SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Growth factor receptor domain alignments in Pan troglodytes 69_2.1.4

These alignments are sequences aligned to the 0053854 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2dtge6               dicpgtakgktncpatvingqf........................................................
ENSPTRP00000046526  sv............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  s.............................................................................
ENSPTRP00000046968  r.............................................................................
ENSPTRP00000046968  h.............................................................................
ENSPTRP00000035956  gp............................................................................
ENSPTRP00000035956  dg............................................................................
ENSPTRP00000046968  d.............................................................................
ENSPTRP00000035956  g.............................................................................
ENSPTRP00000035956  d.............................................................................
ENSPTRP00000032807  v.............................................................................
ENSPTRP00000022058  fvhcepcdekal..................................................................
ENSPTRP00000021397  hin...........................................................................
ENSPTRP00000046968  y.............................................................................
ENSPTRP00000015555  aih...........................................................................
ENSPTRP00000032748  vv............................................................................
ENSPTRP00000022026  v.............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  s.............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  cetglh........................................................................
ENSPTRP00000010754  ank...........................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  w.............................................................................
ENSPTRP00000049039  d.............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  q.............................................................................
ENSPTRP00000005841  id............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  e.............................................................................
ENSPTRP00000022056  lfrcppctperlaacgpppvappaavaavaggarmpcaelvrepg.................................
ENSPTRP00000034969  hm............................................................................
ENSPTRP00000029424  d.............................................................................
ENSPTRP00000034969  y.............................................................................
ENSPTRP00000012046  cm............................................................................
ENSPTRP00000056675  dv............................................................................
ENSPTRP00000049039  mdv...........................................................................
ENSPTRP00000060075  cvdid.........................................................................
ENSPTRP00000029424  cv............................................................................
ENSPTRP00000012046  clqng.........................................................................
ENSPTRP00000029424  d.............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  qg............................................................................
ENSPTRP00000012046  l.............................................................................
ENSPTRP00000012792  ivgnkppkecgdlcpgtmeekpmcekttinneyn............................................
ENSPTRP00000012046  nv............................................................................
ENSPTRP00000049039  cgs...........................................................................
ENSPTRP00000012046  decke.........................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  sr............................................................................
ENSPTRP00000018880  s.............................................................................
ENSPTRP00000000970  qa............................................................................
ENSPTRP00000056675  d.............................................................................
ENSPTRP00000049039  vg............................................................................
ENSPTRP00000021546  gkycsm........................................................................
ENSPTRP00000012046  ffk...........................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  dv............................................................................
ENSPTRP00000046479  qhrh..........................................................................
ENSPTRP00000022516  g.............................................................................
ENSPTRP00000029424  fy............................................................................
ENSPTRP00000006720  cvdid.........................................................................
ENSPTRP00000003607  dsr...........................................................................
ENSPTRP00000017888  kchsgecitldkvcnmardcrdwsdepikec...............................................
ENSPTRP00000029424  k.............................................................................
ENSPTRP00000034969  n.............................................................................
ENSPTRP00000028112  c.............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  d.............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  rregqdcgv.....................................................................
ENSPTRP00000027670  tcgpcepascpplpplg.............................................................
ENSPTRP00000035066  g.............................................................................
ENSPTRP00000029424  dr............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  neecgdicpgtakgktncpatvingqf...................................................
ENSPTRP00000049039  fy............................................................................
ENSPTRP00000024985  d.............................................................................
ENSPTRP00000049039  d.............................................................................
ENSPTRP00000056512  pa............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  qcsp..........................................................................
ENSPTRP00000023256  dq............................................................................
ENSPTRP00000029424  l.............................................................................
ENSPTRP00000005041  gcapcrpeecaaprg...............................................................
ENSPTRP00000011096  tn............................................................................
ENSPTRP00000012755  s.............................................................................
ENSPTRP00000006692  ceagd.........................................................................
ENSPTRP00000049039  c.............................................................................
ENSPTRP00000012046  ceg...........................................................................
ENSPTRP00000011096  v.............................................................................
ENSPTRP00000046310  wpckcphqk.....................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ei............................................................................
ENSPTRP00000035113  qr............................................................................
ENSPTRP00000036737  w.............................................................................
ENSPTRP00000025264  i.............................................................................
ENSPTRP00000006692  cgdgg.........................................................................
ENSPTRP00000052123  tpctcpwppp....................................................................
ENSPTRP00000002974  qnv...........................................................................
ENSPTRP00000029424  cssg..........................................................................
ENSPTRP00000011096  td............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  cdg...........................................................................
ENSPTRP00000006173  gee...........................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000011096  clt...........................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  scpegtlagngnstcvgpapflifshgnsifridtegtnyeqlvvdagvsvimdfhynekriywvdlerqllqrvfln
ENSPTRP00000025264  ckd...........................................................................
ENSPTRP00000057474  gelcd.........................................................................
ENSPTRP00000035842  kcgpcrpegcpapapcpapgisaldec...................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  aachcpleapk...................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  trrti.........................................................................
ENSPTRP00000036924  ac............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  cakttfsghtdy..................................................................
ENSPTRP00000018116  e.............................................................................
ENSPTRP00000018880  cl............................................................................
ENSPTRP00000018116  c.............................................................................
ENSPTRP00000028897  ya............................................................................
ENSPTRP00000046479  p.............................................................................
ENSPTRP00000018085  cgrfs.........................................................................
ENSPTRP00000020306  ceeprncsgsivqg................................................................
ENSPTRP00000020087  ca............................................................................
ENSPTRP00000031762  pcrcsdepap....................................................................
ENSPTRP00000012046  d.............................................................................
ENSPTRP00000035228  wpcecppspp....................................................................
ENSPTRP00000006692  td............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  fcrpgsvl......................................................................
ENSPTRP00000018880  gykr..........................................................................
ENSPTRP00000006692  cpdgkgytqdnnivnygipahr........................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  aq............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  tehd..........................................................................
ENSPTRP00000027395  p.............................................................................
ENSPTRP00000029424  hp............................................................................
ENSPTRP00000049039  di............................................................................
ENSPTRP00000059022  e.............................................................................
ENSPTRP00000056675  scrpgqh.......................................................................
ENSPTRP00000018116  dvde..........................................................................
ENSPTRP00000006720  pds...........................................................................
ENSPTRP00000044502  cam...........................................................................
ENSPTRP00000022833  wd............................................................................
ENSPTRP00000049157  ss............................................................................
ENSPTRP00000029424  qtidi.........................................................................
ENSPTRP00000021397  riap..........................................................................
ENSPTRP00000059022  c.............................................................................
ENSPTRP00000034342  decs..........................................................................
ENSPTRP00000024260  qcfrg.........................................................................
ENSPTRP00000022834  kyg...........................................................................
ENSPTRP00000061259  tg............................................................................
ENSPTRP00000018880  ecgild........................................................................
ENSPTRP00000059022  dciaa.........................................................................
ENSPTRP00000049039  idi...........................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  l.............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  lcd...........................................................................
ENSPTRP00000011096  aee...........................................................................
ENSPTRP00000049062  cat...........................................................................
ENSPTRP00000046479  eecg..........................................................................
ENSPTRP00000049039  wa............................................................................
ENSPTRP00000049510  i.............................................................................
ENSPTRP00000052704  r.............................................................................
ENSPTRP00000005841  e.............................................................................
ENSPTRP00000005841  s.............................................................................
ENSPTRP00000034549  s.............................................................................
ENSPTRP00000000195  dp............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  pe............................................................................
ENSPTRP00000046227  ea............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  tvdkk.........................................................................
ENSPTRP00000058611  vas...........................................................................
ENSPTRP00000015610  qaslk.........................................................................
ENSPTRP00000026114  pigkcs........................................................................
ENSPTRP00000056656  r.............................................................................
ENSPTRP00000033933  rch...........................................................................
ENSPTRP00000033400  vtg...........................................................................
ENSPTRP00000000400  q.............................................................................
ENSPTRP00000033908  gg............................................................................
ENSPTRP00000031479  ig............................................................................
ENSPTRP00000049082  csy...........................................................................
ENSPTRP00000036926  tcdghracstyrtiyrtayrrspglaparpr...............................................
ENSPTRP00000028833  gqfngkrctdavgdr...............................................................
ENSPTRP00000008485  sigcgfrpg.....................................................................
ENSPTRP00000001800  nvmngvasycr...................................................................
ENSPTRP00000002992  iqsfl.........................................................................
ENSPTRP00000058611  aytsecf.......................................................................
ENSPTRP00000000553  k.............................................................................
ENSPTRP00000018082  gavtqk........................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  vtc...........................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  gsrqervcnieknvsgmainwineeviwsnqqegiitvtdmkgnnshvllsalkypaniavdpverfifwssevagsl
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  ..............................................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  ..............................................................................
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  ..............................................................................
ENSPTRP00000008485  ..............................................................................
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  yradldgvgvkalletsekitavsldvldkrlfwiqynregsnslicscdydggsvhiskhptqhnlfamslfgdrif
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  ..............................................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  ..............................................................................
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  ..............................................................................
ENSPTRP00000008485  ..............................................................................
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                         10         
                                                                                          |         
d2dtge6               ...........................................................----------...------
ENSPTRP00000046526  ...........................................................----------...------
ENSPTRP00000035956  ...........................................................----------...----CK
ENSPTRP00000035956  ...........................................................----------...----CK
ENSPTRP00000046968  ...........................................................----------...----CK
ENSPTRP00000046968  ...........................................................----------...---SCA
ENSPTRP00000035956  ...........................................................----------...------
ENSPTRP00000035956  ...........................................................----------...---ICE
ENSPTRP00000046968  ...........................................................----NHVCQP...CNTHCG
ENSPTRP00000035956  ...........................................................----------...--NTCL
ENSPTRP00000035956  ...........................................................----------...----CE
ENSPTRP00000032807  ...........................................................----------...------
ENSPTRP00000022058  ...........................................................----------...------
ENSPTRP00000021397  ...........................................................----------...---ECL
ENSPTRP00000046968  ...........................................................----------...----CA
ENSPTRP00000015555  ...........................................................----------...------
ENSPTRP00000032748  ...........................................................----------...------
ENSPTRP00000022026  ...........................................................----------...------
ENSPTRP00000015508  ...........................................................----------...------
ENSPTRP00000057474  ...........................................................-CVAEALLCN...GQDDCG
ENSPTRP00000035956  ...........................................................----------...----CE
ENSPTRP00000032807  ...........................................................----------...----CQ
ENSPTRP00000006428  ...........................................................-CPVGFSMTEta.VGIRCT
ENSPTRP00000003607  ...........................................................----------...------
ENSPTRP00000010754  ...........................................................----------...--ETCE
ENSPTRP00000011321  ...........................................................ICRFGYQMDE...SN-QCV
ENSPTRP00000032747  ...........................................................----------...------
ENSPTRP00000049039  ...........................................................----------...-VNECT
ENSPTRP00000046968  ...........................................................----------...------
ENSPTRP00000012046  ...........................................................--------CN...DRNECQ
ENSPTRP00000005841  ...........................................................----------...---ECQ
ENSPTRP00000022026  ...........................................................----------...----CG
ENSPTRP00000029424  ...........................................................----------...----CI
ENSPTRP00000022056  ...........................................................----------...------
ENSPTRP00000034969  ...........................................................----------...----CS
ENSPTRP00000029424  ...........................................................----------...-VNECL
ENSPTRP00000034969  ...........................................................----------...----CA
ENSPTRP00000012046  ...........................................................----------...DIDECQ
ENSPTRP00000056675  ...........................................................----------...--DECV
ENSPTRP00000049039  ...........................................................----------...--DECA
ENSPTRP00000060075  ...........................................................----------...------
ENSPTRP00000029424  ...........................................................----------...DRNECL
ENSPTRP00000012046  ...........................................................----------...------
ENSPTRP00000029424  ...........................................................----------...---ECS
ENSPTRP00000002974  ...........................................................QCPSGFTLDS...VGPFCA
ENSPTRP00000031716  ...........................................................----------...------
ENSPTRP00000012046  ...........................................................----------...--NECN
ENSPTRP00000012792  ...........................................................------Y---...------
ENSPTRP00000012046  ...........................................................----------...-TDYCQ
ENSPTRP00000049039  ...........................................................----GLGITTdgrDINECA
ENSPTRP00000012046  ...........................................................----------...------
ENSPTRP00000036737  ...........................................................-CPEGFELDS...QGAFCV
ENSPTRP00000015508  ...........................................................----------...---ACH
ENSPTRP00000018880  ...........................................................----------...CQDDCT
ENSPTRP00000000970  ...........................................................-CAKGCELCS...EVNGCL
ENSPTRP00000056675  ...........................................................----------...---ECR
ENSPTRP00000049039  ...........................................................----------...-RNECR
ENSPTRP00000021546  ...........................................................----------...-----T
ENSPTRP00000012046  ...........................................................----------...DINECK
ENSPTRP00000012046  ...........................................................----GKTGCT...DINECE
ENSPTRP00000005841  ...........................................................----------...--DECA
ENSPTRP00000046479  ...........................................................----------...------
ENSPTRP00000022516  ...........................................................----------...----CI
ENSPTRP00000029424  ...........................................................---------K...DINECK
ENSPTRP00000006720  ...........................................................----------...------
ENSPTRP00000003607  ...........................................................----------...--QTCA
ENSPTRP00000017888  ...........................................................----------...GTNECL
ENSPTRP00000029424  ...........................................................----GTTGCT...DVDECE
ENSPTRP00000034969  ...........................................................----------...---YCA
ENSPTRP00000028112  ...........................................................----------...-----P
ENSPTRP00000024985  ...........................................................----------...------
ENSPTRP00000029424  ...........................................................----------...---ECA
ENSPTRP00000021397  ...........................................................-CPDGSDEGD...LCDECS
ENSPTRP00000008515  ...........................................................----------...------
ENSPTRP00000027670  ...........................................................----------...------
ENSPTRP00000035066  ...........................................................----------...----CL
ENSPTRP00000029424  ...........................................................------QGCT...DIDECM
ENSPTRP00000025197  ...........................................................QCGLGYFEAErnaSHLVCS
ENSPTRP00000022729  ...........................................................-CLPGWMGQN...CDININ
ENSPTRP00000017670  ...........................................................----------...------
ENSPTRP00000049039  ...........................................................---------K...DVNECK
ENSPTRP00000024985  ...........................................................----------...-VNECQ
ENSPTRP00000049039  ...........................................................----------...---ECT
ENSPTRP00000056512  ...........................................................----------...------
ENSPTRP00000022834  ...........................................................----------...------
ENSPTRP00000026116  ...........................................................----------...-----L
ENSPTRP00000023256  ...........................................................----------...----CA
ENSPTRP00000029424  ...........................................................----------...------
ENSPTRP00000005041  ...........................................................-CLAGWVRDA...CG-CCW
ENSPTRP00000011096  ...........................................................----------...------
ENSPTRP00000012755  ...........................................................----------...------
ENSPTRP00000006692  ...........................................................----------...------
ENSPTRP00000049039  ...........................................................---------H...DLDECV
ENSPTRP00000012046  ...........................................................----------...------
ENSPTRP00000011096  ...........................................................----------...------
ENSPTRP00000046310  ...........................................................----------...------
ENSPTRP00000046227  ...........................................................ICPAGYAGRF...CEIDHD
ENSPTRP00000049082  ...........................................................TCVKGFVGLH...CETEVN
ENSPTRP00000059463  ...........................................................KCLPGYAGSW...CEIDID
ENSPTRP00000032142  ...........................................................RCPVGYSGFN...CEKKID
ENSPTRP00000046479  ...........................................................----------...--NECT
ENSPTRP00000035113  ...........................................................----------...------
ENSPTRP00000036737  ...........................................................----------...------
ENSPTRP00000025264  ...........................................................----------...------
ENSPTRP00000006692  ...........................................................----------...------
ENSPTRP00000052123  ...........................................................----------...------
ENSPTRP00000002974  ...........................................................----------...------
ENSPTRP00000029424  ...........................................................-----VGITVdgrDINECA
ENSPTRP00000011096  ...........................................................----------...------
ENSPTRP00000036924  ...........................................................KCVAGYHGVN...CSEEID
ENSPTRP00000029424  ...........................................................----------...------
ENSPTRP00000006173  ...........................................................----------...---NCN
ENSPTRP00000046526  ...........................................................----------...------
ENSPTRP00000021546  ...........................................................-CPNGTDESPlc.NGNSCS
ENSPTRP00000011096  ...........................................................----------...------
ENSPTRP00000018116  ...........................................................ECLPGYNGDN...CEDDVD
ENSPTRP00000028112  ysiwkmktiwiankhtgkdmvrinlhspfvppgelkvvhplaqpkaeddtwepeqklrk----------...------
ENSPTRP00000025264  ...........................................................----------...------
ENSPTRP00000057474  ...........................................................----------...---QCS
ENSPTRP00000035842  ...........................................................----------...------
ENSPTRP00000041706  ...........................................................-CSPGFEGAD...CGVEVD
ENSPTRP00000001581  ...........................................................-CAPGVGLVR...DGCGCC
ENSPTRP00000048671  ...........................................................QCPEGYFGSA...CEEKVD
ENSPTRP00000036924  ...........................................................-CPAGFSGIH...CENNTP
ENSPTRP00000002974  ...........................................................----------...------
ENSPTRP00000036924  ...........................................................--------SQ...DVDECS
ENSPTRP00000018880  ...........................................................----------...------
ENSPTRP00000002493  ...........................................................----------...------
ENSPTRP00000018116  ...........................................................----------...------
ENSPTRP00000018880  ...........................................................---EGDFCFP...HG----
ENSPTRP00000018116  ...........................................................--------DQ...DVDECS
ENSPTRP00000028897  ...........................................................----------...------
ENSPTRP00000046479  ...........................................................----------...------
ENSPTRP00000018085  ...........................................................----------...------
ENSPTRP00000020306  ...........................................................----------...------
ENSPTRP00000020087  ...........................................................----------...------
ENSPTRP00000031762  ...........................................................----------...------
ENSPTRP00000012046  ...........................................................----------...-INECA
ENSPTRP00000035228  ...........................................................----------...------
ENSPTRP00000006692  ...........................................................----------...---ECR
ENSPTRP00000036924  ...........................................................VCPTGWQGQT...CEVDIN
ENSPTRP00000049082  ...........................................................----------...------
ENSPTRP00000018880  ...........................................................----------...------
ENSPTRP00000006692  ...........................................................----------...DIDECM
ENSPTRP00000018116  ...........................................................RCPSGTTGVN...CEVNID
ENSPTRP00000044880  ...........................................................ECPPNFTGSN...CEKKVD
ENSPTRP00000025264  ...........................................................----------...------
ENSPTRP00000028078  ...........................................................----------...------
ENSPTRP00000011096  ...........................................................----------...------
ENSPTRP00000036924  ...........................................................-CLKGTTGPN...CEINLD
ENSPTRP00000028078  ...........................................................-CCWGWARQS...WG-QCQ
ENSPTRP00000032142  ...........................................................-CQEGWGGLF...CNQDLN
ENSPTRP00000005988  ...........................................................----------...---ECG
ENSPTRP00000027395  ...........................................................----------...------
ENSPTRP00000029424  ...........................................................----------...------
ENSPTRP00000049039  ...........................................................----------...--DECG
ENSPTRP00000059022  ...........................................................----------...------
ENSPTRP00000056675  ...........................................................----------...------
ENSPTRP00000018116  ...........................................................----------...------
ENSPTRP00000006720  ...........................................................----------...------
ENSPTRP00000044502  ...........................................................----------...------
ENSPTRP00000022833  ...........................................................----------...----CS
ENSPTRP00000049157  ...........................................................----------...------
ENSPTRP00000029424  ...........................................................----------...------
ENSPTRP00000021397  ...........................................................----------...TEYTCE
ENSPTRP00000059022  ...........................................................----------...-QDHVN
ENSPTRP00000034342  ...........................................................----------...------
ENSPTRP00000024260  ...........................................................----------...---RCH
ENSPTRP00000022834  ...........................................................----------...----CS
ENSPTRP00000061259  ...........................................................----------...----CS
ENSPTRP00000018880  ...........................................................----------...------
ENSPTRP00000059022  ...........................................................----------...------
ENSPTRP00000049039  ...........................................................----------...------
ENSPTRP00000001803  ...........................................................RCPPGFTGDY...CETEVD
ENSPTRP00000025264  ...........................................................----------...------
ENSPTRP00000017658  ...........................................................---PGNFSCT...DINECL
ENSPTRP00000029913  ...........................................................---------E...VIDHCV
ENSPTRP00000011096  ...........................................................----------...------
ENSPTRP00000049062  ...........................................................----------...------
ENSPTRP00000046479  ...........................................................----------...------
ENSPTRP00000049039  ...........................................................-------QCV...DENECA
ENSPTRP00000049510  ...........................................................----------...--NECL
ENSPTRP00000052704  ...........................................................----------...------
ENSPTRP00000005841  ...........................................................----------...------
ENSPTRP00000005841  ...........................................................----------...----CM
ENSPTRP00000034549  ...........................................................----------...------
ENSPTRP00000000195  ...........................................................----------...------
ENSPTRP00000061149  ...........................................................-CNCSVVGRL...DVNRCN
ENSPTRP00000059022  ...........................................................VCDVGWTGPE...CEAELG
ENSPTRP00000059022  ...........................................................----------...------
ENSPTRP00000034924  ...........................................................KCDNNQYFDI...SALSCV
ENSPTRP00000046227  ...........................................................----------...------
ENSPTRP00000004949  ...........................................................----------...------
ENSPTRP00000003938  ...........................................................----------...------
ENSPTRP00000058611  ...........................................................----------...------
ENSPTRP00000015610  ...........................................................----------...------
ENSPTRP00000026114  ...........................................................----------...------
ENSPTRP00000056656  ...........................................................----------...------
ENSPTRP00000033933  ...........................................................-CEPGYEEGG...SGEGCV
ENSPTRP00000033400  ...........................................................----------...------
ENSPTRP00000000400  ...........................................................----------...------
ENSPTRP00000033908  ...........................................................----------...------
ENSPTRP00000031479  ...........................................................----------...------
ENSPTRP00000049082  ...........................................................-------LCD...EGKDCC
ENSPTRP00000036926  ...........................................................----------...------
ENSPTRP00000028833  ...........................................................----------...------
ENSPTRP00000008485  ...........................................................----------...------
ENSPTRP00000001800  ...........................................................----------...------
ENSPTRP00000002992  ...........................................................----------...------
ENSPTRP00000058611  ...........................................................----------...------
ENSPTRP00000000553  ...........................................................----------...------
ENSPTRP00000018082  ...........................................................----------...------
ENSPTRP00000025264  ...........................................................-CAAGQQWAI...DNDECL
ENSPTRP00000037768  ...........................................................----------...-----Q


                                  20                            30                                40
                                   |                             |                                 |
d2dtge6               -......-....--..........--Ve....RC...W-.TH.SHCQ..................KV.....CPT.IC
ENSPTRP00000046526  -......C....HP..........ECGdk...GC...DG.PN.ADQClncvhfslgsvktsrkcvSV.....CPL.GY
ENSPTRP00000035956  P......C....HV..........KCF.....HC...MG.PA.EDQCqtcprnslllnttcv...KD.....CPE.GY
ENSPTRP00000035956  K......C....DI..........SCL.....TC...NG.PG.FKNC..................TS.....CPS.GY
ENSPTRP00000046968  V......C....HN..........SCA.....SC...SG.PT.ASHCtacsppkalrqghcl...PR.....CGE.GF
ENSPTRP00000046968  V......C....HE..........SCA.....GC...WG.PT.EKHClacrdplhvlrdggce..SS.....CGK.GF
ENSPTRP00000035956  -......C....DP..........ECSev...GC...DG.PG.PDHCndclhyyyklknntrvcvSS.....CPP.GH
ENSPTRP00000035956  R......C....SS..........PCR.....TC...E-.GN.ATNC..................HS.....CEG.GL
ENSPTRP00000046968  S......C....DSqa........SCT.....S-...--.--.---Crdpnkvllfgecqy....ES.....CAP.QY
ENSPTRP00000035956  P......C....PD..........NCE.....LC...--.HS.VHVC..................TR.....CVK.GY
ENSPTRP00000035956  S......C....HR..........ACE.....TC...TG.PG.HDEC..................SS.....CRE.GL
ENSPTRP00000032807  -......C....HA..........LCSpe...GC...WG.PE.PRDC..................VS.....CRN.VS
ENSPTRP00000022058  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000021397  S......Kk...VS..........GCSq....DC...QD.LP.VSYK..................CK.....CWP.GF
ENSPTRP00000046968  D......C....HH..........LCQ.....HCaadLH.NT.GSIClrcqnahylllgdhcv..PD.....CPS.GY
ENSPTRP00000015555  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000032748  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000022026  -......C....NH..........LCSsd...GC...WG.PG.PDQC..................LL.....CRR.FS
ENSPTRP00000015508  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000057474  DssdergC....HIneclsrkls.GCSq....DC...ED.LK.IGFK..................CR.....CRP.GF
ENSPTRP00000035956  R......C....NR..........SCK.....GC...QG.PR.PTDClscdrfffllrskgech.RS.....CPD.HY
ENSPTRP00000032807  K......C....DP..........SCPng...SC...WG.AG.EENCqkltk.............II.....CAQ.QC
ENSPTRP00000006428  Dide...Cv...TS..........SCEg....HC...VN.TE.GGFV..................CE.....CGP.GM
ENSPTRP00000003607  N......C....DI..........PQRa....RC...IYtGG.SSYT..................CS.....CLP.GF
ENSPTRP00000010754  H......N....HR..........QCSrha..FC...TD.YA.TGFC..................CH.....CQS.KF
ENSPTRP00000011321  Dvde...Catd.SH..........QCNptq..IC...IN.TE.GGYT..................CS.....CTD.GY
ENSPTRP00000032747  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000049039  E......N....PG..........VCTng...IC...VN.TD.GSFR..................CE.....CPF.GY
ENSPTRP00000046968  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000012046  E......I....PN..........ICShg...QC...ID.TV.GSFY..................CL.....CHT.GF
ENSPTRP00000005841  T......R....NG..........GCDh....FC...KN.TV.GSFD..................CS.....CKK.GF
ENSPTRP00000022026  R......C....HK..........SCTg....RC...WG.PT.ENHCqtltr.............TV.....CAE.QC
ENSPTRP00000029424  Q......N....GV..........LCKng...RC...VN.TD.GSFQ..................CI.....CNA.GF
ENSPTRP00000022056  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000034969  T......L....EH..........NCAh....FC...IN.IP.GSYI..................CR.....CKQ.GY
ENSPTRP00000029424  E......S....PG..........ICSng...QC...IN.TD.GSFR..................CE.....CPM.GY
ENSPTRP00000034969  S......E....NH..........GCEh....EC...VN.AD.GSYL..................CQ.....CHE.GF
ENSPTRP00000012046  R......D....PL..........LCRgg...VC...HN.TE.GSYR..................CE.....CPP.GH
ENSPTRP00000056675  E......G....TD..........NCHida..IC...QN.TP.RSYK..................CI.....CKS.GY
ENSPTRP00000049039  R......D....PL..........LCRgg...TC...TN.TD.GSYK..................CQ.....CPP.GR
ENSPTRP00000060075  E......Cti..PP..........YCHq....RC...VN.TP.GSFY..................CQ.....CSP.GF
ENSPTRP00000029424  E......I....PN..........VCShg...LC...VD.LQ.GSYQ..................CI.....CHN.GF
ENSPTRP00000012046  -......-....-R..........ICNng...RC...IN.TD.GSFH..................CV.....CNA.GF
ENSPTRP00000029424  Q......S....PK..........PCNf....IC...KN.TE.GSYQ..................CS.....CPR.GY
ENSPTRP00000002974  Dede...Caa..GN..........PCSh....TC...HN.AM.GTYY..................CS.....CPK.GL
ENSPTRP00000031716  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000012046  Q......A....PK..........PCNf....IC...KN.TE.GSYQ..................CS.....CPK.GY
ENSPTRP00000012792  -......-....--..........---.....RC...W-.TT.NRCQ..................KM.....CPS.TC
ENSPTRP00000012046  L......V....RY..........LCQng...RC...IP.TP.GSYR..................CE.....CNK.GF
ENSPTRP00000049039  L......D....PE..........VCAng...VC...EN.LR.GSYR..................CV.....CNL.GY
ENSPTRP00000012046  -......-....PD..........VCKhg...QC...IN.TD.GSYR..................CE.....CPF.GY
ENSPTRP00000036737  Drde...Csgg.PS..........PCSh....AC...LN.AP.GRFS..................CT.....CPT.GF
ENSPTRP00000015508  P......C....SP..........MCKgs...RC...WG.ES.SEDCqsltr.............TV.....CAG.GC
ENSPTRP00000018880  Q......S....PG..........LCGrg...AC...KN.LP.GSFR..................CV.....CPV.GF
ENSPTRP00000000970  K......C....SP..........KLFillerND...IR.QV.GVCL..................PS.....CPP.GY
ENSPTRP00000056675  L......N....NG..........GCDh....IC...RN.TV.GSFE..................CS.....CKK.GY
ENSPTRP00000049039  E......I....PN..........VCShg...DC...MD.TE.GSYM..................CL.....CHR.GF
ENSPTRP00000021546  L......Cs...AL..........NCQy....QC...HE.TP.YGGA..................CF.....CPP.GY
ENSPTRP00000012046  M......I....PS..........LCThg...KC...RN.TI.GSFK..................CR.....CDS.GF
ENSPTRP00000012046  I......G....AH..........NCGkha..VC...TN.TA.GSFK..................CS.....CSP.GW
ENSPTRP00000005841  Q......G....LD..........DCHada..LC...QN.TP.TSYK..................CS.....CKP.GY
ENSPTRP00000046479  -......-....--..........LCAhg...QC...RN.TE.GSFQ..................CV.....CDQ.GY
ENSPTRP00000022516  I......C....SEen........GCS.....TC...QQ.RL.FLFIhregirqygkcl......HD.....CPP.GY
ENSPTRP00000029424  A......F....PG..........MCTyg...KC...RN.TI.GSFK..................CR.....CNS.GF
ENSPTRP00000006720  E......Cr...YR..........YCQh....RC...VN.LP.GSFR..................CQ.....CEP.GF
ENSPTRP00000003607  N......N....RH..........QCSvha..EC...RD.YA.TGFC..................CS.....CVA.GY
ENSPTRP00000017888  D......N....NG..........GCSh....VC...ND.LK.IGYE..................CL.....CPD.GF
ENSPTRP00000029424  I......G....AH..........NCDmha..SC...LN.IP.GSFK..................CS.....CRE.GW
ENSPTRP00000034969  L......N....KP..........GCEh....EC...VN.TE.ESYY..................CR.....CHR.GY
ENSPTRP00000028112  S......N....VS..........ECSh....DC...VL.TS.EGPL..................CF.....CPE.GS
ENSPTRP00000024985  -......-....--..........---.....TC...IN.TE.GSYT..................CQknvpnCGR.GY
ENSPTRP00000029424  E......N....IN..........LCEng...QC...LN.VP.GAYR..................CE.....CEM.GF
ENSPTRP00000021397  L......N....NG..........GCSn....HCs..VV.PG.RGIV..................CS.....CPE.GL
ENSPTRP00000008515  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000027670  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000035066  S......Csk..DN..........GCS.....RC...QQ.KL.FFFLrregmrqygecl......HS.....CPS.GY
ENSPTRP00000029424  I......M....NG..........GCDt....QC...TN.SE.GSYE..................CS.....CSE.GY
ENSPTRP00000025197  A......C....FG..........PCA.....RC...SG.PE.ESNC..................LQ.....CKK.GW
ENSPTRP00000022729  D......C....LG..........QCQnda..SC...RD.LV.NGYR..................CI.....CPP.GY
ENSPTRP00000017670  -......-....--..........--Ve....RC...W-.TH.SHCQ..................KV.....CPT.IC
ENSPTRP00000049039  V......F....PG..........LCThg...TC...RN.TV.GSFH..................CA.....CVG.GF
ENSPTRP00000024985  R......Y....PGr.........LCGh....KC...EN.TL.GSYL..................CS.....CSV.GF
ENSPTRP00000049039  S......R....QH..........NCQf....LC...VN.TV.GTFT..................CR.....CPP.GF
ENSPTRP00000056512  -......C....DE..........SCK.....TC...SG.LT.NRDC..................GE.....CEV.GW
ENSPTRP00000022834  -......-....DS..........PCAq....EC...VN.TP.GGFR..................CE.....CWV.GY
ENSPTRP00000026116  P......C....NE..........DGYm....SC...KD.GK.ASFT..................CT.....CKP.GW
ENSPTRP00000023256  E......G....GH..........GCQh....QC...VN.AW.AMFH..................CT.....CNP.GY
ENSPTRP00000029424  -......-....--..........-CAf....RC...MN.TF.GSYE..................CT.....CPI.GY
ENSPTRP00000005041  -......-....--..........---.....EC...AN.LE.GQLCdldpsahfy.........G-.....---.--
ENSPTRP00000011096  -......-....--..........VCGpg...TC...VN.LP.DGYR..................CV.....CSP.GY
ENSPTRP00000012755  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000006692  -......-....--..........VCDng...IC...SN.TP.GSFQ..................CQ.....CLS.GY
ENSPTRP00000049039  S......Q....EH..........RCSprg..DC...LN.VP.GSYR..................CT.....CRQ.GF
ENSPTRP00000012046  -......-....NH..........RCQh....GC...QN.II.GGYR..................CS.....CPQ.GY
ENSPTRP00000011096  -......-....--..........-CSgg...QC...TN.TE.GSYH..................CE.....CDQ.GY
ENSPTRP00000046310  -......-....--..........---.....--...--.--.----..................PR.....CPP.GV
ENSPTRP00000046227  E......Ca...SS..........PCQnga..VC...QD.GI.DGYS..................CF.....CVP.GY
ENSPTRP00000049082  E......Cq...SN..........PCLnna..VC...ED.QV.GGFL..................CK.....CPP.GF
ENSPTRP00000059463  E......Cl...PS..........PCHngg..TC...HN.LV.GGFS..................CS.....CPD.GF
ENSPTRP00000032142  Y......Cs...SS..........PCSnga..KC...VD.LG.DAYL..................CR.....CQA.GF
ENSPTRP00000046479  V......N....PD..........ICGag...HC...IN.LP.VRYT..................CI.....CYE.GY
ENSPTRP00000035113  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000036737  -......-....--..........---.....--...--.--.----..................--.....CPP.GF
ENSPTRP00000025264  -......-....--..........---.....--...--.--.----..................--.....CAR.GY
ENSPTRP00000006692  -......-....--..........---.....FC...IN.FP.GHYK..................CN.....CYP.GY
ENSPTRP00000052123  -......-....--..........---.....--...--.--.----..................-R.....CPL.GV
ENSPTRP00000002974  -......-....--..........-CRpdq..HC...KN.TR.GGYK..................CIdl...CPN.GM
ENSPTRP00000029424  L......D....PD..........ICAng...IC...EN.LR.GSYR..................CN.....CNS.GY
ENSPTRP00000011096  -......-....--..........PCLgg...HC...VN.TE.GSFN..................CL.....CET.GF
ENSPTRP00000036924  E......Cl...SH..........PCQngg..TC...LD.LP.NTYK..................CS.....CPR.GT
ENSPTRP00000029424  -......-....NH..........RCQh....GC...QN.IL.GGYR..................CG.....CPQ.GY
ENSPTRP00000006173  V......N....NG..........GCAq....KC...QM.VR.GAVQ..................CT.....CHT.GY
ENSPTRP00000046526  -......-....--..........---.....--...--.--.----..................--.....CEP.GT
ENSPTRP00000021546  D......F....NG..........GCTh....EC...VQ.EP.FGAK..................CL.....CPL.GF
ENSPTRP00000011096  -......-....PG..........VCAhg...KC...TN.LE.GSFR..................CS.....CEQ.GY
ENSPTRP00000018116  E......Ca...SQ..........PCQhgg..SC...ID.LV.ARYL..................CS.....CPP.GT
ENSPTRP00000028112  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000025264  -......-....NG..........PCKq....VC...ST.VG.GSAI..................CS.....CFP.GY
ENSPTRP00000057474  Lnngg..C....SH..........NCS.....VA...--.PG.EGIV..................CS.....CPL.GM
ENSPTRP00000035842  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000041706  E......Ca...SR..........PCLngg..HC...QD.LP.NGFQ..................CH.....CPD.GY
ENSPTRP00000001581  Kv.....CakqlNE..........DCS.....KT...QP.CD.HTKG..................LE.....CNF.GA
ENSPTRP00000048671  P......Ca...SS..........PCQnng..TC...YV.DG.VHFT..................CS.....CSP.GF
ENSPTRP00000036924  D......Ct...ES..........SCFngg..TC...VD.GI.NSFT..................CL.....CPP.GF
ENSPTRP00000002974  -......-....--..........---.....--...--.--.---R..................KT.....CPE.GS
ENSPTRP00000036924  L......G....AN..........PCEhag..KC...IN.TL.GSFE..................CQ.....CLQ.GY
ENSPTRP00000018880  -......-....--..........---.....-C...EN.TE.GSFQ..................CV.....CPM.GF
ENSPTRP00000002493  -......-....--..........---.....RC...W-.-T.SSHCqrv...............CP.....CPH.GM
ENSPTRP00000018116  -......Ca...ST..........PCRnga..KC...VD.QP.DGYE..................CR.....CAE.GF
ENSPTRP00000018880  -......-....--..........---.....EC...LN.TD.GSFA..................CT.....CAP.GY
ENSPTRP00000018116  I......G....AN..........PCEhlg..RC...VN.TQ.GSFL..................CQ.....CGR.GY
ENSPTRP00000028897  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000046479  -......-....-S..........TCPde...QC...VN.SP.GSYQ..................CVp....CTE.GF
ENSPTRP00000018085  -......-....--..........---.....DC...WN.TE.GSYD..................CV.....CSP.GY
ENSPTRP00000020306  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000020087  L......N....TH..........GCEh....ICv..ND.RS.GSYH..................CE.....CYE.GY
ENSPTRP00000031762  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000012046  L......D....PD..........ICPng...IC...EN.LR.GTYK..................CI.....CNS.GY
ENSPTRP00000035228  -......-....--..........---.....--...--.--.----..................-R.....CPL.GV
ENSPTRP00000006692  L......N....QN..........ICGhg...EC...VP.GP.PDYS..................CH.....CNP.GY
ENSPTRP00000036924  E......Cv...LS..........PCRhga..SC...QN.TH.GGYR..................CH.....CQA.GY
ENSPTRP00000049082  -......-....--..........---.....--...--.-R.GRMC..................VN.....CPL.GT
ENSPTRP00000018880  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000006692  L......Fg...SE..........ICKeg...KC...VN.TQ.PGYE..................CY.....CKQ.GF
ENSPTRP00000018116  D......Ca...SN..........PCTfg...VC...RD.GI.NRYD..................CV.....CQP.GF
ENSPTRP00000044880  R......Ct...SN..........PCAngg..QC...LN.RG.PSRM..................CR.....CRP.GF
ENSPTRP00000025264  -......-....--..........RCSq....EC...AN.IY.GSYQ..................CY.....CRQ.GY
ENSPTRP00000028078  -......-....--..........---.....--...--.--.----..................--.....--P.GL
ENSPTRP00000011096  -......-....--..........---.....--...--.--.----..................--.....CDG.GY
ENSPTRP00000036924  D......Ca...SS..........PCDsg...TC...LD.KI.DGYE..................CA.....CEP.GY
ENSPTRP00000028078  Pv.....C....QP..........RCKhg...EC...IG.PN.---K..................CK.....CHP.GY
ENSPTRP00000032142  Y......Cth..HK..........PCKnga..TC...TN.TGqGSYT..................CS.....CRP.GY
ENSPTRP00000005988  S......G....QH..........NCDena..IC...TN.TV.QGHS..................CT.....CKP.GY
ENSPTRP00000027395  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000029424  -......-....--..........-CE.....MC...--.--.PAQP..................QP.....CRR.GF
ENSPTRP00000049039  E......I....PA..........ICAng...IC...IN.QI.GSFR..................CE.....CPA.GF
ENSPTRP00000059022  -......Cl...SQ..........PCHpgs..TC...LD.LL.ATFH..................CL.....CPP.GL
ENSPTRP00000056675  -......-....--..........---.....--...--.RA.GTKC..................VS.....CPQ.GT
ENSPTRP00000018116  -......Cag..PA..........PCGphg..IC...TN.LA.GSFS..................CT.....CHG.GY
ENSPTRP00000006720  -......-....--..........---.....--...--.--.---Y..................TE.....CTD.GY
ENSPTRP00000044502  -......-....-I..........NCQy....SC...ED.TE.EGPQ..................CL.....CPSsGL
ENSPTRP00000022833  V......E....NG..........GCEh....AC...NA.IP.GAPR..................CQ.....CPA.GA
ENSPTRP00000049157  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000029424  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000021397  D......N....VN..........PCGdda..YC...NQ.IK.TSVF..................CR.....CKP.GF
ENSPTRP00000059022  P......Ce...SR..........PCQnga..TC...MA.QP.SGYL..................CQ.....CAP.GY
ENSPTRP00000034342  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000024260  P......V....DG..........TCA.....CE...PG.YR.GKYCr.................EP.....CPA.GF
ENSPTRP00000022834  F......N....NG..........GCHq....DCf..EG.ED.GSFL..................CG.....CRP.GF
ENSPTRP00000061259  P......D....NG..........GCEh....EC...VE.EV.DGHVs.................CR.....CTE.GF
ENSPTRP00000018880  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000059022  -......-....--..........TCApgs..TC...ID.RV.GSFS..................CL.....CPP.GR
ENSPTRP00000049039  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000001803  L......Cy...SR..........PCGphg..RC...RS.RE.GGYT..................CL.....CRD.GY
ENSPTRP00000025264  -......-....--..........---.....--...--.--.----..................-T.....CEP.GY
ENSPTRP00000017658  T......St...VC..........PEHs....DC...VN.SM.GSYS..................CS.....CQV.GF
ENSPTRP00000029913  P......E....LN..........LCQhea..KC...IP.LD.KGFR..................CE.....CVP.GY
ENSPTRP00000011096  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000049062  -......-....--..........-CHeha..TC...QQ.RE.GKKI..................CI.....CNY.GF
ENSPTRP00000046479  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000049039  L......S....PP..........TCGsa...SC...RN.TL.GGFR..................CV.....CPS.GF
ENSPTRP00000049510  V......N....NG..........GCSh....IC...KD.LV.IGYE..................CD.....CAA.GF
ENSPTRP00000052704  -......-....--..........---.....--...--.--.----..................CM.....CKA.GF
ENSPTRP00000005841  -......-....--..........---.....--...--.--.-NQC..................VS.....CRA.GT
ENSPTRP00000005841  N......K....DH..........GCSh....ICk..EA.PR.GSVA..................CE.....CRP.GF
ENSPTRP00000034549  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000000195  -......-....--..........---.....--...--.--.---C..................SN.....CPA.GT
ENSPTRP00000061149  Q......T....TG..........QCE.....CR...PG.YQ.GLHC..................ET.....CKE.GF
ENSPTRP00000059022  G......Ci...SA..........PCAhgg..TC...YP.QP.SGYN..................CT.....CPT.GY
ENSPTRP00000059022  -......Ca...DS..........PCRnra..TC...QD.SP.QGPR..................CL.....CPT.GY
ENSPTRP00000034924  P......C....GA..........NQRq....DA...--.--.RGTS..................CV.....CLP.GF
ENSPTRP00000046227  -......-....--..........---.....--...--.--.SGYV..................CI.....CQP.GF
ENSPTRP00000004949  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000003938  V......Cs...SN..........PCQngg..TC...LN.LH.DSFF..................CI.....CPP.QW
ENSPTRP00000058611  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000015610  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000026114  -......-....--..........-CN.....AG...YE.ER.GLMC..................QA.....CRP.GF
ENSPTRP00000056656  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000033933  A......C....PSgsyrmdmdtpHCL.....TC...--.PQ.QSTAesegati...........CT.....CES.GH
ENSPTRP00000033400  -......-....--..........---.....--...--.--.----..................CS.....CAP.GF
ENSPTRP00000000400  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000033908  -......-....--..........---.....--...--.--.----..................CR.....---.--
ENSPTRP00000031479  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000049082  D......R....MA..........SCK.....-C...GT.HT.GHFE..................CI.....CEK.GY
ENSPTRP00000036926  -......-....--..........---.....--...--.--.----..................YA.....CCP.GW
ENSPTRP00000028833  -......-....--..........--R.....QC...VP.T-.-EPCedae..............DD.....CGN.DF
ENSPTRP00000008485  -......-....NF..........SCV.....SA...CG.PR.PTRC..................CI.....TAA.PY
ENSPTRP00000001800  -......-....--..........PCA.....LE...AS.DV.GSSC..................TS.....CPA.GY
ENSPTRP00000002992  Y......C....NE..........NGL.....LG...SF.SE.ETHS..................CT.....CPN.DQ
ENSPTRP00000058611  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000000553  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000018082  -......-....--..........---.....--...--.--.----..................--.....---.--
ENSPTRP00000025264  E......I....PE..........SGTedn..VC...RT.AQ.RHCCvsylqe............KS.....CMA.GV
ENSPTRP00000037768  R......C....GP..........GQElsk..DG...YE.GG.DAYC..................TA.....CPR.RY


                                                     50                                             
                                                      |                                             
d2dtge6               KSH..G.C................T....AEGL.............................................
ENSPTRP00000046526  FGD..T.A................A....RRCR.............................................
ENSPTRP00000035956  YAD..E.D................S....NRCA.............................................
ENSPTRP00000035956  LLD..L.GmcqmgaickdgeyvdeH....GHCQ.............................................
ENSPTRP00000046968  YSD..-.-................H....GVCK.............................................
ENSPTRP00000046968  YNR..-.-................Q....GTCS.............................................
ENSPTRP00000035956  YHA..-.D................K....KRCR.............................................
ENSPTRP00000035956  VLH..-.-................H....GVCQ.............................................
ENSPTRP00000046968  YLD..F.S................T....NTCK.............................................
ENSPTRP00000035956  FIA..P.T................N....HTCQklecgqgevqdpdyeecv...........................
ENSPTRP00000035956  QLL..-.-................R....GVCVhatktqeegkfwndilrkpq.........................
ENSPTRP00000032807  RGR..E.CvdkcnilegeprefveN....SECI.............................................
ENSPTRP00000022058  ---..-.-................-....----.............................................
ENSPTRP00000021397  QLK..D.D................G....KTCV.............................................
ENSPTRP00000046968  YAE..-.-................R....GACK.............................................
ENSPTRP00000015555  ---..-.-................-....--CP.............................................
ENSPTRP00000032748  ---..-.-................-....-RCE.............................................
ENSPTRP00000022026  RGR..I.CiescnlydgefrefenG....SICV.............................................
ENSPTRP00000015508  ---..-.-................-....----.............................................
ENSPTRP00000057474  RLK..D.D................G....RTCA.............................................
ENSPTRP00000035956  YVE..Q.S................T....QTCE.............................................
ENSPTRP00000032807  SGR..C.R................G....KSPS.............................................
ENSPTRP00000006428  QLS..A.D................R....HSCQ.............................................
ENSPTRP00000003607  SGD..-.-................G....QACQ.............................................
ENSPTRP00000010754  YGN..-.-................G....KHCLpegaphrvngkvsghlhvghtpvhftdvdlhayivgndgraytai
ENSPTRP00000011321  WLL..-.-................E....GQCL.............................................
ENSPTRP00000032747  ---..-.-................-....-QCA.............................................
ENSPTRP00000049039  SLD..F.T................G....INCV.............................................
ENSPTRP00000046968  ---..-.-................-....----.............................................
ENSPTRP00000012046  KTN..D.D................Q....TMCL.............................................
ENSPTRP00000005841  KLL..T.D................E....KSCQ.............................................
ENSPTRP00000022026  DGR..C.Y................G....PYVS.............................................
ENSPTRP00000029424  ELT..T.D................G....KNCV.............................................
ENSPTRP00000022056  ---..-.-................-....----.............................................
ENSPTRP00000034969  ILN..S.D................Q....TTCR.............................................
ENSPTRP00000029424  NLD..Y.T................G....VRCV.............................................
ENSPTRP00000034969  ALN..P.D................K....KTCT.............................................
ENSPTRP00000012046  QLS..P.N................I....SACI.............................................
ENSPTRP00000056675  TGD..-.-................G....KHCK.............................................
ENSPTRP00000049039  ELT..A.E................G....TACE.............................................
ENSPTRP00000060075  QLA..A.N................N....YTCV.............................................
ENSPTRP00000029424  KAS..Q.D................Q....TMCM.............................................
ENSPTRP00000012046  HVT..R.D................G....KNCE.............................................
ENSPTRP00000029424  VLQ..E.D................G....KTCK.............................................
ENSPTRP00000002974  TIA..A.D................G....RTCQ.............................................
ENSPTRP00000031716  ---..-.-................-....----.............................................
ENSPTRP00000012046  ILQ..E.D................G....RSCK.............................................
ENSPTRP00000012792  GKR..A.C................T....ENNE.............................................
ENSPTRP00000012046  QLD..-.L................R....GECI.............................................
ENSPTRP00000049039  EAG..A.S................G....KDCT.............................................
ENSPTRP00000012046  ILA..-.-................G....NECV.............................................
ENSPTRP00000036737  ALA..W.D................D....RNCR.............................................
ENSPTRP00000015508  ARC..K.G................P....LPTD.............................................
ENSPTRP00000018880  RGS..A.C................E....EDVD.............................................
ENSPTRP00000000970  FDArnP.D................M....NKCI.............................................
ENSPTRP00000056675  KLL..I.N................E....RNCQ.............................................
ENSPTRP00000049039  QAS..A.D................Q....TLCM.............................................
ENSPTRP00000021546  IIN..HnD................S....RTCV.............................................
ENSPTRP00000012046  ALD..S.E................E....RNCT.............................................
ENSPTRP00000012046  IGD..-.-................G....IKCT.............................................
ENSPTRP00000005841  QGE..-.-................G....RQCE.............................................
ENSPTRP00000046479  RAS..G.L................G....DHCE.............................................
ENSPTRP00000022516  FGI..R.G................Qev..NRCK.............................................
ENSPTRP00000029424  ALD..M.E................E....RNCT.............................................
ENSPTRP00000006720  QLG..P.N................N....RSCV.............................................
ENSPTRP00000003607  TGN..-.-................G....RQCVaegspqrvngkvkgrifvgssqvpivfentdlhsyvvmnhgrsyt
ENSPTRP00000017888  QLV..-.A................Q....RRCE.............................................
ENSPTRP00000029424  IGN..-.-................G....IKCI.............................................
ENSPTRP00000034969  TLD..P.N................G....KTCS.............................................
ENSPTRP00000028112  VLE..R.D................G....KTCS.............................................
ENSPTRP00000024985  HLN..E.E................G....TRCV.............................................
ENSPTRP00000029424  TPA..S.D................S....RSCQ.............................................
ENSPTRP00000021397  QLN..K.D................N....KTCE.............................................
ENSPTRP00000008515  ---..-.-................-....----.............................................
ENSPTRP00000027670  ---..-.-................-....----.............................................
ENSPTRP00000035066  YGHraP.D................M....NRCA.............................................
ENSPTRP00000029424  ALM..P.D................G....RSCA.............................................
ENSPTRP00000025197  ALH..-.-................H....LKCV.............................................
ENSPTRP00000022729  AGD..H.C................E....RDID.............................................
ENSPTRP00000017670  KSH..G.C................T....AEGL.............................................
ENSPTRP00000049039  ALD..A.Q................E....WNCT.............................................
ENSPTRP00000024985  RLS..V.D................G....RSCE.............................................
ENSPTRP00000049039  TQR..-.-................H....QACF.............................................
ENSPTRP00000056512  VLD..-.-................E....GACV.............................................
ENSPTRP00000022834  EPGg.P.G................E....GACQ.............................................
ENSPTRP00000026116  QGE..K.C................E....FDIN.............................................
ENSPTRP00000023256  KLA..A.D................N....KSCL.............................................
ENSPTRP00000029424  ALR..E.D................Q....KMCK.............................................
ENSPTRP00000005041  ---..-.-................-....----.............................................
ENSPTRP00000011096  RLH..P.S................Q....AYCT.............................................
ENSPTRP00000012755  ---..-.-................-....----.............................................
ENSPTRP00000006692  HLS..R.D................R....SHCE.............................................
ENSPTRP00000049039  AGD..-.-................G....FSCE.............................................
ENSPTRP00000012046  LQH..Y.Q................W....NQCV.............................................
ENSPTRP00000011096  IMV..-.R................K....GHCQ.............................................
ENSPTRP00000046310  SLV..R.D................G....CGCC.............................................
ENSPTRP00000046227  QGR..H.C................D....LEVD.............................................
ENSPTRP00000049082  LGT..R.C................G....KNVD.............................................
ENSPTRP00000059463  TGR..A.C................E....RDIN.............................................
ENSPTRP00000032142  SGR..H.C................D....DNVD.............................................
ENSPTRP00000046479  KFS..E.Q................Q....RKCV.............................................
ENSPTRP00000035113  ---..-.-................-....----.............................................
ENSPTRP00000036737  IRQ..-.-................N....GVCT.............................................
ENSPTRP00000025264  HAS..D.D................G....AKCV.............................................
ENSPTRP00000006692  RLK..A.S................Rp...PVCE.............................................
ENSPTRP00000052123  PLV..L.D................G....CGCC.............................................
ENSPTRP00000002974  TKA..-.E................N....GTCI.............................................
ENSPTRP00000029424  EPD..V.S................G....RNCI.............................................
ENSPTRP00000011096  QPS..P.E................S....GECV.............................................
ENSPTRP00000036924  QGV..H.C................E....INVD.............................................
ENSPTRP00000029424  IQH..Y.Q................W....NQCV.............................................
ENSPTRP00000006173  RLT..E.D................G....HTCQ.............................................
ENSPTRP00000046526  YFD..S.E................L....IRCG.............................................
ENSPTRP00000021546  LLA..N.D................S....KTCE.............................................
ENSPTRP00000011096  EVT..S.D................E....KGCQ.............................................
ENSPTRP00000018116  LGV..L.C................E....INED.............................................
ENSPTRP00000028112  ---..-.-................-....----.............................................
ENSPTRP00000025264  AIM..A.D................G....VSCE.............................................
ENSPTRP00000057474  ELG..P.D................N....HTCQ.............................................
ENSPTRP00000035842  ---..-.-................-....----.............................................
ENSPTRP00000041706  AGP..T.C................E....EDVE.............................................
ENSPTRP00000001581  SST..A.L................K....GICR.............................................
ENSPTRP00000048671  TGP..T.C................A....QLID.............................................
ENSPTRP00000036924  TGS..Y.C................Q....HDVN.............................................
ENSPTRP00000002974  EAS..-.-................H....DTCI.............................................
ENSPTRP00000036924  TGP..R.C................E....IDVN.............................................
ENSPTRP00000018880  QPN..A.A................G....SECE.............................................
ENSPTRP00000002493  AC-..-.-................T....ARGE.............................................
ENSPTRP00000018116  EGT..L.C................E....RNVD.............................................
ENSPTRP00000018880  RPG..P.R................G....ASCL.............................................
ENSPTRP00000018116  TGP..R.C................E....TDVN.............................................
ENSPTRP00000028897  ---..-.-................-....---V.............................................
ENSPTRP00000046479  RGW..-.-................N....GQCL.............................................
ENSPTRP00000018085  EPV..S.Gaktfknes........E....NTCQ.............................................
ENSPTRP00000020306  ---..-.-................-....-VCG.............................................
ENSPTRP00000020087  TLN..K.D................R....KTCS.............................................
ENSPTRP00000031762  ---..-.-................-....----.............................................
ENSPTRP00000012046  EVD..S.T................G....KNCV.............................................
ENSPTRP00000035228  SLI..T.D................G....CECC.............................................
ENSPTRP00000006692  RSH..P.Q................H....RYCV.............................................
ENSPTRP00000036924  SGR..N.C................E....TDID.............................................
ENSPTRP00000049082  YYN..L.E................H....FTCE.............................................
ENSPTRP00000018880  --Q..-.-................G....TRCI.............................................
ENSPTRP00000006692  YYD..G.N................L....LECV.............................................
ENSPTRP00000018116  TGP..L.C................N....VEIN.............................................
ENSPTRP00000044880  TGT..Y.C................E....RHIS.............................................
ENSPTRP00000025264  QLA..E.D................G....HTCT.............................................
ENSPTRP00000028078  QLA..P.D................G....RTCV.............................................
ENSPTRP00000011096  RPS..P.L................G....DSCE.............................................
ENSPTRP00000036924  TGS..M.C................N....INID.............................................
ENSPTRP00000028078  AGK..T.C................N....QDLN.............................................
ENSPTRP00000032142  TGA..T.C................E....LGID.............................................
ENSPTRP00000005988  VGN..-.-................G....TICR.............................................
ENSPTRP00000027395  ---..-.-................-....----.............................................
ENSPTRP00000029424  IPN..I.R................T....GACQ.............................................
ENSPTRP00000049039  NYN..S.I................L....LACE.............................................
ENSPTRP00000059022  EGQ..L.C................E....VETN.............................................
ENSPTRP00000056675  YYH..G.Q................T....EQCV.............................................
ENSPTRP00000018116  TGP..S.C................D....QDIN.............................................
ENSPTRP00000006720  EWD..P.D................S....QHCR.............................................
ENSPTRP00000044502  RLA..P.N................G....RDCL.............................................
ENSPTRP00000022833  ALQ..A.D................G....RSCT.............................................
ENSPTRP00000049157  ---..-.-................-....----.............................................
ENSPTRP00000029424  ---..-.-................-....--CK.............................................
ENSPTRP00000021397  QRN..M.K................N....RQCE.............................................
ENSPTRP00000059022  DGQ..N.C................S....KELD.............................................
ENSPTRP00000034342  ---..-.-................-....----.............................................
ENSPTRP00000024260  YGL..G.C................R....RRCG.............................................
ENSPTRP00000022834  RLL..D.D................L....VTCA.............................................
ENSPTRP00000061259  RLA..A.D................G....RSCE.............................................
ENSPTRP00000018880  ---..-.-................-....----.............................................
ENSPTRP00000059022  TGL..L.C................H....LKDM.............................................
ENSPTRP00000049039  ---..-.-................-....--CR.............................................
ENSPTRP00000001803  TGE..H.C................E....VSAR.............................................
ENSPTRP00000025264  ALK..-.-................D....GECE.............................................
ENSPTRP00000017658  ISR..-.-................N....STCE.............................................
ENSPTRP00000029913  SGK..L.C................E....TDND.............................................
ENSPTRP00000011096  ---..-.-................-....----.............................................
ENSPTRP00000049062  VGN..-.G................R....TQCV.............................................
ENSPTRP00000046479  ---..-.-................-....----.............................................
ENSPTRP00000049039  DFD..Q.A................L....GGCQ.............................................
ENSPTRP00000049510  ELI..-.D................R....KTCG.............................................
ENSPTRP00000052704  EAV..E.N................G....TVCR.............................................
ENSPTRP00000005841  YYD..G.A................Q....ERCI.............................................
ENSPTRP00000005841  ELA..K.N................Q....RDCI.............................................
ENSPTRP00000034549  ---..-.-................-....----.............................................
ENSPTRP00000000195  FCD..N.Nr...............N....QICS.............................................
ENSPTRP00000061149  YLN..Y.T................S....GLCQ.............................................
ENSPTRP00000059022  TGP..T.C................S....EEMT.............................................
ENSPTRP00000059022  TGG..S.C................Q....TLMD.............................................
ENSPTRP00000034924  QMI..S.N................NggpaIICK.............................................
ENSPTRP00000046227  TGI..H.C................E....EDVN.............................................
ENSPTRP00000004949  ---..-.-................-....----.............................................
ENSPTRP00000003938  KGS..L.C................S....ADVN.............................................
ENSPTRP00000058611  ---..-.-................-....----.............................................
ENSPTRP00000015610  ---..-.-................-....----.............................................
ENSPTRP00000026114  YKA..L.D................Gn...MKCA.............................................
ENSPTRP00000056656  ---..-.-................-....----.............................................
ENSPTRP00000033933  YRA..P.G................E....GPQV.............................................
ENSPTRP00000033400  EAA..E.G................N....TKCR.............................................
ENSPTRP00000000400  ---..-.-................-....----.............................................
ENSPTRP00000033908  ---..-.-................-....----.............................................
ENSPTRP00000031479  ---..-.-................-....----.............................................
ENSPTRP00000049082  YGK..G.L................Q....YECT.............................................
ENSPTRP00000036926  KRT..S.-................Glp..GACG.............................................
ENSPTRP00000028833  QCS..-.-................T....GRCI.............................................
ENSPTRP00000008485  RGI..S.C................Y....RGLT.............................................
ENSPTRP00000001800  YID..R.D................S....GTCH.............................................
ENSPTRP00000002992  VVC..T.A................F....LPCT.............................................
ENSPTRP00000058611  ---..-.-................-....----.............................................
ENSPTRP00000000553  ---..-.-................-....----.............................................
ENSPTRP00000018082  ---..-.T................K....TSCA.............................................
ENSPTRP00000025264  LGA..K.E................G....ETCG.............................................
ENSPTRP00000037768  KSS..W.G................H....HRCQ.............................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000010754  shipqpaaqallpltpigglfgwlfalekpgsengfslagaafthdmevtfypgeetvritqtaegldpenylsiktn
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  aistipetvgysllplapvggiigwmfaveqdgfkngfsitggeftrqaevtfvghpgnlvikqrfsgidehghltid
ENSPTRP00000017888  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  ..............................................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  ..............................................................................
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  ..............................................................................
ENSPTRP00000008485  ..............................................................................
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000010754  iqgqvpyvpanftahispykelyhysdsavtstssrdysltfgainqtwsyrihqnityqvcrhaprrpsfpttqqln
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  telegrvpqipfgssvhiepytelyhystsvitssstreytvteperdgaspsriytyqwrqtitfqecvhddsrpal
ENSPTRP00000017888  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  ..............................................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  ..............................................................................
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  ..............................................................................
ENSPTRP00000008485  ..............................................................................
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ...........................................C.....CHS.......................ECL
ENSPTRP00000046526  ...........................................R.....CHK.......................GCE
ENSPTRP00000035956  ...........................................H.....CHS.......................SCR
ENSPTRP00000035956  ...........................................T.....CEA.......................SCA
ENSPTRP00000046968  ...........................................A.....CHS.......................SCL
ENSPTRP00000046968  ...........................................A.....CDQ.......................SCD
ENSPTRP00000035956  ...........................................K.....CAP.......................NCE
ENSPTRP00000035956  ...........................................En....CPErhvavegvck.............HCP
ENSPTRP00000046968  ...........................................E.....CDW.......................SCS
ENSPTRP00000035956  ...........................................P.....CEE.......................GCL
ENSPTRP00000035956  ...........................................P.....CHS.......................SCK
ENSPTRP00000032807  ...........................................Q.....CHP.......................ECL
ENSPTRP00000022058  ...........................................-.....---.......................---
ENSPTRP00000021397  ...........................................D.....IDEcssgf..................PCS
ENSPTRP00000046968  ...........................................K.....CHF.......................SCR
ENSPTRP00000015555  ...........................................P.....CSEekla...................RCR
ENSPTRP00000032748  ...........................................P.....CDArala...................QCA
ENSPTRP00000022026  ...........................................E.....CDP.......................QCE
ENSPTRP00000015508  ...........................................-.....CHQ.......................LCA
ENSPTRP00000057474  ...........................................D.....VDEcsttf..................PCS
ENSPTRP00000035956  ...........................................R.....CHP.......................TCD
ENSPTRP00000032807  ...........................................Dc....CHN.......................QCA
ENSPTRP00000006428  ...........................................D.....TDEclgt...................PCQ
ENSPTRP00000003607  ...........................................D.....VDEcqps...................RCH
ENSPTRP00000010754  .......vdrvfalyndeervlrfavtnqigpvkedsdptpvnP.....CYDgsh....................MCD
ENSPTRP00000011321  ...........................................D.....IDEcryg...................YCQ
ENSPTRP00000032747  ...........................................P.....CSAekla...................LCP
ENSPTRP00000049039  ...........................................D.....TDEcsvgh..................PCG
ENSPTRP00000046968  ...........................................-.....CHP.......................DCL
ENSPTRP00000012046  ...........................................D.....INEcerd...................ACG
ENSPTRP00000005841  ...........................................D.....VDEcsldr..................TCD
ENSPTRP00000022026  ...........................................Dc....CHR.......................ECA
ENSPTRP00000029424  ...........................................D.....HDEctttn..................MCL
ENSPTRP00000022056  ...........................................-.....---.......................---
ENSPTRP00000034969  ...........................................I.....QDLcamedh.................NCE
ENSPTRP00000029424  ...........................................D.....TDEcsign..................PCG
ENSPTRP00000034969  ...........................................K.....IDYcassnh.................GCQ
ENSPTRP00000012046  ...........................................D.....INEcelsah.................LCP
ENSPTRP00000056675  ...........................................D.....VDEceredna................GCV
ENSPTRP00000049039  ...........................................D.....IDEcslrdg.................LCP
ENSPTRP00000060075  ...........................................D.....INEcdasn..................QCA
ENSPTRP00000029424  ...........................................D.....VDEcerh...................PCG
ENSPTRP00000012046  ...........................................D.....MDEcsirn..................MCL
ENSPTRP00000029424  ...........................................D.....LDEcqtkqh.................NCQ
ENSPTRP00000002974  ...........................................D.....IDEcalgrh.................TCH
ENSPTRP00000031716  ...........................................-.....CQG.......................GCA
ENSPTRP00000012046  ...........................................D.....LDEcatkqh.................NCQ
ENSPTRP00000012792  ...........................................C.....CHP.......................ECL
ENSPTRP00000012046  ...........................................D.....VDEcekn...................PCA
ENSPTRP00000049039  ...........................................D.....MDEcalnsl.................LCD
ENSPTRP00000012046  ...........................................D.....TDEcsvgn..................PCG
ENSPTRP00000036737  ...........................................D.....VDEcawdah.................LCR
ENSPTRP00000015508  ...........................................C.....CHE.......................QCA
ENSPTRP00000018880  ...........................................E.....CAQepp....................PCG
ENSPTRP00000000970  ...........................................K.....CKIe......................HCE
ENSPTRP00000056675  ...........................................D.....IDEcsfdr..................TCD
ENSPTRP00000049039  ...........................................D.....IDEcdrq...................PCG
ENSPTRP00000021546  ...........................................Efdd..CQIwg.....................ICD
ENSPTRP00000012046  ...........................................D.....IDEcrispd.................LCG
ENSPTRP00000012046  ...........................................D.....LDEcsngth.................MCS
ENSPTRP00000005841  ...........................................D.....IDEcgnelng................GCV
ENSPTRP00000046479  ...........................................D.....INEcledks.................VCQ
ENSPTRP00000022516  ...........................................K.....CGA.......................TCE
ENSPTRP00000029424  ...........................................D.....IDEcrispd.................LCG
ENSPTRP00000006720  ...........................................D.....VNEcdmga..................PCE
ENSPTRP00000003607  pstqqlsvdsvfvlynqeekilryalsnsigpvregspdalqnP.....CYLgth....................GCD
ENSPTRP00000017888  ...........................................D.....IDEcqhpd..................TCS
ENSPTRP00000029424  ...........................................D.....LDEcsngth.................QCS
ENSPTRP00000034969  ...........................................R.....VDHcaqqdh.................GCE
ENSPTRP00000028112  ...........................................G.....CSSpdng...................GCS
ENSPTRP00000024985  ...........................................D.....VDEcappae.................PCG
ENSPTRP00000029424  ...........................................D.....IDEcsfqn..................ICV
ENSPTRP00000021397  ...........................................I.....VDYcsnhl..................KCS
ENSPTRP00000008515  ...........................................-.....---.......................---
ENSPTRP00000027670  ...........................................-.....---.......................---
ENSPTRP00000035066  ...........................................R.....CRIe......................NCD
ENSPTRP00000029424  ...........................................D.....IDEcennpd.................ICD
ENSPTRP00000025197  ...........................................D.....IDEcgtega.................NCG
ENSPTRP00000022729  ...........................................E.....CASn......................PCL
ENSPTRP00000017670  ...........................................C.....CHS.......................ECL
ENSPTRP00000049039  ...........................................D.....IDEccispd.................LCG
ENSPTRP00000024985  ...........................................D.....INEcsss...................PCS
ENSPTRP00000049039  ...........................................D.....NDEcsaqpg.................PCG
ENSPTRP00000056512  ...........................................D.....VDEcaaepp.................PCS
ENSPTRP00000022834  ...........................................D.....VDEcalgrs.................PCA
ENSPTRP00000026116  ...........................................E.....CKDpsning.................GCS
ENSPTRP00000023256  ...........................................A.....IDLcaegth.................GCE
ENSPTRP00000029424  ...........................................D.....LDEcaeglh.................DCE
ENSPTRP00000005041  ...........................................-.....---.......................---
ENSPTRP00000011096  ...........................................D.....DNEclrd...................PCK
ENSPTRP00000012755  ...........................................-.....---.......................---
ENSPTRP00000006692  ...........................................D.....IDEcdfpa..................ACI
ENSPTRP00000049039  ...........................................Drde..CAEnvd....................LCD
ENSPTRP00000012046  ...........................................D.....ENEclsah..................ICG
ENSPTRP00000011096  ...........................................D.....INEcrhpg..................TCP
ENSPTRP00000046310  ...........................................Ki....CAKqpge...................I--
ENSPTRP00000046227  ...........................................E.....CASd......................PCK
ENSPTRP00000049082  ...........................................E.....CLSq......................PCK
ENSPTRP00000059463  ...........................................E.....CLQs......................PCK
ENSPTRP00000032142  ...........................................D.....CASs......................PCA
ENSPTRP00000046479  ...........................................D.....IDEctqvqh.................LCS
ENSPTRP00000035113  ...........................................-.....CPP.......................QCP
ENSPTRP00000036737  ...........................................D.....LDEcrvrn..................LCQ
ENSPTRP00000025264  ...........................................D.....VNEcetgvh.................RCG
ENSPTRP00000006692  ...........................................D.....IDEcrdps..................SCP
ENSPTRP00000052123  ...........................................Rv....CARrlge...................PCD
ENSPTRP00000002974  ...........................................D.....IDEckdgth.................QCR
ENSPTRP00000029424  ...........................................D.....IDEclvnrl.................LCD
ENSPTRP00000011096  ...........................................D.....IDEcedygdp................VCG
ENSPTRP00000036924  ...........................................D.....CNPpvdpvsrsp..............KCF
ENSPTRP00000029424  ...........................................Dene..CSNpn.....................ACG
ENSPTRP00000006173  ...........................................D.....VNEcaeeg..................YCS
ENSPTRP00000046526  ...........................................E.....CHH.......................TCG
ENSPTRP00000021546  ...........................................D.....IDEcdilg..................SCS
ENSPTRP00000011096  ...........................................D.....VDEcasra..................SCP
ENSPTRP00000018116  ...........................................D.....CGPgppldsgp...............RCL
ENSPTRP00000028112  ...........................................-.....--Lrkg....................NCS
ENSPTRP00000025264  ...........................................D.....QDEclmgah.................DCS
ENSPTRP00000057474  ...........................................Iqsy..CAKhl.....................KCS
ENSPTRP00000035842  ...........................................-.....---.......................GCC
ENSPTRP00000041706  ...........................................E.....CLSd......................PCL
ENSPTRP00000001581  ...........................................A.....Q--.......................---
ENSPTRP00000048671  ...........................................F.....CALs......................PCA
ENSPTRP00000036924  ...........................................E.....CDSq......................PCL
ENSPTRP00000002974  ...........................................D.....IDEcentd..................ACQ
ENSPTRP00000036924  ...........................................E.....CVSn......................PCQ
ENSPTRP00000018880  ...........................................D.....VDEcenhl..................ACP
ENSPTRP00000002493  ...........................................C.....CHT.......................ECL
ENSPTRP00000018116  ...........................................D.....CSPd......................PCH
ENSPTRP00000018880  ...........................................D.....VDEcseed..................LCQ
ENSPTRP00000018116  ...........................................E.....CLSg......................PCR
ENSPTRP00000028897  ...........................................D.....CPQ.......................HCD
ENSPTRP00000046479  ...........................................D.....VDEclepn..................VCT
ENSPTRP00000018085  ...........................................D.....VDEcqqnpr.................LCK
ENSPTRP00000020306  ...........................................-.....---.......................CCY
ENSPTRP00000020087  ...........................................A.....QDKcalgth.................GCQ
ENSPTRP00000031762  ...........................................-.....---.......................---
ENSPTRP00000012046  ...........................................D.....INEcvlnsl.................LCD
ENSPTRP00000035228  ...........................................Km....CAQqlgd...................NCT
ENSPTRP00000006692  ...........................................D.....VNEceae...................PCG
ENSPTRP00000036924  ...........................................D.....CRPn......................PCH
ENSPTRP00000049082  ...........................................S.....CRI.......................---
ENSPTRP00000018880  ...........................................D.....VDCrrvpp..................PCA
ENSPTRP00000006692  ...........................................D.....VDEcldes..................NCR
ENSPTRP00000018116  ...........................................E.....CASs......................PCG
ENSPTRP00000044880  ...........................................D.....CARn......................PCA
ENSPTRP00000025264  ...........................................D.....IDEcaqgagi................LCT
ENSPTRP00000028078  ...........................................D.....VDEcatgra.................SCP
ENSPTRP00000011096  ...........................................D.....VDEcedpqs.................SCL
ENSPTRP00000036924  ...........................................E.....CVGn......................PCH
ENSPTRP00000028078  ...........................................E.....CGLkpr....................PCK
ENSPTRP00000032142  ...........................................E.....CDPs......................PCK
ENSPTRP00000005988  ...........................................Af....CEE.......................GCR
ENSPTRP00000027395  ...........................................-.....CPA.......................RCD
ENSPTRP00000029424  ...........................................D.....VDEcqaipg.................ICQ
ENSPTRP00000049039  ...........................................D.....VDEcgsres.................PCQ
ENSPTRP00000059022  ...........................................E.....CASa......................PCL
ENSPTRP00000056675  ...........................................P.....CPA.......................G--
ENSPTRP00000018116  ...........................................D.....CDPn......................PCL
ENSPTRP00000006720  ...........................................D.....VNEcltipe.................ACK
ENSPTRP00000044502  ...........................................D.....IDEcasgkv.................ICP
ENSPTRP00000022833  ...........................................ApatqsCND.......................LCE
ENSPTRP00000049157  ...........................................-.....---.......................---
ENSPTRP00000029424  ...........................................H.....HAN.......................LCL
ENSPTRP00000021397  ...........................................D.....LNEclvfg..................TCS
ENSPTRP00000059022  ...........................................A.....CQSq......................PCH
ENSPTRP00000034342  ...........................................-.....--Rpnrg...................GCE
ENSPTRP00000024260  ...........................................Q.....CKGqq.....................PCT
ENSPTRP00000022834  ...........................................Srnp..CSSs......................PCR
ENSPTRP00000061259  ...........................................Dp....CAQa......................PCE
ENSPTRP00000018880  ...........................................-.....---.......................GCT
ENSPTRP00000059022  ...........................................C.....LSQ.......................PCH
ENSPTRP00000049039  ...........................................H.....FTN.......................LCL
ENSPTRP00000001803  ...........................................Sgr...CTPg......................VCK
ENSPTRP00000025264  ...........................................D.....VDEcamgth.................TCQ
ENSPTRP00000017658  ...........................................D.....VDEcadpr..................ACP
ENSPTRP00000029913  ...........................................D.....CVAh......................KCR
ENSPTRP00000011096  ...........................................-.....CGIln.....................GCE
ENSPTRP00000049062  ...........................................Dkne..CQFgatv...................VCG
ENSPTRP00000046479  ...........................................-.....--Iln.....................GCE
ENSPTRP00000049039  ...........................................D.....VDEcagrrg.................PCS
ENSPTRP00000049510  ...........................................D.....IDEcqnpg..................ICS
ENSPTRP00000052704  ...........................................G.....CPS.......................G--
ENSPTRP00000005841  ...........................................L.....CPN.......................G--
ENSPTRP00000005841  ...........................................Lt....CNHgng....................GCQ
ENSPTRP00000034549  ...........................................-.....CPA.......................VCQ
ENSPTRP00000000195  ...........................................P.....CPP.......................N--
ENSPTRP00000061149  ...........................................P.....CDCsphga..................LS-
ENSPTRP00000059022  ...........................................A.....CHSg......................PCL
ENSPTRP00000059022  ...........................................L.....CAQk......................PCP
ENSPTRP00000034924  ...........................................K.....CPE.......................NMK
ENSPTRP00000046227  ...........................................E.....CSSn......................PCQ
ENSPTRP00000004949  ...........................................-.....---.......................---
ENSPTRP00000003938  ...........................................E.....CEIysgtpl.................SCQ
ENSPTRP00000058611  ...........................................-.....---.......................---
ENSPTRP00000015610  ...........................................S.....CPR.......................PAS
ENSPTRP00000026114  ...........................................K.....CPP.......................HSS
ENSPTRP00000056656  ...........................................-.....---.......................---
ENSPTRP00000033933  ...........................................A.....CTGppsaprnlsfsasgtqlslhwepPAD
ENSPTRP00000033400  ...........................................A.....CAQgtfkplsgeg.............S--
ENSPTRP00000000400  ...........................................-.....---.......................---
ENSPTRP00000033908  ...........................................-.....---.......................---
ENSPTRP00000031479  ...........................................-.....---.......................---
ENSPTRP00000049082  ...........................................A.....CPSgtykpegspg.............G--
ENSPTRP00000036926  ...........................................Aai...CQP.......................PCR
ENSPTRP00000028833  ...........................................K.....MRL.......................RCN
ENSPTRP00000008485  ...........................................Ggfg..SHS.......................VCG
ENSPTRP00000001800  ...........................................S.....CPS.......................NTI
ENSPTRP00000002992  ...........................................V.....GDAs......................ACL
ENSPTRP00000058611  ...........................................-.....---.......................PCK
ENSPTRP00000000553  ...........................................-.....---.......................---
ENSPTRP00000018082  ...........................................K.....CPP.......................NAS
ENSPTRP00000025264  ...........................................A.....EDNd......................SCG
ENSPTRP00000037768  ...........................................S.....CITcavinrv................QK-


                             60             70                                  80                  
                              |              |                                   |                  
d2dtge6               ......GNCS...QPD..DPTKCV..AC.........RNFYL..D........G.....RCVE...............
ENSPTRP00000046526  ......-SCS...GRA..-ATQCL..SCrr.......GFYHHqeM........N.....TCVT...............
ENSPTRP00000035956  ......-TCE...GRH..-SRQCH..SCrl.......GWFQL..G........K.....ECLL...............
ENSPTRP00000035956  ......-KCQ...GPT..-QEDCT..TCpm.......TRIFD..D........G.....RCVL...............
ENSPTRP00000046968  ......-ACM...GPA..-PSHCT..GCkkpeeglqvE----..QlsgagipsG.....ECLA...............
ENSPTRP00000046968  ......-SCG...PS-..-SPRCL..TCte.......KTVLH..D........G.....KCMS...............
ENSPTRP00000035956  ......-SCF...GSH..-GDQCM..SCky.......GYFLNeeT........N.....SCVT...............
ENSPTRP00000035956  ......EMCQ...DCI..HEKTCK..ECmp.......EFFLH..D........D.....MCHQ...............
ENSPTRP00000046968  ......-ACS...GPL..-KTDCL..QCmd.......GYVLQ..E........G.....ACVE...............
ENSPTRP00000035956  ......-GCS...LD-..DPGTCT..SCam.......GYYRF..D........H.....HCYK...............
ENSPTRP00000035956  ......-TCN...GS-..-ATLCT..SCpk.......GAYLL..A........H.....ACVS...............
ENSPTRP00000032807  .pqamnITCT...GRG..-PDNCI..QC.........AHYID..G........P.....HCVK...............
ENSPTRP00000022058  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000021397  ......QQCI...NTY..GTYKC-..--.........-----..-........-.....----...............
ENSPTRP00000046968  ......-TCQ...GRG..-PFSCS..SCdt.......NLVLSh.T........G.....TCST...............
ENSPTRP00000015555  ....ppVGCE...ELV..REPGC-..--.........-----..-........-.....----...............
ENSPTRP00000032748  ...pppAVCA...ELV..REPGC-..--.........-----..-........-.....----...............
ENSPTRP00000022026  kmedglLTCH...GPG..-PDNCT..KC.........SHFKD..G........P.....NCVE...............
ENSPTRP00000015508  .....rGHCW...GPG..-PTQCV..NC.........SQFLR..G........Q.....ECVE...............
ENSPTRP00000057474  ......QRCI...NTH..GSYKC-..--.........-----..-........-.....----...............
ENSPTRP00000035956  ......-QCK...GKG..-ALNCL..SCvw.......SYHLM..G........G.....ICTS...............
ENSPTRP00000032807  ......AGCT...GPR..-ESDCL..VC.........RKFRD..E........A.....TCKD...............
ENSPTRP00000006428  ......QRCK...NSI..GSYKC-..--.........-----..-........-.....----...............
ENSPTRP00000003607  ....pdAFCY...NTP..GSFTC-..QCkp.......GYQGD..G........F.....RCVPgevektrcqherehi
ENSPTRP00000010754  ....ttARCHp..GTG..VDYTC-..--.........-----..-........-.....----...............
ENSPTRP00000011321  ......QLCA...NVP..GSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000032747  ...pvsASCS...EVT..RSAGCG..CCpmcal....PLGAA..C........G.....VATA...............
ENSPTRP00000049039  .....qGTCT...NVI..GGFEC-..--.........-----..-........-.....----...............
ENSPTRP00000046968  ......-TCS...QS-..-PDHCD..LCqdp......TKLLQ..N........G.....WCVH...............
ENSPTRP00000012046  .....nGTCR...NTI..GSFNC-..--.........-----..-........-.....----...............
ENSPTRP00000005841  ......HSCI...NHP..GTFAC-..--.........-----..-........-.....----...............
ENSPTRP00000022026  ......GGCS...GPK..-DTDCF..AC.........MNFND..S........G.....ACVT...............
ENSPTRP00000029424  .....nGMCI...NED..GSFKC-..--.........-----..-........-.....----...............
ENSPTRP00000022056  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000034969  ......QLCV...NVP..GSFVC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  .....nGTCT...NVI..GSFEC-..--.........-----..-........-.....----...............
ENSPTRP00000034969  ......HECV...NTD..DSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000012046  .....nGRCV...NLI..GKYQC-..--.........-----..-........-.....----...............
ENSPTRP00000056675  ......HDCV...NIP..GNYRC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  .....hGQCV...NVI..GAFQC-..--.........-----..-........-.....----...............
ENSPTRP00000060075  ......QQCY...NIL..GSFIC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  .....nGTCK...NTV..GSYNC-..--.........-----..-........-.....----...............
ENSPTRP00000012046  .....nGMCI...NED..GSFKC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  ......FLCV...NTL..GGFTC-..--.........-----..-........-.....----...............
ENSPTRP00000002974  ....agQDCD...NTI..GSYRC-..--.........-----..-........-.....--VV...............
ENSPTRP00000031716  ......-TCS...D--..-YNGCL..SCkp.......RLFFAl.Erigmkqi.G.....VCLS...............
ENSPTRP00000012046  ......FLCV...NTI..GGFTC-..--.........-----..-........-.....----...............
ENSPTRP00000012792  ......GSCS...APD..NDTACV..AC.........RHYYY..A........G.....VCVP...............
ENSPTRP00000012046  .....gGECI...NNQ..GSYTC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  .....nGWCH...NSP..GSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000012046  .....nGTCK...NVI..GGFEC-..--.........-----..-........-.....----...............
ENSPTRP00000036737  ....egQRCV...NLL..GSYRC-..--.........-----..-........-.....--LP...............
ENSPTRP00000015508  ......AGCT...GPK..-HSDCL..AC.........LHFNH..S........G.....ICEL...............
ENSPTRP00000018880  .....pGRCD...NTA..GSFHC-..--.........-----..-........-.....----...............
ENSPTRP00000000970  ......-ACF...S--..-HNFCT..KCke.......GLYLH..K........G.....RCYP...............
ENSPTRP00000056675  ......HICV...NTP..GSFQC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  .....nGTCK...NII..GSYNC-..--.........-----..-........-.....----...............
ENSPTRP00000021546  ......QKCE...SRP..GRHLC-..--.........-----..-........-.....----...............
ENSPTRP00000012046  .....rGQCV...NTP..GDFEC-..--.........-----..-........-.....----...............
ENSPTRP00000012046  ....qhADCK...NTM..GSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000005841  ......HDCL...NIP..GNYRC-..--.........-----..-........-.....----...............
ENSPTRP00000046479  .....rGDCI...NTA..GSYDC-..--.........-----..-........-.....----...............
ENSPTRP00000022516  ......-SCF...S--..-QDFCI..RCkr.......QFYLY..K........G.....KCLP...............
ENSPTRP00000029424  .....sGICV...NTP..GSFEC-..--.........-----..-........-.....----...............
ENSPTRP00000006720  ......QRCF...NSY..GTFLC-..--.........-----..-........-.....----...............
ENSPTRP00000003607  ....tnAACRp..GPR..TQFTC-..--.........-----..-........-.....----...............
ENSPTRP00000017888  ......QLCV...NLE..GGYKC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  ....inAQCV...NTP..GSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000034969  ......QLCL...NTE..DSFVC-..--.........-----..-........-.....----...............
ENSPTRP00000028112  ......QLCIpl.SPV..-SWEC-..--.........-----..-........-.....----...............
ENSPTRP00000024985  ....kgHRCV...NSP..GSFRC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  .....fGTCN...NLP..GMFHC-..--.........-----..-........-.....----...............
ENSPTRP00000021397  ......QVCE...QHK..HTVKC-..--.........-----..-........-.....----...............
ENSPTRP00000008515  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000027670  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000035066  ......-SCF...S--..-KDFCT..KCkv.......GFYLH..R........G.....RCFD...............
ENSPTRP00000029424  .....gGQCT...NIP..GEYRC-..--.........-----..-........-.....----...............
ENSPTRP00000025197  ....adQFCV...NTE..GSYECR..DCakacl....GCMGAg.P........G.....RCK-...............
ENSPTRP00000022729  ....ngGHCQ...NEI..NRFQC-..--.........-----..-........-.....----...............
ENSPTRP00000017670  ......GNCS...QPD..DPTKCV..AC.........RNFYL..D........G.....RCVE...............
ENSPTRP00000049039  .....qGTCV...NTP..GSFEC-..--.........-----..-........-.....----...............
ENSPTRP00000024985  ......QECA...NVY..GSYQC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  ....arGHCH...NTP..GSFRC-..--.........-----..-........-.....----...............
ENSPTRP00000056512  ....aaQFCK...NAN..GSYTCE..ECdsscv....GCTGEg.P........G.....NCK-...............
ENSPTRP00000022834  ......QGCT...NTD..GSFHC-..--.........-----..-........-.....----...............
ENSPTRP00000026116  ......QICD...NTP..GSYHC-..--.........-----..-........-.....----...............
ENSPTRP00000023256  ......HHCV...NSP..GSYFC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  ...srgMMCK...NLI..GTFMC-..--.........-----..-........-.....----...............
ENSPTRP00000005041  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000011096  ....gkGRCI...NRV..GSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000012755  ......-GCK...TLT..SSQACV..VCee.......GFSLH..Q........K.....SCVQ...............
ENSPTRP00000006692  .....gGDCI...NTN..GSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  .....nGQCL...NAP..GGYRC-..--.........-----..-........-.....----...............
ENSPTRP00000012046  .....gASCH...NTL..GSYKC-..--.........-----..-........-.....----...............
ENSPTRP00000011096  .....dGRCV...NSP..GSYTCL..--.........-----..-........-.....----...............
ENSPTRP00000046310  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000046227  ....neATCL...NEI..GRYTC-..--.........-----..-........-.....----...............
ENSPTRP00000049082  ....ngATCK...DGA..NSFRC-..--.........-----..-........-.....----...............
ENSPTRP00000059463  ....ngAVCQ...NFP..GSFNC-..--.........-----..-........-.....----...............
ENSPTRP00000032142  ....ngGTCR...DGV..NDFSC-..--.........-----..-........-.....----...............
ENSPTRP00000046479  .....qGRCE...NTE..GSFLC-..--.........-----..-........-.....----...............
ENSPTRP00000035113  ......GQCP...ATP..--P---..--.........-----..-........-.....----...............
ENSPTRP00000036737  ......HACR...NTE..GSYQC-..--.........-----..-........-.....----...............
ENSPTRP00000025264  ....egQVCH...NLP..GSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000006692  .....dGKCE...NKP..GSFKCI..--.........-----..-........-.....----...............
ENSPTRP00000052123  ....qlHVCD...ASQ..-GLVCQ..--.........-----..-........-.....----...............
ENSPTRP00000002974  ....ynQICE...NTR..GSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  .....nGLCR...NTP..GSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000011096  .....tWKCE...NSP..GSYRC-..--.........-----..-........-.....--VL...............
ENSPTRP00000036924  ....nnGTCV...DQV..GGYSC-..--.........-----..-........-.....----...............
ENSPTRP00000029424  .....sASCY...NTL..GSYKC-..--.........-----..-........-.....----...............
ENSPTRP00000006173  ......QGCT...NSE..GAFQC-..--.........-----..-........-.....----...............
ENSPTRP00000046526  ......-TCV...GPG..-REECI..HCak.......NFHFH..D........W.....KCVP...............
ENSPTRP00000021546  ......QHCY...NMR..GSFRC-..SCdt.......GYMLEsdG........R.....TCKVtasesllllvasqnk
ENSPTRP00000011096  .....tGLCL...NTE..GSFACS..--.........-----..-........-.....----...............
ENSPTRP00000018116  ....hnGTCV...DLV..GGFRC-..--.........-----..-........-.....----...............
ENSPTRP00000028112  .....sTVCG...QDL..QSHLC-..--.........-----..-........-.....----...............
ENSPTRP00000025264  ....rrQFCV...NTL..GSFYC-..--.........----V..N........H.....TV--...............
ENSPTRP00000057474  ......QKCD...QNK..FSVKC-..--.........-----..-........-.....----...............
ENSPTRP00000035842  ......ARCL...GAE..-GASC-..--.........-----..G........G.....RAGG...............
ENSPTRP00000041706  ....hgGTCS...DTV..AGYIC-..--.........-----..-........-.....----...............
ENSPTRP00000001581  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000048671  .....hGTCR...SVG..TSYKC-..--.........-----..-........-.....----...............
ENSPTRP00000036924  ....hgGTCQ...DGC..GSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000002974  ......HECK...NTF..GSYQC-..--.........-----..-........-.....----...............
ENSPTRP00000036924  ....ndATCL...DQI..GEFQC-..--.........-----..-........-.....----...............
ENSPTRP00000018880  .....gQECV...NSP..GSFQCR..--.........-----..-........-.....----...............
ENSPTRP00000002493  ......GGCS...QPE..DPRACV..AC.........RHLYF..Q........G.....ACLW...............
ENSPTRP00000018116  .....hGRCV...DGI..ASFSC-..--.........-----..-........-.....----...............
ENSPTRP00000018880  .....sGICT...NTD..GSFEC-..--.........-----..-........-.....----...............
ENSPTRP00000018116  ....nqATCL...DRI..GQFTC-..--.........-----..-........-.....----...............
ENSPTRP00000028897  .....sSECK...S--..-SPRC-..--.........-----..-........-.....----...............
ENSPTRP00000046479  .....nGDCS...NLE..GSYMC-..--.........-----..-........-.....----...............
ENSPTRP00000018085  ....syGTCV...NTL..GSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000020306  ......-TCA...S--..--QRNE..SCa........GTFGI..T........G.....TCDR...............
ENSPTRP00000020087  ......HICVn..DRT..GSHHC-..--.........-----..-........-.....----...............
ENSPTRP00000031762  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000012046  .....nGQCR...NTP..GSFVC-..--.........-----..-........-.....----...............
ENSPTRP00000035228  ....eaAICD...---..------..--.........-----..-........-.....----...............
ENSPTRP00000006692  ...pgrGICM...NTG..GSYNC-..--.........-----..-........-.....----...............
ENSPTRP00000036924  ....ngGSCT...DGI..NTAFC-..--.........-----..-........-.....----...............
ENSPTRP00000049082  ......GSYQ...DEE..GQLECK..LCpsgmyt...EYIHS..R........Nis...DCKA...............
ENSPTRP00000018880  .....pGRCE...NSP..GSFRC-..--.........-----..-........-.....----...............
ENSPTRP00000006692  .....nGVCE...NTR..GGYRC-..--.........-----..-........-.....----...............
ENSPTRP00000018116  ....egGSCM...DGE..NGFRC-..--.........-----..-........-.....----...............
ENSPTRP00000044880  ....hgGTCH...DLE..NGLMC-..--.........-----..-........-.....----...............
ENSPTRP00000025264  ......FRCL...NVP..GSYQC-..--.........-----..-........-.....----...............
ENSPTRP00000028078  ....rfRQCV...NTF..GSYIC-..--.........-----..-........-.....----...............
ENSPTRP00000011096  .....gGECK...NTV..GSYQC-..--.........-----..-........-.....----...............
ENSPTRP00000036924  ....ngGTCE...DGI..NGFTC-..--.........-----..-........-.....----...............
ENSPTRP00000028078  ......HRCM...NTY..GSYKC-..--.........-----..-........-.....----...............
ENSPTRP00000032142  ....ngGSCT...DLE..NSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000005988  ....ygGTCV...A--..-PNKC-..--.........-----..-........-.....----...............
ENSPTRP00000027395  .....vSRCP...SP-..------..--.........-----..-........-.....----...............
ENSPTRP00000029424  .....gGNCI...NTV..GSFEC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  ....qnADCI...NIP..GSYHC-..--.........-----..-........-.....----...............
ENSPTRP00000059022  ....nhADCH...DLL..NGFQC-..--.........-----..-........-.....----...............
ENSPTRP00000056675  ......-TFQ...ERE..GQLSCD..LCpgsdah...GPLGA..T........Nvt...TCAG...............
ENSPTRP00000018116  ....ngGSCQ...DGV..GSFSC-..--.........-----..-........-.....----...............
ENSPTRP00000006720  ....geMKCI...NHY..GGYLC-..--.........-----..-........-.....--LPrsaavindlhgegpp
ENSPTRP00000044502  ....ynRRCV...NTF..GSYYC-..--.........-----..-........-.....----...............
ENSPTRP00000022833  ......HFCVpnpDQP..GSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000049157  ......-SCV...QRD..TEGLCQ..ACdg.......PAYIL..G........Q.....LCLA...............
ENSPTRP00000029424  .....nGRCI...PTV..SSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000021397  ......HQCI...NVE..GSYKC-..VCdq.......NFQER..N........N.....TCIAegsedqvlyiandtd
ENSPTRP00000059022  ....nhGTCT...PKP..GGFHC-..--.........-----..-........-.....----...............
ENSPTRP00000034342  ......QRCL...NTL..GSYKC-..--.........-----..-........-.....----...............
ENSPTRP00000024260  ......---V...---..AEGRCL..TC.........EPGWN..G........T.....KCDQ...............
ENSPTRP00000022834  ....ggATCIlg.PHG..KNYTC-..--.........-----..-........-.....----...............
ENSPTRP00000061259  ......QQCEp..GGP..QGYSC-..--.........-----..-........-.....----...............
ENSPTRP00000018880  .....nGRCV...RVP..EGFTC-..--.........-----..-........-.....----...............
ENSPTRP00000059022  ....gdAQCS...TNPltGSTLC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  .....nGRCL...PTP..SSYRC-..--.........-----..-........-.....----...............
ENSPTRP00000001803  ....ngGTCV...NLLv.GGFKC-..--.........-----..-........-.....----...............
ENSPTRP00000025264  ....pgFLCQ...NTK..GSFYC-..--.........-----..-........-.....QARQ...............
ENSPTRP00000017658  ....ehATCN...NTV..GNYSC-..--.........-----..-........-.....----...............
ENSPTRP00000029913  ....hgAQCM...DTI..NGYTC-..--.........-----..-........-.....----...............
ENSPTRP00000011096  .....nGRCV...RVR..EGYTC-..--.........-----..-........-.....----...............
ENSPTRP00000049062  ....nhTSCH...NTP..GGFYC-..ICle.......GYRAT..N........N.....NKT-...............
ENSPTRP00000046479  .....nGRCV...RVQ..EGYTC-..--.........-----..-........-.....----...............
ENSPTRP00000049039  ......YSCA...NTP..GGFLC-..--.........-----..-........-.....----...............
ENSPTRP00000049510  ......QICI...NLK..GGYKC-..--.........-----..-........-.....----...............
ENSPTRP00000052704  ......-TFK...ANQ..GDEACT..HCpin......S-RTTs.E........Gat...NCV-...............
ENSPTRP00000005841  ......-TFQ...NEE..GQITCE..PCprpgns...G---Al.Ktpeawnm.S.....ECGG...............
ENSPTRP00000005841  ......HSCD...DTA..DGPEC-..--.........-----..-........-.....----...............
ENSPTRP00000034549  ......----...---..-PTRC-..--.........-----..-........-.....PALP...............
ENSPTRP00000000195  ......-SFS...SAG..GQRTCD..ICrqck.....GVFRT..R........K.....ECSStsnaec.........
ENSPTRP00000061149  ......ILCN...S--..-SGKC-..QC.........KVGVI..G........S.....ICD-...............
ENSPTRP00000059022  ....ngGSCN...PSP..GGYYC-..--.........-----..-........-.....----...............
ENSPTRP00000059022  ....snSHCL...QTG..PSFHC-..--.........-----..-........-.....----...............
ENSPTRP00000034924  ......GVTE...D--..-GWNCI..SC.........PSDLTa.E........G.....KCH-...............
ENSPTRP00000046227  ....ngGTCE...NLP..GNYTC-..--.........-----..-........-.....----...............
ENSPTRP00000004949  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000003938  ....ngGTCV...NTM..GSYSC-..--.........-----..-........-.....----...............
ENSPTRP00000058611  ......----...---..---SCR..ACal.......GSEQS..G........S.....SCV-...............
ENSPTRP00000015610  ......-VCS...S--..-GVNCRpeLCl........GYVCQ..P........M.....ACLPsvcmpttfrpa....
ENSPTRP00000026114  ......-T--...QED..GSMNC-..--.........-----..-........-.....----...............
ENSPTRP00000056656  ......----...---..----C-..--.........-----..-........-.....----...............
ENSPTRP00000033933  .....tGGRQ...DVR..YSVRCS..QCq........GTAQD..G........G.....PCQ-...............
ENSPTRP00000033400  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000000400  ......----...---..----C-..--.........-----..-........-.....----...............
ENSPTRP00000033908  ......----...---..------..--.........-----..-........-.....----...............
ENSPTRP00000031479  ......----...---..---KC-..ICka.......GYQQK..G........D.....TCE-...............
ENSPTRP00000049082  ......----...---..-ISSCI..PCpde......NHTSP..P........GstspeDCV-...............
ENSPTRP00000036926  ....ngGSCV...Q--..-PGRC-..--.........-----..-........-.....----...............
ENSPTRP00000028833  ....gdNDCG...DFS..DEDDC-..--.........-----..-........-.....--ESeprppcrdrvveese
ENSPTRP00000008485  ......----...---..-GFRAG..SCgr.......SFGYRs.G........G.....VCGPsppcittvsvnesl.
ENSPTRP00000001800  ......LKAH...QPY..GVQACV..PCgp.......GTKNNkiH........S.....LCYN...............
ENSPTRP00000002992  ......-TCA...PDN..-RTRCG..TCnt.......GYMLS..Q........G.....LCK-...............
ENSPTRP00000058611  .....pGTFS...NKP..GSFNCQ..VCpr.......NTYSEkgA........K.....ECI-...............
ENSPTRP00000000553  ......----...---..----C-..VCsa.......GYEER..R........D.....ACV-...............
ENSPTRP00000018082  ......--CV...N--..-NTHC-..--.........-----..-........-.....----...............
ENSPTRP00000025264  .....iSLY-...---..-KQCC-..DCcgl......GLRVRaeG........Q.....SCES...............
ENSPTRP00000037768  ......VNCT...ATS..-NAVCG..--.........-----..-........-.....----...............


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  lgaagaadpqrpippglfvp..........................................................
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  iiadsvtsqvhniyslvengsyivavdfdsisgrifwsdatqgktwsafqngtdrrvvfdssiiltetiaidwvgrnl
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ppvppaqhpn....................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ilgf..........................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  ..............................................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  ..............................................................................
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  l.............................................................................
ENSPTRP00000008485  ..............................................................................
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  ywtdyaletievskidgshrtvlisknltnprglaldprmnehllfwsdwghhprierasmdgsmrtvivqdkifwpc
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  ..............................................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  ..............................................................................
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  ..............................................................................
ENSPTRP00000008485  ..............................................................................
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  gltidypnrllyfmdsyldymdfcdynghhrrqviasdliirhpyaltlfedsvywtdratrrvmrankwhggnqsvv
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  ..............................................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  ..............................................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  ..............................................................................
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  ..............................................................................
ENSPTRP00000008485  ..............................................................................
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                              90                    
                                                                               |                    
d2dtge6               ..............................................TCP.....PPYYHFQDWR........C.....
ENSPTRP00000046526  ..............................................LCP.....AGFYADESQ-........-.....
ENSPTRP00000035956  ..............................................QCR.....EGYYADNST-........-.....
ENSPTRP00000035956  ..............................................NCP.....SWKFEFE---........-.....
ENSPTRP00000046968  ..............................................QCR.....AHFYLEST--........-.....
ENSPTRP00000046968  ..............................................ECP.....GGYYADAT--........-.....
ENSPTRP00000035956  ..............................................HCP.....DGSYQDTKK-........-.....
ENSPTRP00000035956  ..............................................SCP.....RGFYADS---........-.....
ENSPTRP00000046968  ..............................................QCL.....SSFYQDS---........-.....
ENSPTRP00000035956  ..............................................TCP.....EKTYSEE---........-.....
ENSPTRP00000035956  ..............................................SCP.....QGTWPSVRS-........-.....
ENSPTRP00000032807  ..............................................TCP.....AGVMGENNTLvwky....A.....
ENSPTRP00000022058  ..............................................---.....----------........-.....
ENSPTRP00000021397  ..............................................LCT.....DGYEIQPDNPng......Ckslsg
ENSPTRP00000046968  ..............................................TCF.....PGHYLDDN--........-.....
ENSPTRP00000015555  ..............................................---.....----------........-.....
ENSPTRP00000032748  ..............................................---.....----------........-.....
ENSPTRP00000022026  ..............................................KCP.....DGLQGANSFIfky.....A.....
ENSPTRP00000015508  ..............................................ECRvlqglPREYVNA---........-.....
ENSPTRP00000057474  ..............................................LCV.....EGYAPRGGDPhs......Ckavtd
ENSPTRP00000035956  ..............................................DCL.....VGEYRVGEG-........-.....
ENSPTRP00000032807  ..............................................TCP.....PLMLYNPTTY........Q.....
ENSPTRP00000006428  ..............................................SCR.....TGFHLHGNRHs.......C.....
ENSPTRP00000003607  ..............................................ECD.....AHGHYAPTQC........Hgstgy
ENSPTRP00000010754  ..............................................ECA.....SGYQGDG--Rn.......C.....
ENSPTRP00000011321  ..............................................TCN.....PGFTLNEDGRs.......C.....
ENSPTRP00000032747  ..............................................RCA.....RG--------........-.....
ENSPTRP00000049039  ..............................................ACA.....DGFEPGLMMT........C.....
ENSPTRP00000046968  ..............................................SCG.....LGFYQAG---........-.....
ENSPTRP00000012046  ..............................................RCN.....HGFILSHNND........C.....
ENSPTRP00000005841  ..............................................ACN.....RGYTLYGFTH........C.....
ENSPTRP00000022026  ..............................................QCP.....QTFVYNPTTF........Q.....
ENSPTRP00000029424  ..............................................ICK.....PGFVLAPNGRy.......C.....
ENSPTRP00000022056  ..............................................---.....----------........C.....
ENSPTRP00000034969  ..............................................QCY.....SGYALAEDGKr.......C.....
ENSPTRP00000029424  ..............................................NCN.....EGFEPGPMMN........C.....
ENSPTRP00000034969  ..............................................HCL.....KGFTLNPDKKt.......C.....
ENSPTRP00000012046  ..............................................ACN.....PGYHSTPDRLf.......C.....
ENSPTRP00000056675  ..............................................TCY.....DGFHLAHDGHn.......C.....
ENSPTRP00000049039  ..............................................SCY.....AGFQGTPDRQg.......C.....
ENSPTRP00000060075  ..............................................QCN.....QGYELSSDRLn.......C.....
ENSPTRP00000029424  ..............................................LCY.....PGFELTHNND........C.....
ENSPTRP00000012046  ..............................................ICK.....PGFQLASDGRy.......C.....
ENSPTRP00000029424  ..............................................KCP.....PGFTQHHT-A........C.....
ENSPTRP00000002974  ..............................................RCG.....SGFRRTSDGLs.......C.....
ENSPTRP00000031716  ..............................................SCP.....SGYYGTR---........Y.....
ENSPTRP00000012046  ..............................................KCP.....PGFTQHHT-S........C.....
ENSPTRP00000012792  ..............................................ACP.....PNTYRFEGWR........C.....
ENSPTRP00000012046  ..............................................QCR.....AGYQSTLTRTe.......C.....
ENSPTRP00000049039  ..............................................SCP.....PGFHFWQDTEi.......C.....
ENSPTRP00000012046  ..............................................TCE.....EGFEPGPMMT........C.....
ENSPTRP00000036737  ..............................................DCG.....PGFRVAADGAg.......C.....
ENSPTRP00000015508  ..............................................HCP.....ALVTYNTDT-........-.....
ENSPTRP00000018880  ..............................................ACP.....AGFRSRGPGAp.......C.....
ENSPTRP00000000970  ..............................................ACP.....EGSSAANGTM........-.....
ENSPTRP00000056675  ..............................................LCH.....RGYLLYGITH........C.....
ENSPTRP00000049039  ..............................................LCF.....PGFVVTHNGD........C.....
ENSPTRP00000021546  ..............................................HCE.....EGYILERGQY........Ckands
ENSPTRP00000012046  ..............................................KCD.....EGYESGFMMMkn......C.....
ENSPTRP00000012046  ..............................................LCK.....EGYTGDGF-T........C.....
ENSPTRP00000005841  ..............................................TCF.....DGFMLAHDGHn.......C.....
ENSPTRP00000046479  ..............................................TCP.....DGFQLDDNKT........C.....
ENSPTRP00000022516  ..............................................TCP.....PGTLAHQNT-........-.....
ENSPTRP00000029424  ..............................................ECF.....EGYESGFMMMkn......C.....
ENSPTRP00000006720  ..............................................RCH.....QGYELHRDGFs.......C.....
ENSPTRP00000003607  ..............................................ECS.....IGFRGDGR-T........C.....
ENSPTRP00000017888  ..............................................QCE.....EGFQLDPHTKa.......Ckavgs
ENSPTRP00000029424  ..............................................ACS.....EGFTGDGF-T........C.....
ENSPTRP00000034969  ..............................................QCS.....EGFLINEDLKt.......C.....
ENSPTRP00000028112  ..............................................DCF.....PGYDLQLDKKs.......Caasgp
ENSPTRP00000024985  ..............................................ECK.....TGYYFDGISRm.......C.....
ENSPTRP00000029424  ..............................................ICD.....DGYELDRTGGn.......C.....
ENSPTRP00000021397  ..............................................SCY.....EGWKLDVDGEs.......Ctsvdp
ENSPTRP00000008515  ..............................................---.....----------........-.....
ENSPTRP00000027670  ..............................................-CL.....LGETRDACGC........-.....
ENSPTRP00000035066  ..............................................ECP.....DGFAPLEET-........-.....
ENSPTRP00000029424  ..............................................LCY.....DGFMASMDMKt.......C.....
ENSPTRP00000025197  ..............................................KCS.....PGYQQVGS-K........C.....
ENSPTRP00000022729  ..............................................LCP.....TGFSGNL--C........Q.....
ENSPTRP00000017670  ..............................................TCP.....PPYYHFQDWR........C.....
ENSPTRP00000049039  ..............................................ECF.....PGYESGFMLMkd......C.....
ENSPTRP00000024985  ..............................................YCR.....RGYQLSDVDGvt......C.....
ENSPTRP00000049039  ..............................................ECH.....QGFTLDSSGHg.......C.....
ENSPTRP00000056512  ..............................................ECI.....SGYAREHG-Q........C.....
ENSPTRP00000022834  ..............................................SCK.....EGYVLAGEDGtq......C.....
ENSPTRP00000026116  ..............................................SCK.....SGFVMLSNKKd.......C.....
ENSPTRP00000023256  ..............................................RCQ.....VGFVLQQDQRs.......C.....
ENSPTRP00000029424  ..............................................ICP.....PGMARRPDGEg.......C.....
ENSPTRP00000005041  ..............................................---.....----------........-.....
ENSPTRP00000011096  ..............................................FCY.....PGYTLATSGAtqe.....C.....
ENSPTRP00000012755  ..............................................HCP.....PGFAPQVLDT........H.....
ENSPTRP00000006692  ..............................................LYR.....QGHRLVGARK........C.....
ENSPTRP00000049039  ..............................................ECE.....MGFDPTEDHRa.......C.....
ENSPTRP00000012046  ..............................................MCP.....AGFQYEQFSGg.......C.....
ENSPTRP00000011096  ..............................................ACE.....EGYRGQSG-S........C.....
ENSPTRP00000046310  ..............................................---.....----------........-.....
ENSPTRP00000046227  ..............................................ICP.....HNYSGVN--C........E.....
ENSPTRP00000049082  ..............................................LCA.....AGFTGSH--C........E.....
ENSPTRP00000059463  ..............................................VCK.....TGYTGKM--C........E.....
ENSPTRP00000032142  ..............................................TCP.....PGYTGRN---........-.....
ENSPTRP00000046479  ..............................................ICP.....AGFMASEEGTn.......C.....
ENSPTRP00000035113  ..............................................TCA.....PGVRAVLDGC........-.....
ENSPTRP00000036737  ..............................................LCP.....AGYRLLPSGKn.......C.....
ENSPTRP00000025264  ..............................................DCK.....AGFQRDAFGRg.......C.....
ENSPTRP00000006692  ..............................................ACQ.....PGYRSQGGGA........C.....
ENSPTRP00000052123  ..............................................---.....----------........-.....
ENSPTRP00000002974  ..............................................VCP.....RGYRSQGVGRp.......C.....
ENSPTRP00000029424  ..............................................TCP.....PGYVFRTETEt.......C.....
ENSPTRP00000011096  ..............................................GCQ.....PGFHMAPNGD........C.....
ENSPTRP00000036924  ..............................................TCP.....PGFVGER--C........E.....
ENSPTRP00000029424  ..............................................ACP.....SGFSFDQFSSa.......C.....
ENSPTRP00000006173  ..............................................WCE.....TGYELRPDRRs.......Ckalgp
ENSPTRP00000046526  ..............................................ACG.....EGFYPEE--Mp.......G.....
ENSPTRP00000021546  myniqwplgivavhpskqpnsvnpcafsrcshlcllssqgphfyscVCP.....SGWSLSPDLLn.......Clrddq
ENSPTRP00000011096  ..............................................ACE.....NGYWVNEDGTa.......C.....
ENSPTRP00000018116  ..............................................TCP.....PGYTGLR--C........E.....
ENSPTRP00000028112  ..............................................TCA.....EGYALSRDRKy.......C.....
ENSPTRP00000025264  ..............................................LCA.....DGYILNAHRK........C.....
ENSPTRP00000057474  ..............................................SCY.....EGWVLEPDGEs.......Crsldp
ENSPTRP00000035842  ..............................................RCG.....PGLVCASQ--........-.....
ENSPTRP00000041706  ..............................................RCP.....ETWGGRD---........-.....
ENSPTRP00000001581  ..............................................---.....----------........-.....
ENSPTRP00000048671  ..............................................LCD.....PGYHGLY--C........E.....
ENSPTRP00000036924  ..............................................TCP.....QGYTGPNCQ-........-.....
ENSPTRP00000002974  ..............................................ICP.....PGYQLTHNGKt.......C.....
ENSPTRP00000036924  ..............................................ICM.....PGYEGVH--C........E.....
ENSPTRP00000018880  ..............................................ACP.....SGHHLHRG-R........C.....
ENSPTRP00000002493  ..............................................ACP.....PGTYQYESWR........C.....
ENSPTRP00000018116  ..............................................ACA.....PGYTGTR--C........E.....
ENSPTRP00000018880  ..............................................ICP.....PGHRAGPDLAs.......C.....
ENSPTRP00000018116  ..............................................ICM.....AGFTGTY--C........E.....
ENSPTRP00000028897  ..............................................---.....------KRTV........L.....
ENSPTRP00000046479  ..............................................SCH.....KGYTRTPDHKh.......C.....
ENSPTRP00000018085  ..............................................QCL.....PGFKLKPEDPkl......C.....
ENSPTRP00000020306  ..............................................---.....----------........-.....
ENSPTRP00000020087  ..............................................ECY.....EGYTLNADKKt.......C.....
ENSPTRP00000031762  ..............................................RCP.....AGVSLVLDGC........-.....
ENSPTRP00000012046  ..............................................TCP.....KGFIYKPDLKt.......C.....
ENSPTRP00000035228  ..............................................---.....----------........-.....
ENSPTRP00000006692  ..............................................HCN.....RGYRLHVGAGgrs.....C.....
ENSPTRP00000036924  ..............................................ECL.....PGFRGTF--C........E.....
ENSPTRP00000049082  ..............................................QCK.....QGTYSYSGL-........-.....
ENSPTRP00000018880  ..............................................VCG.....PGFRAGPRAAe.......C.....
ENSPTRP00000006692  ..............................................ACT.....PPAEYSPAQ-........-.....
ENSPTRP00000018116  ..............................................LCP.....PGSLP-----........-.....
ENSPTRP00000044880  ..............................................TCP.....AGFSGRRCEV........R.....
ENSPTRP00000025264  ..............................................ACPe....QGYTMTANGRs.......C.....
ENSPTRP00000028078  ..............................................KCH.....KGFDLMYIGGkyq.....C.....
ENSPTRP00000011096  ..............................................LCP.....QGFQLANGTV........C.....
ENSPTRP00000036924  ..............................................RCP.....EGYHDPT--C........L.....
ENSPTRP00000028078  ..............................................YCL.....NGYMLMPDGS........C.....
ENSPTRP00000032142  ..............................................TCP.....PGFYGKI---........-.....
ENSPTRP00000005988  ..............................................VCP.....SGFTGSH--C........E.....
ENSPTRP00000027395  ..............................................RCP.....GGYVPDLC--........-.....
ENSPTRP00000029424  ..............................................RCP.....AGHKQSETTQk.......C.....
ENSPTRP00000049039  ..............................................ECT.....RGYKLSPGGA........C.....
ENSPTRP00000059022  ..............................................ICL.....PGFSGTR--C........E.....
ENSPTRP00000056675  ..............................................QCP.....PGQHSVDGF-........-.....
ENSPTRP00000018116  ..............................................SCL.....PGFAGPR--C........A.....
ENSPTRP00000006720  ..............................................PCP.....PGYEPDNQES........C.....
ENSPTRP00000044502  ..............................................KCH.....IGFELQYISGryd.....C.....
ENSPTRP00000022833  ..............................................MCE.....TGYRLAADQHr.......C.....
ENSPTRP00000049157  ..............................................YCP.....PRFFNHTRLV........-.....
ENSPTRP00000029424  ..............................................ECN.....MGYKQDANGD........C.....
ENSPTRP00000021397  ..............................................IYP.....FNYSGDHQQI........Shiehn
ENSPTRP00000059022  ..............................................ACP.....PGFVGLR--C........E.....
ENSPTRP00000034342  ..............................................SCD.....PGYELAPDKRr.......Ceaacg
ENSPTRP00000024260  ..............................................PCA.....TGFYGEGCS-........-.....
ENSPTRP00000022834  ..............................................RCP.....QGYQLDSSQLd.......C.....
ENSPTRP00000061259  ..............................................HCR.....LGFRPAEDDPhr......C.....
ENSPTRP00000018880  ..............................................RCF.....DGYRLDVTRMa.......C.....
ENSPTRP00000059022  ..............................................LCQ.....PGYSGPT--C........H.....
ENSPTRP00000049039  ..............................................ECN.....VGYTQDVRGE........C.....
ENSPTRP00000001803  ..............................................DCP.....SGDFEKPY--........Cqvttr
ENSPTRP00000025264  ..............................................RCM.....DGFLQDPEGN........C.....
ENSPTRP00000017658  ..............................................FCN.....PGFESSSGHLsfqgleasC.....
ENSPTRP00000029913  ..............................................TCP.....QGFSGPF---........-.....
ENSPTRP00000011096  ..............................................DCF.....EGFQLDAAHMa.......C.....
ENSPTRP00000049062  ..............................................---.....--FIPNDGTF........C.....
ENSPTRP00000046479  ..............................................DCF.....DGYHLDTAKMt.......C.....
ENSPTRP00000049039  ..............................................GCP.....QGYFRAGQGH........C.....
ENSPTRP00000049510  ..............................................ECS.....RGYQMDLATGv.......Ckavgk
ENSPTRP00000052704  ..............................................-CR.....NGYYRADLDPldmp....C.....
ENSPTRP00000005841  ..............................................LCQ.....PGEYSADGF-........-.....
ENSPTRP00000005841  ..............................................SCH.....PQYKMHTDGRs.......C.....
ENSPTRP00000034549  ..............................................TCA.....LGTTPVFDLC........-.....
ENSPTRP00000000195  ..............................................DCT.....PGFHCLG---........-.....
ENSPTRP00000061149  ..............................................RCQ.....DGYYGFSK--........-.....
ENSPTRP00000059022  ..............................................TCP.....PSHTGPQ--C........Q.....
ENSPTRP00000059022  ..............................................LCL.....QGWTGPL--C........N.....
ENSPTRP00000034924  ..............................................-CP.....IGHILVER--........-.....
ENSPTRP00000046227  ..............................................HCPfdnl.SRTFYGG---........-.....
ENSPTRP00000004949  ..............................................ECG.....QGFSQQENGH........C.....
ENSPTRP00000003938  ..............................................HCP.....PETYGPQ---........-.....
ENSPTRP00000058611  ..............................................PCP.....PGHYIEKET-........-.....
ENSPTRP00000015610  ..............................................SCL.....SKTYLSSS--........Craasg
ENSPTRP00000026114  ..............................................RCE.....NNYFRADKDPpsma....C.....
ENSPTRP00000056656  ..............................................TCK.....PGYEPENS--........-.....
ENSPTRP00000033933  ..............................................PC-.....----------........-.....
ENSPTRP00000033400  ..............................................---.....----------........-.....
ENSPTRP00000000400  ..............................................LCQ.....AGYEKVE---........-.....
ENSPTRP00000033908  ..............................................-CQ.....PGYQPARGD-........-.....
ENSPTRP00000031479  ..............................................PCG.....RGFYKSS---........-.....
ENSPTRP00000049082  ..............................................-CR.....EGYRASGQT-........-.....
ENSPTRP00000036926  ..............................................RCP.....AGWQGDT--C........Q.....
ENSPTRP00000028833  ..............................................A--.....----------........Rtagyg
ENSPTRP00000008485  ..............................................LTP.....LNLEIDPNAQ........Cvkqee
ENSPTRP00000001800  ..............................................DC-.....----------........-.....
ENSPTRP00000002992  ..............................................---.....----------........-.....
ENSPTRP00000058611  ..............................................RCK.....DDSQFSEEGSse......C.....
ENSPTRP00000000553  ..............................................ACE.....LGFYKSAPG-........-.....
ENSPTRP00000018082  ..............................................TCD.....HGYTSGSGQKlftfpletC.....
ENSPTRP00000025264  ..............................................NPN.....LGYPCNHVMLs.......Ccegee
ENSPTRP00000037768  ..............................................DCL.....PRFYRKTRIG........G.....


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  eepfliladhheirkistdgsnytllkqglnnviaidfdyreefiywidssrpngsrinrmclngsdikvvhntavpn
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  eepflifanryylrklnldgsnytllkqglnnavaldfdyreqmiywtdvttqgsmirrmhlngsnvqvlhrtglsnp
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  cwcvdrdgrevegtrtrpgmtppclstvappihqgpavptaviplppgthllfaqtgkierlplegntmrkteakafl
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  fgeasiifsngrdlligdihgrsfrilvesqnrgvavgvafhyhlqrvfwtdtvqnkvfsvdinglniqevlnvsvet
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  iaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqldrahgvssydtvisrdiqa
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  qpfllfansqdirhmhfdgtdygtllsqqmgmvyaldhdpvenkiyfahtalkwieranmdgsqrerlieegvdvpeg
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  feafiifsirheirridlhkrdysllvpglrntialdfhfnqsllywtdvvedriyrgklsesggvsaievvvehgla
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  epvllfanridirqvlphrseytlllnnlenaialdfhhrrelvfwsdvtldrilranlngsnveevvstglespggl
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  pflitvrqhiifgislnpevksndamvpiagiqngldvefddaeqyiywvenpgeihrvktdgtnrtvfasismvgps
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  fkpfiifsnrheirridlhkgdysvlvpglrntialdfhlsqsalywtdvvedkiyrgklldngaltsfevviqygla
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  sritgmdvyyqrdmiiwstqfnpggifykrihdrekrqansglicpefkrprdiavdwvagniywtdhsrmhwfsyyt
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  gfltklngsitspgwpkeyppnknciwqlvaptqyrislqfdffetegndvckydfvevrsgltadsklhgkfcgsek
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  sfpahsfitfrglrqrfhftlalsfatkerdglllyngrfnekhdfvaleviqeqvqltfsagestttvspfvpggvs
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  epsliftnrrdirkiglerkeyiqlveqlrntvaldadiaaqklfwadlsqkaifsasiddkvgrhikmidnvynpaa
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  isgsmgpgswysegafngneketmqflndrlasyltrvrqleqenaelesriqeashsqvltmtpdyqshfrtieelq
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  inilgmdplstpfdnefynglcnrdrdgntltyyrrpwnvaslvyetkgeknlrtehyeeqieafksiiqektsnfna
ENSPTRP00000008485  keqikslnsrfaafidkvrfleqqnklletklqfyqnreccqsnleplfagyietlrreaecveadsgrlaselnhvq
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  plivpevrrppepaaaprrvseaemagrealslgteaelpnslpg.................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  alavdwigknlywsdtekriievsklnglyptilvskrlkfprdlsldpragylywidcceyphigrvgmdgtnqsvv
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  dglavdwvggnlywcdkgrdtievsklngayrtvlvssglrepralvvdvqngylywtdwgdhsligrigmdgssrsv
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  hvpakviiglafdcvdkmvywtditepsigraslhggepttiirqdlgspegiavdhlgrnifwtdsnldrievakld
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  penlavdwvnnkiylvetkvnridmvnldgsyrvtlitenlghprgiavdptvgylffsdweslsgepklerafmdgs
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  pdglavdwihsniywtdsvlgtvsvadtkgvkrktlfrengskpraivvdpvhgfmywtdwgtpakikkgglngvdiy
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  lavdwigrrfywtdrgksligrsdlngkrskiitkenisqprgiavhpmakrlfwtdtginpriessslqglgrlvia
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  tpegltvdwiagniywidsnldqievakldgslrttliagamehpraialdprygilfwtdwdanfpriesasmsgag
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  avdwvhdklywtdsgtsrievanldgahrkvllwqnlekpraialhpmegtiywtdwgntprieassmdgsgrriiad
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  mnlaldwisrnlystnprtqsievltlhgdiryrktliandgtalgvgfpigitvdpargklywsdqgtdsgvpakia
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  tpeglavdwiagniywvesnldqievakldgtlrttllagdiehpraialdprdgilfwtdwdaslprieaasmsgag
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  thwtslrysinvgqlngpnctrlltnmagepyaiavnpkrgmmywtvvgdhshieeaardgtlrrilvqknlqrptgl
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  pevitsqynnmrvefksdntvskkgfkahff...............................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  dgqwhtvqlkyynkpllgqtglpqgpseqkvavvtvdgcdtgvalrfgsvlgnyscaaqgtqggskksldltgplllg
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  iavdwvyktiywtdaasktisvatldgtkrkflfnsdlrepasiavdplsgfvywsdwgepakiekagmngfdrrplv
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  qkilctkaenarmvvnidnaklaaddfrakyeaelamrqlveadinglrrilddltlckadleaqveslkeelmclkk
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  aislkftptetnkaeqcceetassislhgkgsfrfsysknetyqlflsysskkekmflhvkgeihlgrfvmrnrdvvl
ENSPTRP00000008485  evlegykkkyeeevalrataenefvalkkdvdcaylrksdleanvealiqeidflrrlyeeeirvlqshisdtsvvvk
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  ietkisrpmaltidyvnrrlywadenhiefsnmdgshrhkvpnqdipgvialtlfedyiywtdgktkslsrahktsga
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  ivdtkitwpngltldyvteriywadaredyiefasldgsnrhvvlsqdiphifaltlfedyvywtdwetksinrahkt
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  gtqrrvlfetdlvnprgivtdsvrgnlywtdwnrdnpkietsymdgtnrrilvqddlglpngltfdvfssqlcwvdag
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  nrkdlvktklgwpagvtldmiskrvywvdsrfdyietvtydgiqrktvvhggsliphpfgislfegqvfftdwtkmav
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  slvteniqwpngitldllsgrlywvdsklhsissidvnggnrktvledekrlahpfslavfedkvfwtdiineaifsa
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  ssdliwpsgitidfltdklywcdakqsviemanldgskrrrltqndvghpfavavfedyvwfsdwampsvirvnkrtg
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  rktiykdmktgawpngltvdhfekrivwtdarsdaiysalydgtnmieiirgheylshpfavslygsevywtdwrtnt
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  thlfwpngltidyagrrmywvdakhhvieranldgshrkavisqglphpfaitvfedslywtdwhtksinsankftgk
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  sanmdgtsvktlftgnlehlecvtldieeqklywavtgrgviergnvdgtdrmilvhqlshpwgiavhdsflyytdeq
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  rrtvhretgsggwpngltvdylekrilwidarsdaiysarydgsghmevlrgheflshpfavtlyggevywtdwrtnt
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  avdyfseriywadfelsiigsvlydgsnsvvsvsskqgllhphridifedyiygagpkngvfrvqkfghgsveylaln
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  gvpdlpesfpvrmrqfvgcmrnlqvdsrhidmadf...........................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  tadiqwpngitldliksrlywldsklhmlssvdlngqdrrivlksleflahplaltifedrvywidgeneavygankf
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  nheeevgslrcqlgdrlnievdaappvdltrvleemrcqyeamveanrrdveewfnmqmeelnqqvatsseqlqnyqs
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  tttfvddikalpttyekgeyfafletygthysssgslggiyeliyvldkasmnrkgvelkdikrclgyhldvsldfse
ENSPTRP00000008485  ldnsrdlnmdcivaeikaqyddiatrsraeaeswyrskceemkatvirhgetlrrtkeeinelnrmiqrltaevenak
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000022058  ..............................................................................
ENSPTRP00000021397  drisliyswhaitdiq..............................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000015555  ..............................................................................
ENSPTRP00000032748  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000057474  tgtnktllistlhrpmdlh...........................................................
ENSPTRP00000035956  ..............................................................................
ENSPTRP00000032807  ..............................................................................
ENSPTRP00000006428  ..............................................................................
ENSPTRP00000003607  tnraeclnpsqpsrrkaleglqypfavtsygknlyftdwkmnsvvaldlaisketdafqphkqtrlygit........
ENSPTRP00000010754  ..............................................................................
ENSPTRP00000011321  ..............................................................................
ENSPTRP00000032747  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000046968  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000022026  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000022056  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000060075  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000031716  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012792  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000015508  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000000970  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000021546  lkankftetnpqvyyqaslrpygvt.....................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000022516  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000003607  ..............................................................................
ENSPTRP00000017888  nrltgsdvnllaenllspedmvlfhnltqp................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000034969  ..............................................................................
ENSPTRP00000028112  kdrvrlqgsmlkpsslv.............................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  lskankwtgqnvsviqktsaqpfdlqiyhpsrqp............................................
ENSPTRP00000008515  ..............................................................................
ENSPTRP00000027670  ..............................................................................
ENSPTRP00000035066  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000025197  ..............................................................................
ENSPTRP00000022729  ..............................................................................
ENSPTRP00000017670  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000024985  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000056512  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000026116  ..............................................................................
ENSPTRP00000023256  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000005041  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000012755  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000046310  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000059463  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000035113  ..............................................................................
ENSPTRP00000036737  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000052123  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000006173  nqeiirnklhfpmdih..............................................................
ENSPTRP00000046526  ..............................................................................
ENSPTRP00000021546  yeviervdkatgankivlrdnvpnlrglqv................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028112  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000057474  lakankwtghnvtvvqrtntqpfdlq....................................................
ENSPTRP00000035842  ..............................................................................
ENSPTRP00000041706  ..............................................................................
ENSPTRP00000001581  ..............................................................................
ENSPTRP00000048671  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000002974  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000002493  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000028897  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000018085  ..............................................................................
ENSPTRP00000020306  ..............................................................................
ENSPTRP00000020087  ..............................................................................
ENSPTRP00000031762  ..............................................................................
ENSPTRP00000012046  ..............................................................................
ENSPTRP00000035228  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000006692  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000044880  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000036924  ..............................................................................
ENSPTRP00000028078  ..............................................................................
ENSPTRP00000032142  ..............................................................................
ENSPTRP00000005988  ..............................................................................
ENSPTRP00000027395  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000056675  ..............................................................................
ENSPTRP00000018116  ..............................................................................
ENSPTRP00000006720  ..............................................................................
ENSPTRP00000044502  ..............................................................................
ENSPTRP00000022833  ..............................................................................
ENSPTRP00000049157  ..............................................................................
ENSPTRP00000029424  ..............................................................................
ENSPTRP00000021397  idktkgvliahrykql..............................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034342  ..............................................................................
ENSPTRP00000024260  ..............................................................................
ENSPTRP00000022834  ..............................................................................
ENSPTRP00000061259  ..............................................................................
ENSPTRP00000018880  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000001803  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000017658  ..............................................................................
ENSPTRP00000029913  ..............................................................................
ENSPTRP00000011096  ..............................................................................
ENSPTRP00000049062  ..............................................................................
ENSPTRP00000046479  ..............................................................................
ENSPTRP00000049039  ..............................................................................
ENSPTRP00000049510  tgselatlvnnlndaqdiivyhelvqp...................................................
ENSPTRP00000052704  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000005841  ..............................................................................
ENSPTRP00000034549  ..............................................................................
ENSPTRP00000000195  ..............................................................................
ENSPTRP00000061149  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000059022  ..............................................................................
ENSPTRP00000034924  ..............................................................................
ENSPTRP00000046227  ..............................................................................
ENSPTRP00000004949  ..............................................................................
ENSPTRP00000003938  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000015610  diidlrrtvntleielqaqhslrdslentltesearyssqlaqmqcmitnveaqlaeiradlerqnqeyqvlldvrar
ENSPTRP00000026114  ..............................................................................
ENSPTRP00000056656  ..............................................................................
ENSPTRP00000033933  ..............................................................................
ENSPTRP00000033400  ..............................................................................
ENSPTRP00000000400  ..............................................................................
ENSPTRP00000033908  ..............................................................................
ENSPTRP00000031479  ..............................................................................
ENSPTRP00000049082  ..............................................................................
ENSPTRP00000036926  ..............................................................................
ENSPTRP00000028833  isvgaefnkddcvkrgegravnitsenliddvvslirggtrkyafelkekllrgtvidvtdfvkwassindapvlisq
ENSPTRP00000008485  cqnskleaavaqseqqgeaalsdarcklaelegalqkakqdmaclireyqevmnsklgldieiatyrrllegeeqrlc
ENSPTRP00000001800  ..............................................................................
ENSPTRP00000002992  ..............................................................................
ENSPTRP00000058611  ..............................................................................
ENSPTRP00000000553  ..............................................................................
ENSPTRP00000018082  ..............................................................................
ENSPTRP00000025264  ..............................................................................
ENSPTRP00000037768  ..............................................................................


                                                                         100                        
                                                                           |                        
d2dtge6               .................................VN..................FSFCQD..LHHK.............
ENSPTRP00000046526  .................................--..................-KNCLK..CHPS.............
ENSPTRP00000035956  .................................--..................-GRCER..CNRS.............
ENSPTRP00000035956  .................................--..................-NQCHP..CHHT.............
ENSPTRP00000046968  .................................--..................-GICEA..CHQS.............
ENSPTRP00000046968  .................................--..................-GRCKV..CHNS.............
ENSPTRP00000035956  .................................--..................-NLCRK..CSEN.............
ENSPTRP00000035956  .................................--..................-RHCVP..CHKD.............
ENSPTRP00000046968  .................................--..................-GLCKN..CDSY.............
ENSPTRP00000035956  .................................--..................-VECKA..CDSN.............
ENSPTRP00000035956  .................................--..................-GSCEN..CMEA.............
ENSPTRP00000032807  .................................-Da.................GHVCHL..CHPN.............
ENSPTRP00000022058  .................................--..................-SMCPP..SPLG.............
ENSPTRP00000021397  .................................V-..................---YHS..YRQPdvskhl.......
ENSPTRP00000046968  .................................--..................-HVCQP..CNTH.............
ENSPTRP00000015555  .................................--..................-GCCAT..CALGlgmp.........
ENSPTRP00000032748  .................................--..................-GCCLT..CALSegqp.........
ENSPTRP00000022026  .................................DP..................DRECHP..CHPN.............
ENSPTRP00000015508  .................................--..................-RHCLP..CHPE.............
ENSPTRP00000057474  .................................VF..................HALRQPdvPNHP.............
ENSPTRP00000035956  .................................-E..................KFNCEK..CHES.............
ENSPTRP00000032807  .................................MD..................VNPEGK..YSFG.............
ENSPTRP00000006428  .................................VD..................VNECRR..----.............
ENSPTRP00000003607  .................................TA..................LSQCPR..GHNY.............
ENSPTRP00000010754  .................................VD..................ENECAT..GFHR.............
ENSPTRP00000011321  .................................QD..................VNECAT..----.............
ENSPTRP00000032747  .................................--..................------..----.............
ENSPTRP00000049039  .................................ED..................IDECSL..NPLL.............
ENSPTRP00000046968  .................................--..................-SLCLA..CQPQ.............
ENSPTRP00000012046  .................................ID..................VDECAS..G---.............
ENSPTRP00000005841  .................................GD..................TNECSI..NNGG.............
ENSPTRP00000022026  .................................LE..................HNFNAK..YTYG.............
ENSPTRP00000029424  .................................TD..................VDECQT..----.............
ENSPTRP00000022056  .................................GC..................CSVCAR..LEGEa............
ENSPTRP00000034969  .................................VA..................VDYCAS..ENHG.............
ENSPTRP00000029424  .................................ED..................INECAQ..NPLL.............
ENSPTRP00000034969  .................................RR..................INYCAL..NKPG.............
ENSPTRP00000012046  .................................VD..................IDECSI..MNGG.............
ENSPTRP00000056675  .................................LD..................VDECAE..GNGG.............
ENSPTRP00000049039  .................................VD..................INECRV..QNGG.............
ENSPTRP00000060075  .................................ED..................IDECRT..SSYL.............
ENSPTRP00000029424  .................................LD..................IDECSS..FF--.............
ENSPTRP00000012046  .................................KD..................INECET..----.............
ENSPTRP00000029424  .................................ID..................NNECGS..QPSL.............
ENSPTRP00000002974  .................................QD..................INECQE..----.............
ENSPTRP00000031716  .................................PD..................INKCTK..CKAD.............
ENSPTRP00000012046  .................................ID..................NNECTS..DINL.............
ENSPTRP00000012792  .................................VD..................RDFCAN..ILSA.............
ENSPTRP00000012046  .................................RD..................IDECLQ..----.............
ENSPTRP00000049039  .................................KD..................VDECLS..----.............
ENSPTRP00000012046  .................................ED..................INECAQ..NPLL.............
ENSPTRP00000036737  .................................ED..................VDECLE..GLDD.............
ENSPTRP00000015508  .................................--..................-FESMP..NPEGrytf.........
ENSPTRP00000018880  .................................QD..................VDECAR..SPPP.............
ENSPTRP00000000970  .................................--..................--E---..----.............
ENSPTRP00000056675  .................................GD..................VDECSI..NRGG.............
ENSPTRP00000049039  .................................VD..................FDECTT..L---.............
ENSPTRP00000021546  .................................VY..................HSLRQP..YATNp............
ENSPTRP00000012046  .................................MD..................IDECQR..DPLL.............
ENSPTRP00000012046  .................................TD..................LDECSE..NLNL.............
ENSPTRP00000005841  .................................LD..................VDECLE..NNGG.............
ENSPTRP00000046479  .................................QD..................INECEH..----.............
ENSPTRP00000022516  .................................--..................------..----.............
ENSPTRP00000029424  .................................MD..................IDECER..NPLL.............
ENSPTRP00000006720  .................................SD..................IDECSY..SSYL.............
ENSPTRP00000003607  .................................YD..................IDECSE..QPSV.............
ENSPTRP00000017888  .................................RG..................VNWCER..TTLS.............
ENSPTRP00000029424  .................................SD..................VDECAE..NINL.............
ENSPTRP00000034969  .................................SR..................VDYCLL..SDHG.............
ENSPTRP00000028112  .................................VV..................HPLAKP..GADP.............
ENSPTRP00000024985  .................................VD..................VNECQR..Y---.............
ENSPTRP00000029424  .................................TD..................IDECAD..----.............
ENSPTRP00000021397  .................................QA..................PNPCAA..NDGK.............
ENSPTRP00000008515  .................................--..................------..----.............
ENSPTRP00000027670  .................................--..................---CPM..CARGe............
ENSPTRP00000035066  .................................--..................-MECVEg.CEVG.............
ENSPTRP00000029424  .................................ID..................VNECDL..NSNI.............
ENSPTRP00000025197  .................................LD..................VDECET..----.............
ENSPTRP00000022729  .................................LD..................IDYCEP..----.............
ENSPTRP00000017670  .................................VN..................FSFCQD..LHHK.............
ENSPTRP00000049039  .................................MD..................VDECAR..DPLL.............
ENSPTRP00000024985  .................................ED..................IDECAL..PTG-.............
ENSPTRP00000049039  .................................ED..................VNECDG..----.............
ENSPTRP00000056512  .................................AD..................VDECSL..AEKA.............
ENSPTRP00000022834  .................................QD..................VDECVG..----.............
ENSPTRP00000026116  .................................KD..................VDECSL..KPSI.............
ENSPTRP00000023256  .................................RA..................IDYCSF..GNHS.............
ENSPTRP00000029424  .................................VD..................ENECRT..KPGI.............
ENSPTRP00000005041  .................................--..................------..----.............
ENSPTRP00000011096  .................................QD..................INECEQ..----.............
ENSPTRP00000012755  .................................YStendvetir.........ASVCAP..CHAS.............
ENSPTRP00000006692  .................................YN..................IDECSQ..DPSL.............
ENSPTRP00000049039  .................................QD..................VDECAQ..----.............
ENSPTRP00000012046  .................................QD..................INECGS..AQAP.............
ENSPTRP00000011096  .................................VD..................VNECLT..----.............
ENSPTRP00000046310  .................................--..................------..----.............
ENSPTRP00000046227  .................................LE..................IDECWS..----.............
ENSPTRP00000049082  .................................LN..................INECQS..----.............
ENSPTRP00000059463  .................................SS..................VNYCEC..----.............
ENSPTRP00000032142  .................................--..................------..CSAP.............
ENSPTRP00000046479  .................................ID..................VDECLR..----.............
ENSPTRP00000035113  .................................--..................-SCCLV..CARQ.............
ENSPTRP00000036737  .................................QD..................INECEE..ESIE.............
ENSPTRP00000025264  .................................ID..................VNECWA..----.............
ENSPTRP00000006692  .................................RD..................VNECAE..----.............
ENSPTRP00000052123  .................................--..................------..----.............
ENSPTRP00000002974  .................................MD..................INECEQ..VPKP.............
ENSPTRP00000029424  .................................ED..................INECES..----.............
ENSPTRP00000011096  .................................ID..................IDECAN..----.............
ENSPTRP00000036924  .................................GD..................VNECLS..----.............
ENSPTRP00000029424  .................................HD..................VNECSS..SKNP.............
ENSPTRP00000006173  .................................TL..................HPQRQP..AGKNr............
ENSPTRP00000046526  .................................LP..................HKVCRR..CGEN.............
ENSPTRP00000021546  .................................YH..................RRNAAE..SSNG.............
ENSPTRP00000011096  .................................ED..................LDECAF..----.............
ENSPTRP00000018116  .................................AD..................INECRS..----.............
ENSPTRP00000028112  .................................ED..................VNECAF..WNHG.............
ENSPTRP00000025264  .................................VD..................INECVT..DLHT.............
ENSPTRP00000057474  .................................VY..................HPSRQP..MAPNp............
ENSPTRP00000035842  .................................--..................------..----.............
ENSPTRP00000041706  .................................--..................---CSV..QLTG.............
ENSPTRP00000001581  .................................--..................------..----.............
ENSPTRP00000048671  .................................EE..................YNECLS..----.............
ENSPTRP00000036924  .................................--..................-NLVHW..CDS-.............
ENSPTRP00000002974  .................................QD..................IDECLE..QNVH.............
ENSPTRP00000036924  .................................VN..................TDECAS..----.............
ENSPTRP00000018880  .................................TD..................VDECSS..GAPP.............
ENSPTRP00000002493  .................................VT..................AERCAS..LHSV.............
ENSPTRP00000018116  .................................SQ..................VDECRS..----.............
ENSPTRP00000018880  .................................LD..................VDECRE..----.............
ENSPTRP00000018116  .................................VD..................IDECQS..----.............
ENSPTRP00000028897  .................................DD..................CGCCRV..CAAGrget.........
ENSPTRP00000046479  .................................RD..................IDECQQ..----.............
ENSPTRP00000018085  .................................TD..................VNECTS..GQNP.............
ENSPTRP00000020306  .................................--..................------..----.............
ENSPTRP00000020087  .................................SV..................RDKCAL..GSHG.............
ENSPTRP00000031762  .................................--..................-GCCRV..CAKQlge..........
ENSPTRP00000012046  .................................ED..................IDECES..----.............
ENSPTRP00000035228  .................................--..................------..----.............
ENSPTRP00000006692  .................................VD..................LNECAK..----.............
ENSPTRP00000036924  .................................ED..................INECAS..----.............
ENSPTRP00000049082  .................................--..................-ETCES..CPLGtyqpkf.......
ENSPTRP00000018880  .................................LD..................VDECHR..VPPP.............
ENSPTRP00000006692  .................................--..................-RQCLSp.EDME.............
ENSPTRP00000018116  .................................--..................-PLCLP..PSHP.............
ENSPTRP00000044880  .................................TS..................IDACAS..----.............
ENSPTRP00000025264  .................................KD..................VDECAL..GTHN.............
ENSPTRP00000028078  .................................HD..................IDECSL..GQYQ.............
ENSPTRP00000011096  .................................ED..................VNECMG..----.............
ENSPTRP00000036924  .................................SE..................VNECNS..----.............
ENSPTRP00000028078  .................................SS..................ALTCSM..----.............
ENSPTRP00000032142  .................................--..................------..CELS.............
ENSPTRP00000005988  .................................KD..................IDECSE..GIIE.............
ENSPTRP00000027395  .................................--..................-NCCLV..CAASe............
ENSPTRP00000029424  .................................ED..................IDECSI..IPGI.............
ENSPTRP00000049039  .................................VG..................RNECRE..IPNV.............
ENSPTRP00000059022  .................................ED..................IDECRS..----.............
ENSPTRP00000056675  .................................--..................-KPCQP..CPRGtyqpeagrtl...
ENSPTRP00000018116  .................................RD..................VDECLS..----.............
ENSPTRP00000006720  .................................VD..................VDECAQ..ALHD.............
ENSPTRP00000044502  .................................ID..................INECTM..DSHT.............
ENSPTRP00000022833  .................................ED..................VDDCIL..EPSP.............
ENSPTRP00000049157  .................................-Tagpghtaapa........LRVCSS..CHAS.............
ENSPTRP00000029424  .................................ID..................VDECTS..----.............
ENSPTRP00000021397  .................................D-..................------..----.............
ENSPTRP00000059022  .................................GD..................VDECLD..----.............
ENSPTRP00000034342  .................................SD..................KDECSK..DNGG.............
ENSPTRP00000024260  .................................--..................-HRCPP..CRDGha...........
ENSPTRP00000022834  .................................VD..................VDECQD..----.............
ENSPTRP00000061259  .................................VD..................TDECQI..----.............
ENSPTRP00000018880  .................................VD..................INECDE..AEAA.............
ENSPTRP00000059022  .................................QD..................LDECLM..AQQG.............
ENSPTRP00000049039  .................................ID..................VDECTS..----.............
ENSPTRP00000001803  .................................IA..................NNGTVPg.CPAK.............
ENSPTRP00000025264  .................................VD..................INECTS..LSEP.............
ENSPTRP00000017658  .................................ED..................IDECTEm.C---.............
ENSPTRP00000029913  .................................--..................---CEH..PPPM.............
ENSPTRP00000011096  .................................VD..................VNECDD..LN--.............
ENSPTRP00000049062  .................................TD..................IDECEV..----.............
ENSPTRP00000046479  .................................VD..................VNECDE..LNNR.............
ENSPTRP00000049039  .................................VS..................------..----.............
ENSPTRP00000049510  .................................SG..................KNWCEE..DMEN.............
ENSPTRP00000052704  .................................--..................------..----.............
ENSPTRP00000005841  .................................--..................-APCQL..CALGtfqpeagrts...
ENSPTRP00000005841  .................................LEredtvlevtesnttsvvdGDKRVK..---Rrllmet.......
ENSPTRP00000034549  .................................--..................-RCCRV..CPAAerev.........
ENSPTRP00000000195  .................................--..................-AGCSM..CEQD.............
ENSPTRP00000061149  .................................--..................-NGCLP..CQCNnrsas........
ENSPTRP00000059022  .................................TS..................TDYCVS..----.............
ENSPTRP00000059022  .................................LP..................LSSCQK..AALS.............
ENSPTRP00000034924  .................................-D..................INGTLL..SQAT.............
ENSPTRP00000046227  .................................--..................-RDCSD..ILLG.............
ENSPTRP00000004949  .................................MD..................TNECIQ..FPFV.............
ENSPTRP00000003938  .................................--..................------..CASK.............
ENSPTRP00000058611  .................................--..................-NQCKE..CPPD.............
ENSPTRP00000015610  ..................legeintyrslleseDC..................KLPCNP..CSTPs............
ENSPTRP00000026114  .................................--..................------..----.............
ENSPTRP00000056656  .................................--..................-VACKA..CPAG.............
ENSPTRP00000033933  .................................--..................------..----.............
ENSPTRP00000033400  .................................--..................------..----.............
ENSPTRP00000000400  .................................--..................-DACQA..CSPG.............
ENSPTRP00000033908  .................................--..................-KACQA..CPRG.............
ENSPTRP00000031479  .................................--..................------..----.............
ENSPTRP00000049082  .................................--..................---CEL..VHCP.............
ENSPTRP00000036926  .................................SD..................VDECSA..RRGG.............
ENSPTRP00000028833  klspiynlvpvkmknahlkkqnleraiedyineFS..................VRKCHT..----.............
ENSPTRP00000008485  ..............................egvEA..................VNVCVS..SSRG.............
ENSPTRP00000001800  .................................--..................------..----.............
ENSPTRP00000002992  .................................--..................------..----.............
ENSPTRP00000058611  .................................TE..................RPPCTT..KDYFqihtpcdeegktq
ENSPTRP00000000553  .................................--..................DQLCAR..----.............
ENSPTRP00000018082  .................................ND..................INECIPp.YSVY.............
ENSPTRP00000025264  .................................DD..................QDECLL..LPG-.............
ENSPTRP00000037768  .................................LQ..................DQECIP..CTKQ.............


                           110                                120                                   
                             |                                  |                                   
d2dtge6               .......CK......NSRRQ...................GCHQ.........YVIHNN......KC............
ENSPTRP00000046526  .......CK......KCVDEpek................CTVCkeg......FSLARG......SC............
ENSPTRP00000035956  .......CK......GCQGPrptd...............CLSCdrfff....LLRSKG......EC............
ENSPTRP00000035956  .......CQ......RCQGSgpth...............CTSCgadnygre.HFLYQG......EC............
ENSPTRP00000046968  .......CF......RCAGKsphn...............CTDCgps......HVLLDG......QC............
ENSPTRP00000046968  .......CA......SCSGPtash...............CTACspp......KALRQG......HC............
ENSPTRP00000035956  .......CK......TCTEFhn.................CTECrdg......LSLQGS......RC............
ENSPTRP00000035956  .......CL......ECSGPkadd...............CELCless.....WVLYDG......LC............
ENSPTRP00000046968  .......CL......QCQGPhe.................CTRCkgp......FLLLEA......QC............
ENSPTRP00000035956  .......CG......SCDQNg..................CYWCegg......FFLLGG......SC............
ENSPTRP00000035956  .......CA......ICSGAdl.................CQKCqmqpghp..LFLHEG......RC............
ENSPTRP00000032807  .......CTy.....GCTGP...................----.........------......--............
ENSPTRP00000022058  .......CE......LVKEPg..................CGCCmt.......CALAEG......QScgvy........
ENSPTRP00000021397  .......CM......INNGG...................CSHL.........CLLAPGk.....TH............
ENSPTRP00000046968  .......CG......SCDSQas.................CTSCrdpn.....KVLLFG......EC............
ENSPTRP00000015555  .......CG......VYTPR...................CGSGlr.......C-----......--............
ENSPTRP00000032748  .......CG......IYTER...................CGSGlr.......CQP---......--............
ENSPTRP00000022026  .......CTq.....GCNGP...................----.........------......--............
ENSPTRP00000015508  .......CQpqngsvTCFGPeadq...............CVACa........HYKDPP......FC............
ENSPTRP00000057474  .......CK......VNNGG...................CSNL.........CLLSPGg.....GH............
ENSPTRP00000035956  .......CM......ECKGPgakn...............CTLCpanlv....LHMDDS......RC............
ENSPTRP00000032807  .......-A......TCVKK...................CPRN.........YVVTDHg.....SC............
ENSPTRP00000006428  .......--......----Plerrv..............CHHS.........CHNTVG......SF............
ENSPTRP00000003607  .......CS......VNNGG...................CTHL.........CLATPG......SR............
ENSPTRP00000010754  .......--......-----...................CGPNsv.......CINLPG......SY............
ENSPTRP00000011321  .......--......--ENP...................CVQT.........CVNTYG......SF............
ENSPTRP00000032747  .......--......-----...................----.........------......--............
ENSPTRP00000049039  .......--......-----...................CAFR.........CHNTEG......SY............
ENSPTRP00000046968  .......CS......TCTSGle.................CSSCqpp......LLMRHG......QC............
ENSPTRP00000012046  .......--......----Ngnl................CRNGq........CINTVG......SF............
ENSPTRP00000005841  .......--......-----...................CQQV.........CVNTVG......SY............
ENSPTRP00000022026  .......-A......FCVKK...................CPHN.........FVVDSS......SC............
ENSPTRP00000029424  .......--......--PGI...................CMNGh........CINSEG......SF............
ENSPTRP00000022056  .......CG......VYTPR...................CGQGlr.......CYPHPG......S-............
ENSPTRP00000034969  .......--......-----...................CEHE.........CVNADG......SY............
ENSPTRP00000029424  .......--......-----...................CAFR.........CMNTFG......SY............
ENSPTRP00000034969  .......--......-----...................CEHE.........CVNTEE......SY............
ENSPTRP00000012046  .......--......-----...................CETF.........CTNSEG......SY............
ENSPTRP00000056675  .......--......-----...................CQQS.........CVNMMG......SY............
ENSPTRP00000049039  .......--......-----...................CDVH.........CINTEG......SY............
ENSPTRP00000060075  .......--......-----...................CQYQ.........CVNEPG......KF............
ENSPTRP00000029424  .......--......---GQv..................CRNGr........CFNEIG......SF............
ENSPTRP00000012046  .......--......--PGI...................CMNGr........CVNTDG......SY............
ENSPTRP00000029424  .......--......-----...................CGAKgi.......CQNTPG......SF............
ENSPTRP00000002974  .......--......--SSP...................CHQR.........CFNAIG......SF............
ENSPTRP00000031716  .......CD......TCFNKnf.................CTKCksg......FYLHLG......KC............
ENSPTRP00000012046  .......--......-----...................CGSKgi.......CQNTPG......SF............
ENSPTRP00000012792  .......--......--ESS...................DSEG.........FVIHDG......EC............
ENSPTRP00000012046  .......--......---NGri.................CNNGr........CINTDG......SF............
ENSPTRP00000049039  .......--......---SP...................CVNGv........CQNLAG......SY............
ENSPTRP00000012046  .......--......-----...................CAFR.........CVNTYG......SY............
ENSPTRP00000036737  .......--......-----...................CHYNql.......CENTPG......GH............
ENSPTRP00000015508  .......GA......SCVTA...................CPYNy........LSTDVG......SC............
ENSPTRP00000018880  .......--......-----...................CTYGr........CENTEG......SF............
ENSPTRP00000000970  .......--......-----...................----.........------......--............
ENSPTRP00000056675  .......--......-----...................CRFG.........CINTPG......SY............
ENSPTRP00000049039  .......--......--VGQv..................CRFGh........CLNTAG......SF............
ENSPTRP00000021546  .......CK......DNNGG...................CEQV.........CVLSHRtdndglGF............
ENSPTRP00000012046  .......--......-----...................CRGGv........CHNTEG......SY............
ENSPTRP00000012046  .......--......-----...................CGNGq........CLNAPG......GY............
ENSPTRP00000005841  .......--......-----...................CQHT.........CVNVMG......SY............
ENSPTRP00000046479  .......--......--PGL...................CGPQge.......CLNTEG......SF............
ENSPTRP00000022516  .......--......-----...................----.........------......--............
ENSPTRP00000029424  .......--......-----...................CRGGt........CVNTEG......SF............
ENSPTRP00000006720  .......--......-----...................CQYR.........CVNEPG......RF............
ENSPTRP00000003607  .......--......-----...................CGSHti.......CNNHPG......TF............
ENSPTRP00000017888  .......NG......GCQYL...................CLPApq.......INPHSP......KF............
ENSPTRP00000029424  .......--......-----...................CENGq........CLNVPG......AY............
ENSPTRP00000034969  .......--......-----...................CEYS.........CVNMDR......SF............
ENSPTRP00000028112  .......CL......YQNGG...................CEHI.........CKKRLG......TA............
ENSPTRP00000024985  .......--......----Pgrl................CGHK.........CENTLG......SY............
ENSPTRP00000029424  .......--......----Pin.................CVNGl........CVNTPG......RY............
ENSPTRP00000021397  .......--......---GP...................CSHMc........LINHNR......SA............
ENSPTRP00000008515  .......--......-----...................----.........------......-Y............
ENSPTRP00000027670  .......GE......PCGGGgagrgy.............CAPGme.......CVKSRK......RRkgkagaaaggpg
ENSPTRP00000035066  .......HW......SE---...................----.........------......--............
ENSPTRP00000029424  .......--......-----...................CMFGe........CENTKG......SF............
ENSPTRP00000025197  .......--......---EV...................CPGEnkq......CENTEG......GY............
ENSPTRP00000022729  .......--......---NP...................CQNGaq.......CYNRAS......DY............
ENSPTRP00000017670  .......CK......NSRRQ...................GCHQ.........YVIHNN......KC............
ENSPTRP00000049039  .......--......-----...................CRGGt........CTNTDG......SY............
ENSPTRP00000024985  .......--......----Ghi.................CSYR.........CINIPG......SF............
ENSPTRP00000049039  .......--......----Phr.................CQHG.........CQNQLG......GY............
ENSPTRP00000056512  .......--......-----...................CVRKhen......CYNTPG......SY............
ENSPTRP00000022834  .......--......----Pggpl...............CDSL.........CFNTQG......SF............
ENSPTRP00000026116  .......--......-----...................CGTAv........CKNIPG......DF............
ENSPTRP00000023256  .......--......-----...................CQHE.........CVSTPG......GP............
ENSPTRP00000029424  .......--......-----...................CENGr........CVNIIG......SY............
ENSPTRP00000005041  .......--......----H...................CG--.........------......--............
ENSPTRP00000011096  .......--......--PGV...................CSGGq........CTNTEG......SY............
ENSPTRP00000012755  .......CA......TCQGPaltd...............CL--.........------......--............
ENSPTRP00000006692  .......--......-----...................CLPHga.......CKNLQG......SY............
ENSPTRP00000049039  .......--......---GNl..................CAFGs........CENLPG......MF............
ENSPTRP00000012046  .......--......-----...................CSYG.........CSNTEG......GY............
ENSPTRP00000011096  .......--......--PGV...................CAHGk........CTNLEG......SF............
ENSPTRP00000046310  .......--......-----...................CNEAdl.......CDPHKG......LY............
ENSPTRP00000046227  .......--......---QP...................CLNGat.......CQDALG......AY............
ENSPTRP00000049082  .......--......---NP...................CRNQat.......CVDELN......SY............
ENSPTRP00000059463  .......--......---NP...................CFNGgs.......CHSGVD......SY............
ENSPTRP00000032142  .......VS......RCEHAp..................CHNGat.......CHERGH......RY............
ENSPTRP00000046479  .......--......--PDV...................CGEGh........CVNTVG......AF............
ENSPTRP00000035113  .......--......--R-Ges.................CSDLep.......CDESSG......LY............
ENSPTRP00000036737  .......--......-----...................CGPGqm.......CFNTRG......SY............
ENSPTRP00000025264  .......--......---SPgrl................CQHT.........CENTLG......SY............
ENSPTRP00000006692  .......--......---GSp..................CSPGw........CENLPG......SF............
ENSPTRP00000052123  .......--......-----...................----.........------......--............
ENSPTRP00000002974  .......--......-----...................CAHQ.........CSNTPG......SF............
ENSPTRP00000029424  .......--......---NP...................CVNGa........CRNNLG......SF............
ENSPTRP00000011096  .......--......---DTm..................CGSHgf.......CDNTDG......SF............
ENSPTRP00000036924  .......--......---NP...................CDARgtqn.....CVQRVN......DF............
ENSPTRP00000029424  .......--......-----...................CNYG.........CSNTEG......GY............
ENSPTRP00000006173  .......CG......DNNGG...................CTHL.........CLPSGQ......NY............
ENSPTRP00000046526  .......CL......SCAGSsrn................CSRCktg......FTQLGT......SC............
ENSPTRP00000021546  .......CS......NNMNA...................CQQI.........CLPVPGg.....LF............
ENSPTRP00000011096  .......--......--PGV...................CPSGv........CTNTAG......SF............
ENSPTRP00000018116  .......--......---GA...................CHAAhtrdc....LQDPGG......GF............
ENSPTRP00000028112  .......--......-----...................CTLG.........CKNTPG......SY............
ENSPTRP00000025264  .......--......-----...................CSRGeh.......CVNTLG......SF............
ENSPTRP00000057474  .......CE......A-NGGrgp................CSHLc........LINYNR......TV............
ENSPTRP00000035842  .......--......-----...................----.........------......--............
ENSPTRP00000041706  .......CQ......---GHtcplaat............CIPT.........FESGVH......SY............
ENSPTRP00000001581  .......--......-----...................----.........------......--............
ENSPTRP00000048671  .......--......---AP...................CLNAat.......CRDLVN......GY............
ENSPTRP00000036924  .......--......---SP...................CKNGgk.......CWQTHT......QY............
ENSPTRP00000002974  .......--......-----...................CGPNrm.......CFNMRG......SY............
ENSPTRP00000036924  .......--......---SP...................CLHNgr.......CLDKIN......EF............
ENSPTRP00000018880  .......--......-----...................CGPHgh.......CTNTEG......SF............
ENSPTRP00000002493  .......--......---PG...................RAST.........FGIHQG......SC............
ENSPTRP00000018116  .......--......---QP...................CRHGgk.......CLDLVD......KY............
ENSPTRP00000018880  .......--......--RGPal.................CGSQr........CENSPG......SY............
ENSPTRP00000018116  .......--......---SP...................CVNGgv.......CKDRVN......GF............
ENSPTRP00000028897  .......CY......RTVSGmdgmk..............CGPGlr.......CQPSN-......--............
ENSPTRP00000046479  .......--......---GNl..................CVNGq........CKNTEG......SF............
ENSPTRP00000018085  .......--......-----...................CHSSth.......CLNNVG......SY............
ENSPTRP00000020306  .......--......-----...................----.........------......--............
ENSPTRP00000020087  .......--......-----...................CQHI.........CVSDGAa.....SY............
ENSPTRP00000031762  .......LC......TERDP...................CDPHkg.......LFC---......--............
ENSPTRP00000012046  .......--......---SP...................CINGv........CKNSPG......SF............
ENSPTRP00000035228  .......--......-----...................----.........--PHRG......LY............
ENSPTRP00000006692  .......--......---PHl..................CGDGgf.......CINFPG......HY............
ENSPTRP00000036924  .......--......---DP...................CRNGan.......CTDCVD......SY............
ENSPTRP00000049082  .......G-......----Srs.................CLSCpentstvkrGAVNIS......AC............
ENSPTRP00000018880  .......--......-----...................CDLGr........CENTPG......SF............
ENSPTRP00000006692  .......VD......ECQDPaa.................CRPGr........CVNLPS......SY............
ENSPTRP00000018116  .......CA......H--EP...................CSHGi........CYDAPG......GF............
ENSPTRP00000044880  .......--......---SP...................CFNRatcy.....TDLSTD......TF............
ENSPTRP00000025264  .......--......-----...................CSEAet.......CHNIQG......SF............
ENSPTRP00000028078  .......--......-----...................CSSFar.......CYNIRG......SY............
ENSPTRP00000011096  .......--......--EEH...................CAPHge.......CLNSHG......SF............
ENSPTRP00000036924  .......--......---NP...................CVHGa........CRDSLN......GY............
ENSPTRP00000028078  .......--......---AN...................CQYG.........CDVVKG......QI............
ENSPTRP00000032142  .......AM......TCADGp..................CFNGgr.......CSDSPDg.....GY............
ENSPTRP00000005988  .......--......-----...................CHNHsr.......CVNLPG......WY............
ENSPTRP00000027395  .......GE......PCGGPldsp...............CGES.........LECVRG......LC............
ENSPTRP00000029424  .......--......-----...................CETGe........CSNTVG......SY............
ENSPTRP00000049039  .......--......-----...................CSHGd........CMDTEG......SY............
ENSPTRP00000059022  .......--......---FP...................CANGgq.......CQDQPG......AF............
ENSPTRP00000056675  .......CF......PCGGGlttkhegaisfqd......C---.........------......DT............
ENSPTRP00000018116  .......--......---NP...................CGPGt........CTDHVA......SF............
ENSPTRP00000006720  .......--......-----...................CRPSqd.......CHNLPG......SY............
ENSPTRP00000044502  .......--......-----...................CSHHan.......CFNTQG......SF............
ENSPTRP00000022833  .......--......-----...................CPQR.........CVNTQG......GF............
ENSPTRP00000049157  .......CY......TCRGGsprd...............CT--.........------......--............
ENSPTRP00000029424  .......--......---NP...................CTNGd........CVNTPG......SY............
ENSPTRP00000021397  .......--......-LPNP...................CLDLacefl....CLLNPS......GA............
ENSPTRP00000059022  .......--......---QP...................CHPTgtaa.....CHSLAN......AF............
ENSPTRP00000034342  .......--......-----...................CQQD.........CVNTFG......SY............
ENSPTRP00000024260  .......CN......HVTGK...................CTRCn........AGWIGD......RC............
ENSPTRP00000022834  .......--......---SP...................CAQE.........CVNTPG......GF............
ENSPTRP00000061259  .......--......--AGV...................CQQM.........CVNYVG......GF............
ENSPTRP00000018880  .......--......---SPl..................CVNAr........CLNTDG......SF............
ENSPTRP00000059022  .......--......--PSP...................CEHGgs.......CLNTPG......SF............
ENSPTRP00000049039  .......--......---SP...................CHHGd........CVNIPG......TY............
ENSPTRP00000001803  .......KN......VCDSNt..................CHNGgt.......CVNQWD......AF............
ENSPTRP00000025264  .......--......-----...................CRPGfs.......CINTVG......SY............
ENSPTRP00000017658  .......--......-----...................-PINst.......CTNTPG......SY............
ENSPTRP00000029913  .......VL......LQTSPcdqye..............CQNGaq.......CIVVQQ......EP............
ENSPTRP00000011096  .......--......---GPavl................CVHGy........CENTEG......SY............
ENSPTRP00000049062  .......--......--SGL...................CRHGgr.......CVNTHG......SF............
ENSPTRP00000046479  .......--......--MSL...................CKNAk........CINTDG......SY............
ENSPTRP00000049039  .......--......-----...................----.........------......--............
ENSPTRP00000049510  .......--......---GGceyl...............CLPApq.......INDHSP......KY............
ENSPTRP00000052704  .......--......-----...................----.........------......--............
ENSPTRP00000005841  .......CF......PCGGGlatkhqgatsfqdcetrvqCSPGh........FYNTTT......HR............
ENSPTRP00000005841  .......CA......VNNGG...................CDRT.........CKDTST......GV............
ENSPTRP00000034549  .......CG......GAQGQp..................CAPGlqcl.....Q-----......--............
ENSPTRP00000000195  .......--......-----...................CKQG.........QELTKK......GC............
ENSPTRP00000061149  .......CD......ALTGA...................CLNC.........QENSKG......NH............
ENSPTRP00000059022  .......--......---AP...................CFNGgt.......CVNRPG......TF............
ENSPTRP00000059022  .......QG......IDVSSl..................CHNGgl.......CVDSGP......SY............
ENSPTRP00000034924  .......CE......LCDGNensfmvvnalgdr......CVRCe........PTFVNT......SR............
ENSPTRP00000046227  .......CThq....QCLNNgi.................CIPH.........FQDGQH......GF............
ENSPTRP00000004949  .......--......-----...................CPRDkpv......CVNTYG......SY............
ENSPTRP00000003938  .......YD......DCEGGsvar...............CVHGicedl....MREQAGep....KY............
ENSPTRP00000058611  .......TY......-----...................-LSI.........HQVYGK......EA............
ENSPTRP00000015610  .......CT......TCVPSp..................CVPRtic......VPRTVG......VP............
ENSPTRP00000026114  .......--......-----...................----.........------......--............
ENSPTRP00000056656  .......TF......KASQEaeg................CSHCpsns.....RSPAEA......SP............
ENSPTRP00000033933  .......--......-----...................----.........------......--............
ENSPTRP00000033400  .......--......-----...................CQPCpans.....HSNTIG......SA............
ENSPTRP00000000400  .......FF......KFEASesp................CLECpeht.....LPSPEG......AT............
ENSPTRP00000033908  .......LY......KASAGnap................CSPCpars.....HAANPA......AP............
ENSPTRP00000031479  .......--......---SQdlq................CSRCpths.....FSDKEG......SS............
ENSPTRP00000049082  .......AL......KPPENgy.................FIQNt........CNNHFNa.....AC............
ENSPTRP00000036926  .......--......-----...................CPQR.........CVNTAG......SY............
ENSPTRP00000028833  .......--......-----...................CQNGgt.......VILMDG......KC............
ENSPTRP00000008485  .......GV......VCGDL...................CVSGs........RPVTGS......VC............
ENSPTRP00000001800  .......--......-----...................----.........------......--............
ENSPTRP00000002992  .......--......-----...................----.........------......--............
ENSPTRP00000058611  imykwiePK......ICREDltdairlppsgekkd....CPPCnpg......FYNNGS......SS............
ENSPTRP00000000553  .......--......-----...................CPPHs........HSAAPA......SQ............
ENSPTRP00000018082  .......--......-----...................CGFNav.......CHNVEG......SF............
ENSPTRP00000025264  .......--......----El..................CQHL.........CINTVG......SY............
ENSPTRP00000037768  .......--......-----...................----.........------......--............


                        130             140                             150                         
                          |               |                               |                         
d2dtge6               ...IPE.....CP.SGYTMNSSN..........LLCTP............CLGPC---pkv.................
ENSPTRP00000046526  ...IPD.....CE.PGTYFDSEL..........IRCGE............CHHTCGTCvg..................
ENSPTRP00000035956  ...HRS.....CP.DHYYVEQST..........QTCER............CHPTC---....................
ENSPTRP00000035956  ...QDS.....CP.EGHYAT-EG..........NTCLP............CPDNCELCh...................
ENSPTRP00000046968  ...LSQ.....CP.DGYFH--QE..........GSCTE............CHPTC---....................
ENSPTRP00000046968  ...LPR.....CG.EGFYS--DH..........GVCKA............CHSSCLACmg..................
ENSPTRP00000035956  ...SVS.....CE.DGRYF--NG..........QDCQP............CHRFCATC....................
ENSPTRP00000035956  ...LEE.....CP.AGTYYEKET..........KECRD............CHKSCLTCss..................
ENSPTRP00000046968  ...VQE.....CG.KGYFADHAK..........HKCTA............CPWGCLQCs...................
ENSPTRP00000035956  ...VRK.....CG.PGFYGDQEM..........GDCES............CHRACETCtg..................
ENSPTRP00000035956  ...YSK.....CP.EGSYA--ED..........GICER............CSSPCRTCeg..................
ENSPTRP00000032807  ...---.....--.---------..........-----............--------glegc...............
ENSPTRP00000022058  ...TER.....CA.QGL------..........-RC--............--------lprqdeekplhallhgrgvc
ENSPTRP00000021397  ...TCA.....CP.TNFYLAADN..........RTCLSn...........CTASQFRC....................
ENSPTRP00000046968  ...QYEs....CA.PQYYLDFST..........NTCKE............CDWSC---....................
ENSPTRP00000015555  ...---.....--.---------..........-----............--------ypprgvekplhtlmhgqglc
ENSPTRP00000032748  ...---.....--.---------..........-----............--------spdearplqalldgrglcvn
ENSPTRP00000022026  ...---.....--.---------..........-----............--------tshdc...............
ENSPTRP00000015508  ...VAR.....CP.SGVKPDLSYmpiwkfpdekGTCQP............CPINCT--hscvdlddkgc.........
ENSPTRP00000057474  ...KCA.....CP.TNFYLGSDG..........RTCVSn...........CTASQFVC....................
ENSPTRP00000035956  ...LHC.....CN.TSDPP--SA..........QECCD............CQDTT---dec.................
ENSPTRP00000032807  ...VRA.....CG.ADSYEMEEDgv........RKCKK............CEGPC---rkvcng..............
ENSPTRP00000006428  ...LCT.....CR.PGFRLRADR..........VSCE-............--------a...................
ENSPTRP00000003607  ...TCR.....CP.DNT----LG..........VDC--............--------i...................
ENSPTRP00000010754  ...RCE.....CR.SGYEFADDR..........HTCILitppanp.....CEDGSHTC....................
ENSPTRP00000011321  ...ICR.....CD.PGYELEEDG..........VHCSDmde.........CSFSEFLC....................
ENSPTRP00000032747  ...---.....--.---------..........-----............--------lscralpgeqqplhaltrgq
ENSPTRP00000049039  ...LCT.....CP.AGYTLREDG..........AMCRDvde.........CADGQQDC....................
ENSPTRP00000046968  ...VPT.....CG.DGFYQ--DR..........HSCAV............CHESCAGCwgpt................
ENSPTRP00000012046  ...QCQ.....CN.EGYEVAPDG..........RTCV-............--------d...................
ENSPTRP00000005841  ...ECQ.....CH.PGYKLHWNK..........KDCV-............--------....................
ENSPTRP00000022026  ...VRA.....CP.SSKMEVEENgi........KMCKP............CTDIC---p...................
ENSPTRP00000029424  ...RCD.....CP.PGLAVGMDG..........RVCV-............--------d...................
ENSPTRP00000022056  ...---.....--.---------..........-----............--------elplqalvmgegtcekrrd.
ENSPTRP00000034969  ...LCQ.....CH.EGFALNPDK..........KTCTK............--------i...................
ENSPTRP00000029424  ...ECT.....CP.IGYALREDQ..........KMCKDlde.........CAEGLHDC....................
ENSPTRP00000034969  ...YCR.....CH.RGYTLDPNG..........KTCS-............--------r...................
ENSPTRP00000012046  ...ECS.....CQ.PGFALMPDQ..........RSCTD............I-------dec.................
ENSPTRP00000056675  ...ECH.....CR.EGFFLSDNQ..........HTCIQ............--------rpe.................
ENSPTRP00000049039  ...RCS.....CG.QGYSLMPDG..........RACADvde.........CEENPRVC....................
ENSPTRP00000060075  ...SCM.....CP.QGYQVV-RS..........RTCQ-............--------d...................
ENSPTRP00000029424  ...KCL.....CN.EGYELTPDG..........KNCI-............--------d...................
ENSPTRP00000012046  ...RCE.....CF.PGLAVGLDG..........RVCV-............--------d...................
ENSPTRP00000029424  ...SCE.....CQ.RGFSLDATG..........LNCEDvde.........CDG-----n...................
ENSPTRP00000002974  ...HCG.....CE.PGYQL--KG..........RKCMD............--------vnecrq..............
ENSPTRP00000031716  ...LDN.....CP.EGLEANNHT..........MECV-............--------s...................
ENSPTRP00000012046  ...TCE.....CQ.RGFSLDQTG..........SSCED............V-------dec.................
ENSPTRP00000012792  ...MQE.....CP.SGFIRNGSQs.........MYCIP............CEGPC---....................
ENSPTRP00000012046  ...HCV.....CN.AGFHVTRDG..........KNCED............M-------dec.................
ENSPTRP00000049039  ...TCK.....CG.PGSQLDPSG..........TICL-............--------d...................
ENSPTRP00000012046  ...ECK.....CP.VGYVLREDR..........RMCKDede.........CEEGKHDC....................
ENSPTRP00000036737  ...RCS.....CP.RGYRMQGPS..........LPC--............--------....................
ENSPTRP00000015508  ...TLV.....CP.LHNQEVTAEdgt.......QRCEK............CSKPCA--rvcy................
ENSPTRP00000018880  ...QCV.....CP.MGFQPNAAG..........SECED............V-------dec.................
ENSPTRP00000000970  ...---.....--.---------..........-----............--------cs..................
ENSPTRP00000056675  ...QCT.....CP.AGQGRL---..........-----............--------hwngkdct............
ENSPTRP00000049039  ...HCL.....CQ.DGFELTADG..........KNCV-............--------d...................
ENSPTRP00000021546  ...RCK.....CT.FGFQLDTDE..........RHCI-............--------a...................
ENSPTRP00000012046  ...RCE.....CP.PGHQLSPNI..........SACIDine.........CELSAHLC....................
ENSPTRP00000012046  ...RCE.....CD.MGFVPSADG..........KACED............I-------dec.................
ENSPTRP00000005841  ...ECC.....CK.EGFFLSDNQ..........HTCIH............RSEESLSC....................
ENSPTRP00000046479  ...HCV.....CQ.QGFSISADG..........RTCEDide.........CV------nn..................
ENSPTRP00000022516  ...---.....--.---------..........RECQGecelgpwggwspCTH-----ngktc...............
ENSPTRP00000029424  ...QCD.....CP.LGHELSPSR..........EDCVD............--------inec................
ENSPTRP00000006720  ...SCH.....CP.QGYQLL-AT..........RLCQDide.........CESGAHQC....................
ENSPTRP00000003607  ...RCE.....CV.EGYQFS-DE..........GTCVAvvdqrpiny...CETGLHNC....................
ENSPTRP00000017888  ...TCA.....CP.DGMLLARDM..........RSC--............--------....................
ENSPTRP00000029424  ...RCE.....CE.MGFTPASDS..........RSCQD............I-------dec.................
ENSPTRP00000034969  ...ACQ.....CP.EGHVLRSDG..........KTCA-............--------kl..................
ENSPTRP00000028112  ...WCS.....CR.EGFMKASDG..........KTCL-............--------ald.................
ENSPTRP00000024985  ...LCS.....CS.VGFRLSVDG..........RSCEDine.........C-------ss..................
ENSPTRP00000029424  ...ECN.....CP.PDFQLNPTG..........VGCVDn...........RVGNC---....................
ENSPTRP00000021397  ...ACA.....CP.HLMKLSSDK..........KTCY-............--------....................
ENSPTRP00000008515  ...TPN.....CA.PGLQC----..........-----............--------hppkddeaplralllgrgrc
ENSPTRP00000027670  vsgVCV.....CK.SRY------..........-----............--------pvcgsdg.............
ENSPTRP00000035066  ...---.....--.---------..........-----............--------wgtcsrnn............
ENSPTRP00000029424  ...ICH.....CQ.LGYSVKKGT..........TGCTDvde.........CEIGAHNC....................
ENSPTRP00000025197  ...RCI.....CA.EGYKQ--ME..........GICV-............--------k...................
ENSPTRP00000022729  ...FCK.....CP.EDY----EG..........KNCSH............LKDH----c...................
ENSPTRP00000017670  ...IPE.....CP.SGYTMNSSN..........LLCTP............CLGPC---....................
ENSPTRP00000049039  ...KCQ.....CP.PGRELTAEG..........TACE-............--------d...................
ENSPTRP00000024985  ...QCS.....CPsSGYRLAPNG..........RNCQDide.........CVTGIHNC....................
ENSPTRP00000049039  ...RCG.....CP.QGFTQHSQW..........AQCVDene.........CALSPPTC....................
ENSPTRP00000056512  ...VCV.....CP.DGFEE--TE..........DACV-............--------p...................
ENSPTRP00000022834  ...HCG.....CL.PGWVLAPNG..........VSCT-............--------....................
ENSPTRP00000026116  ...ECE.....CP.EGYRYNLKS..........KSCE-............--------d...................
ENSPTRP00000023256  ...RCH.....CR.EGHDLQPDG..........RSCQV............--------rdlcn...............
ENSPTRP00000029424  ...RCE.....CN.EGFQSSSSG..........TECL-............--------d...................
ENSPTRP00000005041  ...---.....--.---------..........-----............--------eqlecrldtgddlsrgevpe
ENSPTRP00000011096  ...HCE.....CD.QGYIMV-RK..........GHCQ-............--------d...................
ENSPTRP00000012755  ...--S.....CP.SHASLDPVE..........QTC--............--------s...................
ENSPTRP00000006692  ...VCV.....CD.EGFTPTQDQ..........HGCE-............--------ev..................
ENSPTRP00000049039  ...RCI.....CN.GGYELDRGG..........GNCTD............--------inec................
ENSPTRP00000012046  ...LCG.....CP.PGYFRI-GQ..........GHCV-............--------....................
ENSPTRP00000011096  ...RCS.....CE.QGYEVTSDE..........KGCQD............--------v...................
ENSPTRP00000046310  ...C--.....--.---------..........-----............--------dysvdrpryetgvcayl...
ENSPTRP00000046227  ...FCD.....CA.PGF----LG..........DHCEL............NTDEC---....................
ENSPTRP00000049082  ...SCK.....CQ.PGF----SG..........KRCE-............--------t...................
ENSPTRP00000059463  ...YCH.....CP.FGV----FG..........KHCE-............--------l...................
ENSPTRP00000032142  ...VCE.....CA.RGY----GG..........PNCQ-............--------f...................
ENSPTRP00000046479  ...RCEy....CD.SGYRMT-QR..........GRCE-............--------d...................
ENSPTRP00000035113  ...CDR.....--.---------..........-----............--------sadpsnqtgicmavegdncv
ENSPTRP00000036737  ...QCVdtp..CP.ATYRQGPSP..........GTCFRr...........CSQDC---g...................
ENSPTRP00000025264  ...RCS.....CA.SGFLLAADG..........KRCED............--------vnec................
ENSPTRP00000006692  ...RCT.....CA.QGYAPAPDG..........RSCLD............V-------dec.................
ENSPTRP00000052123  ...---.....--.---------..........-----............--------pgagpggrgalcllaeddss
ENSPTRP00000002974  ...KCI.....CP.PGQHLLGDG..........KSC--............--------....................
ENSPTRP00000029424  ...NCE.....CS.PGSKLSSTG..........LICI-............--------d...................
ENSPTRP00000011096  ...RCL.....CD.QGFEISPSG..........WDCV-............--------d...................
ENSPTRP00000036924  ...HCE.....CR.AGH----TG..........RRCES............VINGC---k...................
ENSPTRP00000029424  ...LCG.....CP.PGYYRV-GQ..........GHCV-............--------....................
ENSPTRP00000006173  ...TCA.....CP.TGFRKI-SS..........HAC--............--------a...................
ENSPTRP00000046526  ...I--.....--.-------TN..........HTC--............--------snadet..............
ENSPTRP00000021546  ...SCA.....CA.TGFKLNPDN..........RSCSP............--------y...................
ENSPTRP00000011096  ...SCKd....CD.GGYRPSPLG..........DSCED............--------v...................
ENSPTRP00000018116  ...RCL.....CH.AGF----SG..........PRCQT............VLSPC---....................
ENSPTRP00000028112  ...YCT.....CP.VGFVLLPDG..........KRCHQlvs.........CPSNVSEC....................
ENSPTRP00000025264  ...HCDkalt.CE.PGYAL--KD..........GECEDvde.........CAMGTHTC....................
ENSPTRP00000057474  ...SCA.....CP.HLMKLHKDN..........TTC--............--------....................
ENSPTRP00000035842  ...---.....--.---------..........-----............--------aagaapegtglcvcaqrgtv
ENSPTRP00000041706  ...VCH.....CP.PGT----HG..........PFC--............--------....................
ENSPTRP00000001581  ...---.....--.---------..........-----............--------segrpceyn...........
ENSPTRP00000048671  ...ECV.....CL.AEY----KG..........THCEL............YKDPC---a...................
ENSPTRP00000036924  ...RCE.....CP.SGW----TG..........LYCDV............P-------svsc................
ENSPTRP00000002974  ...QCIdtp..CP.PNYQRDPVS..........GFCLKn...........CPPNDLEC....................
ENSPTRP00000036924  ...QCE.....CP.TGF----TG..........HLCQY............DVDEC---....................
ENSPTRP00000018880  ...RCS.....CA.PGY------..........-----............--------ra..................
ENSPTRP00000002493  ...LAQ.....CP.SGFTRNSSS..........IFCHK............CEGLC---pkec................
ENSPTRP00000018116  ...LCR.....CP.SGT----TG..........VNCEV............NIDDC---....................
ENSPTRP00000018880  ...RCVrd...CD.PGYHAG-PE..........GTC--............--------dd..................
ENSPTRP00000018116  ...SCT.....CP.SGF----SG..........STCQL............DVDEC---....................
ENSPTRP00000028897  ...---.....--.---------..........-----............--------gedpfgeefgickd......
ENSPTRP00000046479  ...RCT.....CG.QGYQLSAAK..........DQCED............I-------dec.................
ENSPTRP00000018085  ...QCR.....CR.PGWQ-----..........-----............--------p...................
ENSPTRP00000020306  ...---.....--.---------..........-----............--------glrcvirpplngdslteyea
ENSPTRP00000020087  ...HCD.....CY.PGYTLNEDK..........KTCS-............--------a...................
ENSPTRP00000031762  ...---.....--.---------..........-----............--------dfgspanrkigvctakdgap
ENSPTRP00000012046  ...ICE.....CS.SESTLDPTK..........TICI-............--------eti.................
ENSPTRP00000035228  ...C--.....--.---------..........-----............--------dysgdrpryaigvcaqvv..
ENSPTRP00000006692  ...KCN.....CY.PGYRLKASRp.........PV---............--------ced.................
ENSPTRP00000036924  ...TCT.....CP.AGF----SG..........IHCEN............NTPDC---....................
ENSPTRP00000049082  ...GVP.....CP.EGKFSRSGL..........MPCHP............CPR-----dyy.................
ENSPTRP00000018880  ...LCV.....CP.AGYQAAPHG..........ASCQDd...........CTQ-----spg.................
ENSPTRP00000006692  ...SCE.....CR.PPWVPGPSG..........RDCQ-............--------l...................
ENSPTRP00000018116  ...RCV.....CE.PGW----SG..........PRCS-............--------q...................
ENSPTRP00000044880  ...VCN.....CP.YGF----VG..........SRC--............--------e...................
ENSPTRP00000025264  ...RCLrfe..CP.PNYVQV-SK..........TKCERtt..........CH------d...................
ENSPTRP00000028078  ...KCK.....CK.EGYQG--DG..........LTCV-............--------y...................
ENSPTRP00000011096  ...FCL.....CA.PGFVSAEGG..........TSCQD............--------vd..................
ENSPTRP00000036924  ...KCD.....CD.PGW----SG..........TNCDI............NNNEC---....................
ENSPTRP00000028078  ...RCQ.....CPsPGLQLAPDG..........RTCVDvde.........CATGRASC....................
ENSPTRP00000032142  ...SCR.....CP.VGY----SG..........FNCEK............KIDYC---....................
ENSPTRP00000005988  ...HCE.....CR.SGFH-----..........-----............--------dd..................
ENSPTRP00000027395  ...RCR.....--.---------..........-----............--------gshavcgtdg..........
ENSPTRP00000029424  ...FCV.....CP.RGYVTSTDG..........SRCID............--------qrtgmcf.............
ENSPTRP00000049039  ...MCL.....CH.RGFQASADQ..........TLCM-............--------....................
ENSPTRP00000059022  ...HCK.....CL.PGF----EG..........PRCQT............EVDEC---l...................
ENSPTRP00000056675  ...KVQ.....CS.PGHYYNTSI..........HRCIR............CA------mgsyqpdfrqnfcsrcpg..
ENSPTRP00000018116  ...TCT.....CP.PGY----GG..........FHCEQ............DLPDC---....................
ENSPTRP00000006720  ...QCT.....CP.DGYRK--IG..........PECVD............--------i...................
ENSPTRP00000044502  ...KCK.....CK.QGYKG--NG..........LRCS-............--------aipe................
ENSPTRP00000022833  ...ECH.....CY.PNYDL--VD..........GECVE............PVDPC---....................
ENSPTRP00000049157  ...--S.....CP.PSSTLDQQQ..........GSCV-............--------g...................
ENSPTRP00000029424  ...YCK.....CH.AGFQRTPTK..........QACIDide.........CIQNGVLC....................
ENSPTRP00000021397  ...TCV.....CP.EGKYL--IN..........GTCND............--------dsllddsc............
ENSPTRP00000059022  ...YCQ.....CL.PGH----TG..........QWCEV............EIDPC---h...................
ENSPTRP00000034342  ...ECQ.....CR.SGFVLHDNK..........HDCKE............--------agcd................
ENSPTRP00000024260  ...ETK.....CS.NGTYGEDCA..........FVCAD............CGS-----g...................
ENSPTRP00000022834  ...RCE.....CW.VGYEPGGPGe.........GACQ-............--------d...................
ENSPTRP00000061259  ...ECY.....CS.EGHELEADG..........ISCSP............--------....................
ENSPTRP00000018880  ...RCI.....CR.PGFAPTHQP..........HHCA-............--------p...................
ENSPTRP00000059022  ...NCL.....CP.PGY----TG..........SRCEA............DHNEC---l...................
ENSPTRP00000049039  ...HCR.....CY.PGFQAMPTR..........QACVD............V-------dec.................
ENSPTRP00000001803  ...SCE.....CP.LGF----GG..........KSCA-............--------q...................
ENSPTRP00000025264  ...TCQrnpliCA.RGYHASDDG..........AKCVDvne.........CETGVHRC....................
ENSPTRP00000017658  ...FCT.....CH.PGF------..........-----............--------ap..................
ENSPTRP00000029913  ...TCR.....CP.PGF----AG..........PRCE-............--------k...................
ENSPTRP00000011096  ...RCH.....CS.PGYVAEAGP..........PHC--............--------t...................
ENSPTRP00000049062  ...ECY.....CM.DGY------..........-----............--------lp..................
ENSPTRP00000046479  ...KCL.....CL.PGYVPSDKP..........NYCTP............--------....................
ENSPTRP00000049039  ...---.....--.---------..........-----............--------glgfspgpqd..........
ENSPTRP00000049510  ...TCS.....CP.NGYNVEENG..........RDCQ-............--------s...................
ENSPTRP00000052704  ...---.....--.---------..........-----............--------ttipsapqavissvnetslm
ENSPTRP00000005841  ...CIR.....CP.VGTYQPEFGk.........NNCVS............CPGNT---ttdfdgstnitqcknrrc..
ENSPTRP00000005841  ...HCS.....CP.VGFTLQLDG..........KTCK-............--------....................
ENSPTRP00000034549  ...---.....--.---------..........-----............--------plrpgfpstcgcptlggavc
ENSPTRP00000000195  ...K-D.....CC.FGTFNDQKR..........GICRP............--------wtnc................
ENSPTRP00000061149  ...CEE.....CK.EGFYQSPDAt.........KECLR............CP------c...................
ENSPTRP00000059022  ...SCL.....CA.MGF----QG..........PRCE-............--------gkirpsc.............
ENSPTRP00000059022  ...FCH.....CP.PGF----QG..........SLCQD............HVNPC---....................
ENSPTRP00000034924  ...SCA.....CS.EPNIL--TG..........-----............--------glc.................
ENSPTRP00000046227  ...SCL.....CP.SGY----TG..........SLCE-............--------....................
ENSPTRP00000004949  ...RCRtnkk.CS.RGYEPNEDG..........TACV-............--------....................
ENSPTRP00000003938  ...SCI.....CD.AGWMSSPNS..........PACTL............DRDEC---....................
ENSPTRP00000058611  ...CIP.....CG.PGSKNNQDH..........SVCYS............--------dcf.................
ENSPTRP00000015610  ...CSP.....CP.QG-------..........-----............--------r...................
ENSPTRP00000026114  ...---.....--.---------..........-----............--------trppssprnvisninetsvi
ENSPTRP00000056656  ...ICT.....CR.TGYYRAD--..........-----............--------fdppevactsvpsgprnvis
ENSPTRP00000033933  ...---.....--.---------..........-----............--------gvgvh...............
ENSPTRP00000033400  ...VCQ.....CR.VGYFRAR--..........-----............--------tdprgapcttppsaprsvvs
ENSPTRP00000000400  ...SCE.....CE.EGFFRAPQD..........-----............--------pasmpctrppsaphyltavg
ENSPTRP00000033908  ...VCP.....CL.EGFYRAS--..........-----............--------sdppeapctgppsapqelwf
ENSPTRP00000031479  ...RCE.....CE.DGYYRA---..........-----............--------psd.................
ENSPTRP00000049082  ...GVR.....CH.PGFDLVGSSi.........ILCLP............--------nglwsgsesyc.........
ENSPTRP00000036926  ...WCQ.....CW.EGHSLSADG..........TLC--............--------....................
ENSPTRP00000028833  ...LCA.....CP.FKF----EG..........IAC--............--------e...................
ENSPTRP00000008485  ...SAP.....CN.GNLVV--ST..........GLCKP............CGQLNTTC....................
ENSPTRP00000001800  ...---.....--.---------..........-----............--------tf..................
ENSPTRP00000002992  ...---.....--.---------..........-----............--------p...................
ENSPTRP00000058611  ...CHP.....CP.PGTFSD-GT..........KECRP............CPA-----g...................
ENSPTRP00000000553  ...ACH.....CD.LSYYRA---..........-----............--------aldppssactrppsapvnli
ENSPTRP00000018082  ...YCQ.....CV.PGYRLHSGN..........-----............--------eqfsnsnentcqd.......
ENSPTRP00000025264  ...HCA.....CF.PGFSLQDDG..........RTCRP............--------....................
ENSPTRP00000037768  ...---.....--.---------..........-----............--------tptsevqc............


                                                                        
                                                                        
d2dtge6               ..................................................
ENSPTRP00000046526  ..................................................
ENSPTRP00000035956  ..................................................
ENSPTRP00000035956  ..................................................
ENSPTRP00000046968  ..................................................
ENSPTRP00000046968  ..................................................
ENSPTRP00000035956  ..................................................
ENSPTRP00000035956  ..................................................
ENSPTRP00000046968  ..................................................
ENSPTRP00000035956  ..................................................
ENSPTRP00000035956  ..................................................
ENSPTRP00000032807  ..................................................
ENSPTRP00000022058  lneksy............................................
ENSPTRP00000021397  ..................................................
ENSPTRP00000046968  ..................................................
ENSPTRP00000015555  mela..............................................
ENSPTRP00000032748  asa...............................................
ENSPTRP00000022026  ..................................................
ENSPTRP00000015508  ..................................................
ENSPTRP00000057474  ..................................................
ENSPTRP00000035956  ..................................................
ENSPTRP00000032807  ..................................................
ENSPTRP00000006428  ..................................................
ENSPTRP00000003607  ..................................................
ENSPTRP00000010754  ..................................................
ENSPTRP00000011321  ..................................................
ENSPTRP00000032747  gacvqesd..........................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000046968  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000005841  ..................................................
ENSPTRP00000022026  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000022056  ..................................................
ENSPTRP00000034969  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000034969  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000056675  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000060075  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000002974  ..................................................
ENSPTRP00000031716  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000012792  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000036737  ..................................................
ENSPTRP00000015508  ..................................................
ENSPTRP00000018880  ..................................................
ENSPTRP00000000970  ..................................................
ENSPTRP00000056675  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000021546  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000005841  ..................................................
ENSPTRP00000046479  ..................................................
ENSPTRP00000022516  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000006720  ..................................................
ENSPTRP00000003607  ..................................................
ENSPTRP00000017888  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000034969  ..................................................
ENSPTRP00000028112  ..................................................
ENSPTRP00000024985  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000021397  ..................................................
ENSPTRP00000008515  lpa...............................................
ENSPTRP00000027670  ..................................................
ENSPTRP00000035066  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000025197  ..................................................
ENSPTRP00000022729  ..................................................
ENSPTRP00000017670  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000024985  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000056512  ..................................................
ENSPTRP00000022834  ..................................................
ENSPTRP00000026116  ..................................................
ENSPTRP00000023256  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000005041  plcacrsqsplcgsdg..................................
ENSPTRP00000011096  ..................................................
ENSPTRP00000012755  ..................................................
ENSPTRP00000006692  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000011096  ..................................................
ENSPTRP00000046310  ..................................................
ENSPTRP00000046227  ..................................................
ENSPTRP00000049082  ..................................................
ENSPTRP00000059463  ..................................................
ENSPTRP00000032142  ..................................................
ENSPTRP00000046479  ..................................................
ENSPTRP00000035113  fdg...............................................
ENSPTRP00000036737  ..................................................
ENSPTRP00000025264  ..................................................
ENSPTRP00000006692  ..................................................
ENSPTRP00000052123  cevng.............................................
ENSPTRP00000002974  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000011096  ..................................................
ENSPTRP00000036924  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000006173  ..................................................
ENSPTRP00000046526  ..................................................
ENSPTRP00000021546  ..................................................
ENSPTRP00000011096  ..................................................
ENSPTRP00000018116  ..................................................
ENSPTRP00000028112  ..................................................
ENSPTRP00000025264  ..................................................
ENSPTRP00000057474  ..................................................
ENSPTRP00000035842  cgsdg.............................................
ENSPTRP00000041706  ..................................................
ENSPTRP00000001581  ..................................................
ENSPTRP00000048671  ..................................................
ENSPTRP00000036924  ..................................................
ENSPTRP00000002974  ..................................................
ENSPTRP00000036924  ..................................................
ENSPTRP00000018880  ..................................................
ENSPTRP00000002493  ..................................................
ENSPTRP00000018116  ..................................................
ENSPTRP00000018880  ..................................................
ENSPTRP00000018116  ..................................................
ENSPTRP00000028897  ..................................................
ENSPTRP00000046479  ..................................................
ENSPTRP00000018085  ..................................................
ENSPTRP00000020306  gvced.............................................
ENSPTRP00000020087  ..................................................
ENSPTRP00000031762  cifg..............................................
ENSPTRP00000012046  ..................................................
ENSPTRP00000035228  ..................................................
ENSPTRP00000006692  ..................................................
ENSPTRP00000036924  ..................................................
ENSPTRP00000049082  ..................................................
ENSPTRP00000018880  ..................................................
ENSPTRP00000006692  ..................................................
ENSPTRP00000018116  ..................................................
ENSPTRP00000044880  ..................................................
ENSPTRP00000025264  ..................................................
ENSPTRP00000028078  ..................................................
ENSPTRP00000011096  ..................................................
ENSPTRP00000036924  ..................................................
ENSPTRP00000028078  ..................................................
ENSPTRP00000032142  ..................................................
ENSPTRP00000005988  ..................................................
ENSPTRP00000027395  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000059022  ..................................................
ENSPTRP00000056675  ..................................................
ENSPTRP00000018116  ..................................................
ENSPTRP00000006720  ..................................................
ENSPTRP00000044502  ..................................................
ENSPTRP00000022833  ..................................................
ENSPTRP00000049157  ..................................................
ENSPTRP00000029424  ..................................................
ENSPTRP00000021397  ..................................................
ENSPTRP00000059022  ..................................................
ENSPTRP00000034342  ..................................................
ENSPTRP00000024260  ..................................................
ENSPTRP00000022834  ..................................................
ENSPTRP00000061259  ..................................................
ENSPTRP00000018880  ..................................................
ENSPTRP00000059022  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000001803  ..................................................
ENSPTRP00000025264  ..................................................
ENSPTRP00000017658  ..................................................
ENSPTRP00000029913  ..................................................
ENSPTRP00000011096  ..................................................
ENSPTRP00000049062  ..................................................
ENSPTRP00000046479  ..................................................
ENSPTRP00000049039  ..................................................
ENSPTRP00000049510  ..................................................
ENSPTRP00000052704  lewtpprdsggredlvyniickscgsgrgactrcgdnvqy..........
ENSPTRP00000005841  ..................................................
ENSPTRP00000005841  ..................................................
ENSPTRP00000034549  gsd...............................................
ENSPTRP00000000195  ..................................................
ENSPTRP00000061149  ..................................................
ENSPTRP00000059022  ..................................................
ENSPTRP00000059022  ..................................................
ENSPTRP00000034924  ..................................................
ENSPTRP00000046227  ..................................................
ENSPTRP00000004949  ..................................................
ENSPTRP00000003938  ..................................................
ENSPTRP00000058611  ..................................................
ENSPTRP00000015610  ..................................................
ENSPTRP00000026114  ldwswpldtggrkdvtfniickkcgwnikqcepcspn.............
ENSPTRP00000056656  ivnetsiilewhppretggrddvtyniickkcradrrscsrcddnvefv.
ENSPTRP00000033933  ..................................................
ENSPTRP00000033400  rlngsslhlewsaplesggredltyalrcrecrpggscapcgg.......
ENSPTRP00000000400  mgakvelrwtppqdsggredivysvtceqcwpesgecgpce.........
ENSPTRP00000033908  evqgsalmlhwrlprelggrgdllfnvvckecegrqepasggggtcrrc.
ENSPTRP00000031479  ..................................................
ENSPTRP00000049082  ..................................................
ENSPTRP00000036926  ..................................................
ENSPTRP00000028833  ..................................................
ENSPTRP00000008485  ..................................................
ENSPTRP00000001800  ..................................................
ENSPTRP00000002992  ..................................................
ENSPTRP00000058611  ..................................................
ENSPTRP00000000553  ssvngtsvtlewappldpggrsditynavcrrcpwalsrceacgsgtrfv
ENSPTRP00000018082  ..................................................
ENSPTRP00000025264  ..................................................
ENSPTRP00000037768  ..................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053854 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22<