SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Growth factor receptor domain alignments in Taeniopygia guttata 76_3.2.4

These alignments are sequences aligned to the 0048103 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  sg............................................................................
ENSTGUP00000001808  h.............................................................................
ENSTGUP00000000773  gr............................................................................
ENSTGUP00000001808  l.............................................................................
ENSTGUP00000000773  e.............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  sdgsdekschineclskkvs..........................................................
ENSTGUP00000001863  v.............................................................................
ENSTGUP00000011850  v.............................................................................
ENSTGUP00000007382  vl............................................................................
ENSTGUP00000001863  s.............................................................................
ENSTGUP00000012383  declvnngg.....................................................................
ENSTGUP00000006963  ecvqng........................................................................
ENSTGUP00000010696  vqetcannr.....................................................................
ENSTGUP00000004353  itctsndng.....................................................................
ENSTGUP00000010903  cnvnngg.......................................................................
ENSTGUP00000001809  idecrlnngg....................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  dmcvgrehg.....................................................................
ENSTGUP00000000773  pes...........................................................................
ENSTGUP00000012926  npt...........................................................................
ENSTGUP00000000998  fykdvneckvfsg.................................................................
ENSTGUP00000006963  dvneclespgi...................................................................
ENSTGUP00000012362  mcsive........................................................................
ENSTGUP00000008559  idecqsnngg....................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  gdadidecseipa.................................................................
ENSTGUP00000000998  dvne..........................................................................
ENSTGUP00000001809  de............................................................................
ENSTGUP00000000998  ecimngv.......................................................................
ENSTGUP00000003792  qcpagfaldssgpycs..............................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  tlnqtidi......................................................................
ENSTGUP00000005188  mcmgrehg......................................................................
ENSTGUP00000006963  tidnckhh......................................................................
ENSTGUP00000008033  ecypgewacpgsgh................................................................
ENSTGUP00000006963  fykdineckvfpg.................................................................
ENSTGUP00000012383  decaea........................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  cgrgyhlnedgtrcvdvdecsssn......................................................
ENSTGUP00000001588  qg............................................................................
ENSTGUP00000006963  cssgigitvdgrdinecaldpd........................................................
ENSTGUP00000009278  s.............................................................................
ENSTGUP00000000449  ncpptvingif...................................................................
ENSTGUP00000006963  cndldecsqspr..................................................................
ENSTGUP00000007100  qv............................................................................
ENSTGUP00000013892  nqcsplpchkdgy.................................................................
ENSTGUP00000006963  kgttgctdvneceigah.............................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ecalglddchpdai................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  flcgnkkcisanlrcnffddcgdgsdeescshehksy.........................................
ENSTGUP00000013537  n.............................................................................
ENSTGUP00000000998  csdvd.........................................................................
ENSTGUP00000013307  cipgwtgv......................................................................
ENSTGUP00000007218  crpgfsga......................................................................
ENSTGUP00000006963  decmimngg.....................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  prgtaygvytar..................................................................
ENSTGUP00000003999  thsv..........................................................................
ENSTGUP00000011678  cpercdrsrcpalpag..............................................................
ENSTGUP00000008956  ivgnkppk......................................................................
ENSTGUP00000012362  ycaldnhg......................................................................
ENSTGUP00000015313  s.............................................................................
ENSTGUP00000009278  inectvn.......................................................................
ENSTGUP00000010351  gctecqpeecpmprgcl.............................................................
ENSTGUP00000015843  ectsen........................................................................
ENSTGUP00000017519  ctedvdecamansnp...............................................................
ENSTGUP00000010098  cplgysgf......................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  rnlre.........................................................................
ENSTGUP00000017519  qcapgweger....................................................................
ENSTGUP00000007738  cpvncgrhngg...................................................................
ENSTGUP00000007419  cemcpaqphp....................................................................
ENSTGUP00000000998  decstkq.......................................................................
ENSTGUP00000017519  k.............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  wpcrcplvpa....................................................................
ENSTGUP00000011389  dscrdenggcehvcehtaa...........................................................
ENSTGUP00000006963  cdgnh.........................................................................
ENSTGUP00000002877  vnscetsngg....................................................................
ENSTGUP00000006342  tcpsgf........................................................................
ENSTGUP00000010582  cparcdv.......................................................................
ENSTGUP00000005344  rpcycpwvpprcprg...............................................................
ENSTGUP00000017519  icnpgymga.....................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  nscsinngg.....................................................................
ENSTGUP00000009572  cidggkvcdshrdcrdwsdeplkdcgv...................................................
ENSTGUP00000006342  t.............................................................................
ENSTGUP00000006342  ecvagyhg......................................................................
ENSTGUP00000012510  cysgytlavsvgkqscedrdeceqps....................................................
ENSTGUP00000007392  gaacgiyte.....................................................................
ENSTGUP00000012362  fcalgqhdcehecvnmee............................................................
ENSTGUP00000001337  lcsffspavc....................................................................
ENSTGUP00000016176  cslnngg.......................................................................
ENSTGUP00000012943  wpcecprspprcavgv..............................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  qhrc..........................................................................
ENSTGUP00000004439  kcpagyngps....................................................................
ENSTGUP00000006342  ecptgfngh.....................................................................
ENSTGUP00000015640  necglkpr......................................................................
ENSTGUP00000001337  gr............................................................................
ENSTGUP00000003906  mls...........................................................................
ENSTGUP00000006280  citgwsgh......................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  iclkgttgpncein................................................................
ENSTGUP00000012183  gg............................................................................
ENSTGUP00000010478  s.............................................................................
ENSTGUP00000000998  cemcpaqph.....................................................................
ENSTGUP00000002105  wclqspcqng....................................................................
ENSTGUP00000012510  v.............................................................................
ENSTGUP00000003906  ecdns.........................................................................
ENSTGUP00000010696  nhcqrg........................................................................
ENSTGUP00000003792  nvcrpdql......................................................................
ENSTGUP00000014137  cepgytgen.....................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ecgsgqhrcden..................................................................
ENSTGUP00000010098  cqegwgg.......................................................................
ENSTGUP00000001570  cllgyegerce...................................................................
ENSTGUP00000006280  cpagwega......................................................................
ENSTGUP00000017519  aycdvpnvscqvaa................................................................
ENSTGUP00000005606  nineclln......................................................................
ENSTGUP00000000755  pcqcp.........................................................................
ENSTGUP00000013140  ecqssl........................................................................
ENSTGUP00000003982  ccwg..........................................................................
ENSTGUP00000007100  cdann.........................................................................
ENSTGUP00000011980  cqcgtgpgp.....................................................................
ENSTGUP00000011110  cdegwgg.......................................................................
ENSTGUP00000001480  cs............................................................................
ENSTGUP00000012362  dick..........................................................................
ENSTGUP00000006169  ctehde........................................................................
ENSTGUP00000004439  cepgytgen.....................................................................
ENSTGUP00000017519  qcrlgytghrcespyvpcsp..........................................................
ENSTGUP00000002520  yavdcpdpcd....................................................................
ENSTGUP00000015133  ghg...........................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  nqcsplpchkdgy.................................................................
ENSTGUP00000003906  kckdng........................................................................
ENSTGUP00000002463  ct............................................................................
ENSTGUP00000004353  talecyvnaecvlled..............................................................
ENSTGUP00000003982  crcpspglqlgpdgr...............................................................
ENSTGUP00000003906  tcqrre........................................................................
ENSTGUP00000012383  ateg..........................................................................
ENSTGUP00000012383  gmncmnkdhg....................................................................
ENSTGUP00000012510  cehpelcsrnccrplnsfstrrtfagaslcavpflladld......................................
ENSTGUP00000008485  n.............................................................................
ENSTGUP00000004172  la............................................................................
ENSTGUP00000006467  pspcdsep......................................................................
ENSTGUP00000016677  nqcsplpchkdgy.................................................................
ENSTGUP00000001309  tchiha........................................................................
ENSTGUP00000012926  vclsspgka.....................................................................
ENSTGUP00000004782  g.............................................................................
ENSTGUP00000004439  draegy........................................................................
ENSTGUP00000001809  scgpgqqr......................................................................
ENSTGUP00000009278  ee............................................................................
ENSTGUP00000017513  rc............................................................................
ENSTGUP00000004936  cnqhgd........................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  cdvgeflchdgitcvswhwlcdgepdcpddsdesldtcpeesd...................................
ENSTGUP00000002463  va............................................................................
ENSTGUP00000012223  ytcednvn......................................................................
ENSTGUP00000010755  pvga..........................................................................
ENSTGUP00000008559  mscmnkdhg.....................................................................
ENSTGUP00000012383  w.............................................................................
ENSTGUP00000013638  vgr...........................................................................
ENSTGUP00000013585  tgsssvrlhcngegewmvaig.........................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  i.............................................................................
ENSTGUP00000007088  rc............................................................................
ENSTGUP00000012227  srla..........................................................................
ENSTGUP00000007981  n.............................................................................
ENSTGUP00000011389  n.............................................................................
ENSTGUP00000008033  dvnsnpcldnnggcshlcfalpdiqtpkcgcafgtlggdgkrcsistddylifalenalrsihldpenhsppfrtvsv
ENSTGUP00000001337  c.............................................................................
ENSTGUP00000013896  l.............................................................................
ENSTGUP00000017687  vpgt..........................................................................
ENSTGUP00000003497  ywlnriqsfly...................................................................
ENSTGUP00000012223  cepdpsgtp.....................................................................
ENSTGUP00000012933  g.............................................................................
ENSTGUP00000007100  y.............................................................................
ENSTGUP00000011594  pgkyg.........................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  lrtavaldfdsinnriyftqsypsgtgrisyvsiysgissptvvasdlgtpdgiafdwinnriyysdylnqtissmaa
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  dgsnrtviarvprpraivldpcrgymywtdwssnakieratlggnfrtpivstnlvwpngltldyeeqqlywadanlq
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..........................................................................----
ENSTGUP00000000773  ..........................................................................-TCK
ENSTGUP00000009269  ..........................................................................----
ENSTGUP00000000773  ..........................................................................----
ENSTGUP00000001808  ..........................................................................NICK
ENSTGUP00000000773  ..........................................................................-ECE
ENSTGUP00000001808  ..........................................................................--CT
ENSTGUP00000000773  ..........................................................................-TCK
ENSTGUP00000001808  ..........................................................................--CR
ENSTGUP00000000773  ..........................................................................-QCR
ENSTGUP00000001808  ..........................................................................-YCV
ENSTGUP00000012223  ..........................................................................----
ENSTGUP00000001863  ..........................................................................----
ENSTGUP00000011850  ..........................................................................----
ENSTGUP00000007382  ..........................................................................----
ENSTGUP00000001863  ..........................................................................--CP
ENSTGUP00000012383  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000010696  ..........................................................................---H
ENSTGUP00000004353  ..........................................................................----
ENSTGUP00000010903  ..........................................................................----
ENSTGUP00000001809  ..........................................................................----
ENSTGUP00000011850  ..........................................................................--CG
ENSTGUP00000014972  ..........................................................................----
ENSTGUP00000000773  ..........................................................................----
ENSTGUP00000012926  ..........................................................................----
ENSTGUP00000000998  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000012362  ..........................................................................---H
ENSTGUP00000008559  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000000998  ..........................................................................----
ENSTGUP00000000998  ..........................................................................----
ENSTGUP00000001809  ..........................................................................--CV
ENSTGUP00000000998  ..........................................................................----
ENSTGUP00000003792  ..........................................................................----
ENSTGUP00000012128  ..........................................................................----
ENSTGUP00000000998  ..........................................................................----
ENSTGUP00000005188  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000008033  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000012383  ..........................................................................----
ENSTGUP00000001808  ..........................................................................----
ENSTGUP00000012183  ..........................................................................----
ENSTGUP00000001588  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000009278  ..........................................................................----
ENSTGUP00000000449  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000007100  ..........................................................................----
ENSTGUP00000013892  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000013142  ..........................................................................----
ENSTGUP00000008559  ..........................................................................----
ENSTGUP00000012223  ..........................................................................----
ENSTGUP00000016176  ..........................................................................----
ENSTGUP00000013537  ..........................................................................-VCA
ENSTGUP00000000998  ..........................................................................----
ENSTGUP00000013307  ..........................................................................----
ENSTGUP00000007218  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000013140  ..........................................................................----
ENSTGUP00000002415  ..........................................................................----
ENSTGUP00000003999  ..........................................................................--CT
ENSTGUP00000011678  ..........................................................................----
ENSTGUP00000008956  ..........................................................................----
ENSTGUP00000012362  ..........................................................................----
ENSTGUP00000015313  ..........................................................................----
ENSTGUP00000009278  ..........................................................................----
ENSTGUP00000010351  ..........................................................................----
ENSTGUP00000015843  ..........................................................................----
ENSTGUP00000017519  ..........................................................................----
ENSTGUP00000010098  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000003792  ..........................................................................----
ENSTGUP00000017519  ..........................................................................----
ENSTGUP00000007738  ..........................................................................----
ENSTGUP00000007419  ..........................................................................----
ENSTGUP00000000998  ..........................................................................---H
ENSTGUP00000017519  ..........................................................................----
ENSTGUP00000006342  ..........................................................................----
ENSTGUP00000012356  ..........................................................................----
ENSTGUP00000011389  ..........................................................................----
ENSTGUP00000006963  ..........................................................................----
ENSTGUP00000002877  ..........................................................................----
ENSTGUP00000006342  ..........................................................................----
ENSTGUP00000010582  ..........................................................................----
ENSTGUP00000005344  ..........................................................................----
ENSTGUP00000017519  ..........................................................................----
ENSTGUP00000000773  ..........................................................................----
ENSTGUP00000011389  ..........................................................................----
ENSTGUP00000009572  ..........................................................................----
ENSTGUP00000006342  ..........................................................................----
ENSTGUP00000006342  ..........................................................................----
ENSTGUP00000012510  ..........................................................................----
ENSTGUP00000007392  ..........................................................................----
ENSTGUP00000012362  ..........................................................................----
ENSTGUP00000001337  ..........................................................................----
ENSTGUP00000016176  ..........................................................................----
ENSTGUP00000012943  ..........................................................................----
ENSTGUP00000012578  ..........................................................................----
ENSTGUP00000002877  ..........................................................................----
ENSTGUP00000004439  ..........................................................................----
ENSTGUP00000006342  ..........................................................................----
ENSTGUP00000015640  ..........................................................................----
ENSTGUP00000001337  ..........................................................................----
ENSTGUP00000003906  ..........................................................................----
ENSTGUP00000006280  ..........................................................................----
ENSTGUP00000013140  ..........................................................................----
ENSTGUP00000009269  ..........................................................................----
ENSTGUP00000006342  ..........................................................................----
ENSTGUP00000012183  ..........................................................................----
ENSTGUP00000010478  ..........................................................................----
ENSTGUP00000000998  ..........................................................................----
ENSTGUP00000002105  ..........................................................................----
ENSTGUP00000012510  ..........................................................................----
ENSTGUP00000003906  ..........................................................................----
ENSTGUP00000010696  ..........................................................................----
ENSTGUP00000003792  ..........................................................................----
ENSTGUP00000014137  ..........................................................................----
ENSTGUP00000008560  ..........................................................................----
ENSTGUP00000004653  ..........................................................................----
ENSTGUP00000010098  ..........................................................................----
ENSTGUP00000001570  ..........................................................................----
ENSTGUP00000006280  ..........................................................................----
ENSTGUP00000017519  ..........................................................................----
ENSTGUP00000005606  ..........................................................................----
ENSTGUP00000000755  ..........................................................................----
ENSTGUP00000013140  ..........................................................................----
ENSTGUP00000003982  ..........................................................................----
ENSTGUP00000007100  ..........................................................................----
ENSTGUP00000011980  ..........................................................................----
ENSTGUP00000011110  ..........................................................................----
ENSTGUP00000001480  ..........................................................................----
ENSTGUP00000012362  ..........................................................................----
ENSTGUP00000006169  ..........................................................................----
ENSTGUP00000004439  ..........................................................................----
ENSTGUP00000017519  ..........................................................................----
ENSTGUP00000002520  ..........................................................................----
ENSTGUP00000015133  ..........................................................................----
ENSTGUP00000016380  ..........................................................................----
ENSTGUP00000007065  ..........................................................................----
ENSTGUP00000016679  ..........................................................................----
ENSTGUP00000003906  ..........................................................................----
ENSTGUP00000002463  ..........................................................................---F
ENSTGUP00000004353  ..........................................................................----
ENSTGUP00000003982  ..........................................................................----
ENSTGUP00000003906  ..........................................................................----
ENSTGUP00000012383  ..........................................................................----
ENSTGUP00000012383  ..........................................................................----
ENSTGUP00000012510  ..........................................................................----
ENSTGUP00000008485  ..........................................................................----
ENSTGUP00000004172  ..........................................................................----
ENSTGUP00000006467  ..........................................................................----
ENSTGUP00000016677  ..........................................................................----
ENSTGUP00000001309  ..........................................................................----
ENSTGUP00000012926  ..........................................................................----
ENSTGUP00000004782  ..........................................................................----
ENSTGUP00000004439  ..........................................................................----
ENSTGUP00000001809  ..........................................................................----
ENSTGUP00000009278  ..........................................................................----
ENSTGUP00000017513  ..........................................................................----
ENSTGUP00000004936  ..........................................................................----
ENSTGUP00000005796  ..........................................................................----
ENSTGUP00000012223  ..........................................................................---F
ENSTGUP00000002463  ..........................................................................----
ENSTGUP00000012223  ..........................................................................----
ENSTGUP00000010755  ..........................................................................----
ENSTGUP00000008559  ..........................................................................----
ENSTGUP00000012383  ..........................................................................----
ENSTGUP00000013638  ..........................................................................----
ENSTGUP00000013585  ..........................................................................----
ENSTGUP00000015533  ..........................................................................----
ENSTGUP00000004876  ..........................................................................----
ENSTGUP00000007088  ..........................................................................----
ENSTGUP00000012227  ..........................................................................----
ENSTGUP00000007981  ..........................................................................----
ENSTGUP00000011389  ..........................................................................----
ENSTGUP00000008033  kierctltgtnrevivstalhpfamtvfdqhiywtdwntrsiyrankydgsdqivmimnlpqrpmdihvwaksk----
ENSTGUP00000001337  ..........................................................................----
ENSTGUP00000013896  ..........................................................................----
ENSTGUP00000017687  ..........................................................................----
ENSTGUP00000003497  ..........................................................................----
ENSTGUP00000012223  ..........................................................................----
ENSTGUP00000012933  ..........................................................................----
ENSTGUP00000007100  ..........................................................................----
ENSTGUP00000011594  ..........................................................................----


                            10                        20                    30                      
                             |                         |                     |                      
d1m6ba3               PC..HEVCKg...RCWGpgs...EDC..Q....TLTKTICA............PQC......................
ENSTGUP00000000773  SC..HKKCF....HCSGpte...HQC..L....SCVNNRYLls..........KTC......................
ENSTGUP00000009269  PC..HPECGdq..GCDGpna...DQC..L....NCIHYSLGsmktg.......RMC......................
ENSTGUP00000000773  PC..NAECSkv..GCDGpgp...DHC..T....DCLHYYYKsknnt.......RIC......................
ENSTGUP00000001808  GC..HPSCR....SCAGpga...AQC..L....RCQAPEDVlqphppgegvlhGLC......................
ENSTGUP00000000773  PC..HRSCA....TCAGagv...DAC..I....NCTQGYFMed..........GRC......................
ENSTGUP00000001808  AC..HESCS....SCWGaae...SHC..L....SCKDPSHVlqa.........GFC......................
ENSTGUP00000000773  EC..SGSCK....TCMGsa....TQC..L....SCKNPLLLeh..........WEC......................
ENSTGUP00000001808  EC..DWSCN....TCKGpqr...TDC..L....QCTEGHFLhe..........GAC......................
ENSTGUP00000000773  DC..PSNCD....SCDK......DGC..D....SCEEGFYLsd..........GTC......................
ENSTGUP00000001808  DC..HPLCQ....QCVAnlrdsgSVC..L....KCQHARHLllg.........DRC......................
ENSTGUP00000012223  --..--GCSq...DCQDlpv...GYK..C....KCWPGFLLkddg........KTCvd....................
ENSTGUP00000001863  --..-----....----......---..-....--------............---......................
ENSTGUP00000011850  --..-----....----......---..-....--------............---......................
ENSTGUP00000007382  --..-----....----......---..-....--------............---......................
ENSTGUP00000001863  KC..HQNCTed..HCWGpge...KNC..Q....TLTKVICA............QQC......................
ENSTGUP00000012383  -C..DHFCR....NTVG......SFE..C....SCQKGYKLltde........RTC......................
ENSTGUP00000006963  --..-----....----......---..V....LCKNGRCVnte.........GSF......................
ENSTGUP00000010696  QCsvHAICK....DYPN......GFC..C....SCIAGYKGng..........RQCvaegspqrvngkvrgrifvgnn
ENSTGUP00000004353  -C..SHGCL....----......---..-....-------Qts..........KGP......................
ENSTGUP00000010903  -C..AQKCQ....MVRGm.....VQC..-....TCHTGYRLledg........R--......................
ENSTGUP00000001809  -C..DHICR....NTVG......SFE..C....SCKKGYKLli..........NER......................
ENSTGUP00000011850  RC..HKSCTg...RCWGpte...NHC..Q....TLTKTVCA............EQC......................
ENSTGUP00000014972  -C..QHSCV....STPG......SFY..C....ECNPGYRLnvdg........K--......................
ENSTGUP00000000773  --..-----....----......DHC..I....SCPLRRVFdd..........GRC......................
ENSTGUP00000012926  --..----Q....ICINteg...GYT..C....SCTEGYWLle..........GQCid....................
ENSTGUP00000000998  --..-----....----......---..-....LCTHGTCRnti.........GSF......................
ENSTGUP00000006963  --..-----....----......---..-....-CSSGHCIntd.........GSF......................
ENSTGUP00000012362  HC..DHFCI....NTPG......SYL..C....RCKQGYIL............NAD......................
ENSTGUP00000008559  -C..DHFCK....NTVG......SFD..C....SCRKGFKLltd.........E--......................
ENSTGUP00000006963  --..-----....-CIDr.....NEC..LeipnVCSHGLCVdmq.........GSY......................
ENSTGUP00000000998  --..-----....----......---..-....ICTNGVCInqi.........GSF......................
ENSTGUP00000000998  -C..SENLG....VCIN......GAC..-....-------Intd.........GSF......................
ENSTGUP00000001809  EG..TDNCHida.ICQNtpk...SYK..C....ICKSGYTGdg..........KHC......................
ENSTGUP00000000998  --..-----....----......---..-....MCRNGRCVntd.........GSF......................
ENSTGUP00000003792  --..-----....---De.....DEC..-....--AVGNPCshtchnav....GSY......................
ENSTGUP00000012128  --..-----....----......---..-....--------............---......................
ENSTGUP00000000998  -C..KHFTN....LCLN......GRC..I....PTPSSY--............---......................
ENSTGUP00000005188  -C..QHSCV....STPG......SFY..C....ECNPGYRLnvdg........KTC......................
ENSTGUP00000006963  --..---PN....LCLN......GRC..I....PTPSSY--............---......................
ENSTGUP00000008033  -C..IPIGK....VCDGa.....ADC..P....EGEDETNItag.........RHC......................
ENSTGUP00000006963  --..-----....----......---..-....MCMNGKCRnti.........GSF......................
ENSTGUP00000012383  --..TDDCHida.ICQNtpk...SYK..C....ICKPGYKGeg..........KQCed....................
ENSTGUP00000001808  -C..HPDCL....LQ--......---..-....--------............---......................
ENSTGUP00000012183  --..-----....----......---..Q....PCGEGHICinap........GNY......................
ENSTGUP00000001588  --..-----....----......---..-....--------............---......................
ENSTGUP00000006963  --..-----....----......---..-....ICSNGICEnlr.........GSY......................
ENSTGUP00000009278  --..-----....----......---..-....VCTNGRCRnte.........GSF......................
ENSTGUP00000000449  --..-----....----......---..-....-------Iercwth......DRC......................
ENSTGUP00000006963  PC..N----....----......---..-....-------Ficknse......GSY......................
ENSTGUP00000007100  --..-----....-CVNlrg...SFS..C....QCLPGYQKrg..........EQC......................
ENSTGUP00000013892  --..-----....----......---..K....DCIDGQAK............YTC......................
ENSTGUP00000006963  NCdmHASCV....NVPG......SFK..C....SCREGWVG............NGI......................
ENSTGUP00000013142  --..-----....----......---..-....-CAPGYYG............SLCemdvnecetlpclhggscinrl
ENSTGUP00000008559  --..-----....----......---..-....-CQNTPKL............Y--......................
ENSTGUP00000012223  --..-----....----......---..-....--------............---......................
ENSTGUP00000016176  DC..MTNST....----......---..-....MCGDEAHCvqsq........STS......................
ENSTGUP00000013537  LG..THGCQq...VCVSnga...SHL..C....DCYEGYTLnpdk........R--......................
ENSTGUP00000000998  EC..ADNVN....LCEN......GQC..L....NAPGGYRC............---......................
ENSTGUP00000013307  NC..HININ....DCHG......---..-....QCQHGGTCkdev........NGY......................
ENSTGUP00000007218  --..-----....TCGHdi....DEC..Asg..PCRNGAICrdsa........GEY......................
ENSTGUP00000006963  -C..DTHCT....NSEG......SYE..C....SCSDGYALmpdv........RTC......................
ENSTGUP00000013140  --..-----....----......---..-....-CAPGYYG............SLCemdvnecetlpclhggscinrl
ENSTGUP00000002415  --..-----....----......---..-....--------............---......................
ENSTGUP00000003999  A-..-----....----......---..-....--------............---......................
ENSTGUP00000011678  --..-----....----......---..-....--------............---......................
ENSTGUP00000008956  EC..GDLCP....GTMEek....PLC..E....KTSINNEYnyrcwtt.....NHC......................
ENSTGUP00000012362  -C..QHECV....NTKD......SYY..C....RCHPGFIL............NPD......................
ENSTGUP00000015313  --..-----....----......---..-....--------............---......................
ENSTGUP00000009278  --..PDICGag..HCVNlpv...GYT..C....ICYKGYKL............NDQ......................
ENSTGUP00000010351  --..-----....---Agtvr..DAC..D....CCWECANLe...........G--......................
ENSTGUP00000015843  PC..TQTCV....NTYG......SFL..C....RCEPGYELead.........GVN......................
ENSTGUP00000017519  --..-----....----......---..-....------CEha..........GKCvntegsf...............
ENSTGUP00000010098  --..-----....NCEKki....DYC..Sss..PCANGAQCvdlg........NSY......................
ENSTGUP00000006963  -C..AFRCI....NTYGf.....YE-..C....TCPVGYELredq........KMCkd....................
ENSTGUP00000003792  --..-----....----......---..-....--------............---......................
ENSTGUP00000017519  --..-----....-CTVdi....DEC..Lsk..PCKNHALChniq........GSY......................
ENSTGUP00000007738  -C..QQLCL....DVPGe.....SPR..C....ACRPGYVLaadm........ASC......................
ENSTGUP00000007419  --..-----....----......---..-....--------............---......................
ENSTGUP00000000998  NC..QFLCV....NVIG......GFN..C....KCPPGFTQ............HHS......................
ENSTGUP00000017519  -C..PPGFQgt..NCESni....DEC..Tds..SCFNGGTCvdgi........NSF......................
ENSTGUP00000006342  -C..PPGWQgq..TCEIdi....NEC..Vks..PCRNGATCqntn........GSY......................
ENSTGUP00000012356  --..-----....----......---..-....--------............---......................
ENSTGUP00000011389  --..-----....----......GPR..C....SCHRGHRLagdt........KTCpd....................
ENSTGUP00000006963  RC..QHGCQ....NILG......GYR..C....GCPQGFVQhyqw........NQC......................
ENSTGUP00000002877  -C..SH---....----......---..-....--------............---......................
ENSTGUP00000006342  --..----Sgi..HCENnt....PDC..Tes..SCFNGGTCvdgi........NTF......................
ENSTGUP00000010582  --..-----....----......STC..Psp..SCPSGYVPdr..........CGC......................
ENSTGUP00000005344  --..-----....----......---..-....-----SPLvldg........CGC......................
ENSTGUP00000017519  IC..SEQID....ECHSnpclhqGRC..I....DLVNGYQC............---......................
ENSTGUP00000000773  --..-----....----......---..-....--------............NEC......................
ENSTGUP00000011389  -C..EQDCV....QLSEd.....HYK..C....QCQPGYQLktda........KSC......................
ENSTGUP00000009572  --..-----....----......---..-....--------............--N......................
ENSTGUP00000006342  --..-----....----......---..-....-CLSGYMGpg..........NQD......................
ENSTGUP00000006342  --..----V....NCSEei....NEC..Lsh..PCQNGGTCidli........NTY......................
ENSTGUP00000012510  --..-----....----......---..-....ICRGQQCIntp.........GSY......................
ENSTGUP00000007392  --..-----....----......---..-....--------............---......................
ENSTGUP00000012362  --..-----....----......---..-....--------............-LF......................
ENSTGUP00000001337  --..-----....----......---..-....-------Edrv.........GSF......................
ENSTGUP00000016176  -C..SHNCT....VAPGe.....GIV..C....SCPLGMEL............GAD......................
ENSTGUP00000012943  --..-----....----......---..-....--------............---......................
ENSTGUP00000012578  --..-----....----......---..-....--------............---......................
ENSTGUP00000002877  --..-----....----......---..-....QCRHNHQLhedg........K--......................
ENSTGUP00000004439  --..---CE....TADSdcdt..NPC..Ehgg.TCQSGLAG............PTC......................
ENSTGUP00000006342  --..-----....LCQFdi....DECasT....PCKNGAKCvdgp........NTY......................
ENSTGUP00000015640  PC..KHRCM....NTYG......SYK..C....YCLNGYMLmpd.........GTC......................
ENSTGUP00000001337  --..-----....----......---..-....--------............--M......................
ENSTGUP00000003906  --..-----....----......---..-....-CSRGYHSneeg........TRC......................
ENSTGUP00000006280  --..--NCD....INI-......NDC..Rg...QCQNGGSCrdlv........NGY......................
ENSTGUP00000013140  --..-----....----......---..-....--------............---......................
ENSTGUP00000009269  --..-----....----......---..-....--------............--C......................
ENSTGUP00000006342  --..-----....--L-......DDC..Asn..PCDYGKCIdki.........NGY......................
ENSTGUP00000012183  --..-----....----......---..-....--------............---......................
ENSTGUP00000010478  --..--GCK....TLTQql....GGG..I....ICKKGYYLhq..........KKL......................
ENSTGUP00000000998  --..-----....----......---..-....--------............---......................
ENSTGUP00000002105  --..-----....----......---..-....--------............GSClrrlavspalrthesvpviiva
ENSTGUP00000012510  --..-----....----......---..T....LCSRGQCLnte.........GSY......................
ENSTGUP00000003906  PC..SQECA....NVYG......SYQ..C....YCRQGFQLaed.........GHS......................
ENSTGUP00000010696  --..THSCD....IPQR......AQC..V....-----Y-Tgg..........SAY......................
ENSTGUP00000003792  --..-----....----......---..-....-------Ckntrgg......YKC......................
ENSTGUP00000014137  --..-----....-CEEdi....DDC..Hgh..QCVNGATCvdgi........NGY......................
ENSTGUP00000008560  --..-----....----......---..-....--------............---......................
ENSTGUP00000004653  --..---AI....-CTNtir...GHS..C....TCKPGYVGng..........TTC......................
ENSTGUP00000010098  --..----L....FCNQdl....NYC..Thhk.PCKNGATCtntgq.......GSY......................
ENSTGUP00000001570  --..-INPD....DCED......ND-..-....-CENNSTCvdgi........NNY......................
ENSTGUP00000006280  --..-----....----......---..-....--------............-TC......................
ENSTGUP00000017519  --..-----....---Sqrgv..PVD..Q....LCQHSGHClnvg........NTH......................
ENSTGUP00000005606  --..NGGCSh...ICRDlvi...GYE..C....DCPAGFELldr.........RT-......................
ENSTGUP00000000755  --..-----....----......SQP..L....QCPAGTSHvwdv........CGC......................
ENSTGUP00000013140  -ClhNASCA....DLIG......GYK..C....VCLPGFTG............ELCetdidecasipckngat.....
ENSTGUP00000003982  --..-----....----......---..-....-----WARvaw.........GQC......................
ENSTGUP00000007100  PC..AQQCY....NILG......SFI..C....QCNPGFEL............SSD......................
ENSTGUP00000011980  --..-----....----......---..-....TCPAGVSLvldg........CGC......................
ENSTGUP00000011110  --..----L....FCDQdl....NYC..Thhr.PCKNGATCmntgq.......GSY......................
ENSTGUP00000001480  --..-FSCKagefLEMQt.....QTC..R....PCAAGTYSl...........GTGvrfdewdevphgfanvatnlev
ENSTGUP00000012362  SV..NHGCEh...VCASagd...SFV..C....KCQEGFLL............RED......................
ENSTGUP00000006169  -C..VTNQH....----......---..-....NCDENALCfntv........GGH......................
ENSTGUP00000004439  --..-----....-CEEdi....DDC..Hgh..QCVNGATCvdgi........NGY......................
ENSTGUP00000017519  --..-----....----......---..-....--------............---......................
ENSTGUP00000002520  --..-----....----......---..-....--------............---......................
ENSTGUP00000015133  --..-----....----......---..-....-CKYGECMgp..........NKC......................
ENSTGUP00000016380  --..-----....----......---..-....SCASGEYLemk.........NQV......................
ENSTGUP00000007065  --..-----....----......---..-....--------............---......................
ENSTGUP00000016679  --..-----....----......---..K....DCIDGQAK............YTC......................
ENSTGUP00000003906  PC..KHLCN....IVEG......DAV..C....SCMAGYTLma..........DGV......................
ENSTGUP00000002463  SC..ASGEY....LEMKn.....QVC..S....KCAEGTYSl...........GSGikfdewdelpagfsnvatfmdt
ENSTGUP00000004353  --..-----....----......---..-....--------............---......................
ENSTGUP00000003982  --..-----....TCVDi.....DEC..AtgrvLCPRFRHCvntf........GSY......................
ENSTGUP00000003906  --..--HCV....NTMGs.....FRC..Lqel.SCQPGHELkd..........GECvd....................
ENSTGUP00000012383  --..-----....----......---..-....--------............---......................
ENSTGUP00000012383  -C..AHICR....---Etpkg..GVA..C....ECRPGFEL............---......................
ENSTGUP00000012510  --..-----....----......---..-....--------............---......................
ENSTGUP00000008485  -C..QYGCE....EVKGr.....VQC..L....CPSGGLQLgpng........RTC......................
ENSTGUP00000004172  --..-----....TCNNthg...SYI..C....QCPLGYELek..........GKCnldtsfvrafygdfvhpllttg
ENSTGUP00000006467  --..-----....----......---..-....-CLNGGSCkvhd........DSY......................
ENSTGUP00000016677  --..-----....----......---..K....DCIDGQAK............YTC......................
ENSTGUP00000001309  --..-----....----......---..-....------TCqqsg........GKS......................
ENSTGUP00000012926  --..-----....----......--Q..Q....QCTNGFDLdras........GQC......................
ENSTGUP00000004782  --..-----....----......---..-....--------............---......................
ENSTGUP00000004439  --..-----....----......---..-....--------............---......................
ENSTGUP00000001809  --..-----....----......---..-....--------............---......................
ENSTGUP00000009278  --..-----....----......---..-....--------............---......................
ENSTGUP00000017513  --..-----....----......---..-....MCRAGYESven.........GTV......................
ENSTGUP00000004936  --..-----....----......--C..H....PLTGHCQClhnte.......GPF......................
ENSTGUP00000005796  -C..DCGHG....SCSPa.....SGH..C....TCEPGYQG............RSC......................
ENSTGUP00000012223  KC..SPNFI....SCIGt.....NKC..I....H------Ls...........QLCng....................
ENSTGUP00000002463  --..-----....----......---..-....--------............---......................
ENSTGUP00000012223  --..-----....----......---..-....--------............---......................
ENSTGUP00000010755  --..-----....----......---..C....TCAAGYEPamk.........DTQ......................
ENSTGUP00000008559  -C..AHICR....---Etpkg..GVA..C....ECRPGFEL............---......................
ENSTGUP00000012383  QC..SPGHY....SSDGf.....KPC..T....VCPLGMYQpepg........RTL......................
ENSTGUP00000013638  --..-----....----......---..-....--------............---......................
ENSTGUP00000013585  --..-----....----......---..-....--------............-RC......................
ENSTGUP00000015533  -Cr.IENCD....SCFSr.....DFC..T....KCKSGFYShr..........GRC......................
ENSTGUP00000004876  --..-----....----......---..-....--------............---......................
ENSTGUP00000007088  --..-----....----......---..-....TCKAGYEPen..........NVA......................
ENSTGUP00000012227  --..-----....----......--C..A....PCGAHQRQsa..........GGS......................
ENSTGUP00000007981  --..-----....----......---..-....--------............---......................
ENSTGUP00000011389  -C..DHFCV....NSLG......SYE..C....ACKEGYRL............GHSrwacvalptdlrsdfgmgiftn
ENSTGUP00000008033  --..-----....----......---..-....--------............---......................
ENSTGUP00000001337  --..SYLCE....ANENcc....DIM..A....SCKCGTHT............GQF......................
ENSTGUP00000013896  --..-----....----......---..-....--------............---......................
ENSTGUP00000017687  --..-----....----......---..-....--------............---......................
ENSTGUP00000003497  --..-----....----......---..-....-CNENGLLgsfse.......ETH......................
ENSTGUP00000012223  --..-----....----......---..-....--------............---......................
ENSTGUP00000012933  --..-----....----......---..-....--------............---......................
ENSTGUP00000007100  --..-----....----......---..-....--------............---......................
ENSTGUP00000011594  --..-----....----......---..-....--------............---......................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  pvpvvfentdlhsyvvmnqgraytaistipetlgysllplasiggiigwmfaveqqgyrngfsitggeftrqtevtfl
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ggy...........................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ggy...........................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  neplrpf.......................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ddsfgdaaenctastwvplgdyvasntdectatlmyavslkqsgtvtfeyiypdssivfeffvqndqcqpaveesrwm
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  alssseskanscnnsswtprgnyiesnrddctvsliyavhlkksgsvffeyqyidnniffeffiqndqckemdstadk
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  qcispieqlnlrdaqspllnaslsglpgyhhstvkasretnfvhvsvqstfslasnvtffdvissvksy.........
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  pgnlgaqlepslnmaraglravrgstgklrnahfafvpn.......................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  gnneklvvkqkfsgidehghltistemegripeipsgasvhiepytelyhtsssvitssssreytvteperdggtsty
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  rttekgwefhsvslsrgnnvlywrttafsvwskvpkpvlvrnigitgvaftse.........................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  wvkltdngewgshsvtlksgsnilywrttgilmgskvvkpvlvknitiegvaytse......................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               .....................................................NGHCFGPNP................
ENSTGUP00000000773  .....................................................VETCPDGYYadsterq.........
ENSTGUP00000009269  .....................................................VSSCPAGFFgdngarr.........
ENSTGUP00000000773  .....................................................VSTCPPGHYnadkkr..........
ENSTGUP00000001808  .....................................................LPLCPSHFHvdstgv..........
ENSTGUP00000000773  .....................................................VLSCSSGYYldhstesgyks.....
ENSTGUP00000001808  .....................................................LASCGQGFYprdgv...........
ENSTGUP00000000773  .....................................................KSTCSEKHFasegi...........
ENSTGUP00000001808  .....................................................VEECPPAFYpesdt...........
ENSTGUP00000000773  .....................................................VSECGDGFFadgisre.........
ENSTGUP00000001808  .....................................................VPDCPPGHYtqhga...........
ENSTGUP00000012223  .....................................................IDECSSG--................
ENSTGUP00000001863  .....................................................---------................
ENSTGUP00000011850  .....................................................---------................
ENSTGUP00000007382  .....................................................CAPCTPERLal..............
ENSTGUP00000001863  .....................................................SGRCRGKVP................
ENSTGUP00000012383  .....................................................-QDIDECSF................
ENSTGUP00000006963  .....................................................QCICNAGFElttn............
ENSTGUP00000010696  tgayqwrqtisfdecihddsphsapatqqlsvdsvfvlynrdeqilryamsnsI-------Gpisdgsadinrnp...
ENSTGUP00000004353  .....................................................VCFCPEGSV................
ENSTGUP00000010903  .....................................................---------................
ENSTGUP00000001809  .....................................................---------................
ENSTGUP00000011850  .....................................................DGRCYGPYV................
ENSTGUP00000014972  .....................................................--TCSPVDA................
ENSTGUP00000000773  .....................................................VMQCPRGKFefkqh...........
ENSTGUP00000012926  .....................................................IDECRYGYC................
ENSTGUP00000000998  .....................................................RCICGNGFAldaeernctdide...
ENSTGUP00000006963  .....................................................RCECPMGYNldftgvhcidtde...
ENSTGUP00000012362  .....................................................QKTCSTQDL................
ENSTGUP00000008559  .....................................................---------................
ENSTGUP00000006963  .....................................................QCICHNGFKasqdqtmcmdvde...
ENSTGUP00000000998  .....................................................RCECPIGFSynni............
ENSTGUP00000000998  .....................................................RCECPFGYNldyt............
ENSTGUP00000001809  .....................................................--------Kdvde............
ENSTGUP00000000998  .....................................................QCICNAGFEitpd............
ENSTGUP00000003792  .....................................................YCSCPKGFT................
ENSTGUP00000012128  .....................................................---------................
ENSTGUP00000000998  .....................................................RCECNMGYKqdvrgecidvdecs..
ENSTGUP00000005188  .....................................................----SPIDA................
ENSTGUP00000006963  .....................................................---------................
ENSTGUP00000008033  .....................................................---------................
ENSTGUP00000006963  .....................................................KCRCNSGFTldmeernctdide...
ENSTGUP00000012383  .....................................................IDECENDFY................
ENSTGUP00000001808  .....................................................---------................
ENSTGUP00000012183  .....................................................RCECKAGYTfdvisrtcidinecrr
ENSTGUP00000001588  .....................................................---------................
ENSTGUP00000006963  .....................................................RCNCNSGYQ................
ENSTGUP00000009278  .....................................................RCICSQGYS................
ENSTGUP00000000449  .....................................................QRVCPPACKsqgctad.........
ENSTGUP00000006963  .....................................................QCSCPRGYVlqedgktckdlde...
ENSTGUP00000007100  .....................................................-VDI-----................
ENSTGUP00000013892  .....................................................--VCKAGWR................
ENSTGUP00000006963  .....................................................KCIDLDECAng..............
ENSTGUP00000013142  .....................................................RCLCLLGFT................
ENSTGUP00000008559  .....................................................KCMCKMGYTgegrkcedide.....
ENSTGUP00000012223  .....................................................---CPDGSDegdl............
ENSTGUP00000016176  .....................................................YCTCRRGFQ................
ENSTGUP00000013537  .....................................................--TCSAVDV................
ENSTGUP00000000998  .....................................................--ECEMGFN................
ENSTGUP00000013307  .....................................................HCLCPRGFT................
ENSTGUP00000007218  .....................................................SCFCVPGFQgsh.............
ENSTGUP00000006963  .....................................................---------................
ENSTGUP00000013140  .....................................................RCLCLLGFT................
ENSTGUP00000002415  .....................................................---CGAGLR................
ENSTGUP00000003999  .....................................................---------................
ENSTGUP00000011678  .....................................................---------................
ENSTGUP00000008956  .....................................................QKMCPSSCGkractdq.........
ENSTGUP00000012362  .....................................................KRTCGKPDY................
ENSTGUP00000015313  .....................................................---------................
ENSTGUP00000009278  .....................................................QTKCIDINE................
ENSTGUP00000010351  .....................................................---------................
ENSTGUP00000015843  .....................................................CSDMDE---................
ENSTGUP00000017519  .....................................................HCECLKGYTgprcemd.........
ENSTGUP00000010098  .....................................................ICQCQAGFT................
ENSTGUP00000006963  .....................................................LDECAEGLHd...............
ENSTGUP00000003792  .....................................................--TCPEGYEar..............
ENSTGUP00000017519  .....................................................LCECRPGFT................
ENSTGUP00000007738  .....................................................--VPEDSCH................
ENSTGUP00000007419  .....................................................---CRRGFIpnirtgacqdvde...
ENSTGUP00000000998  .....................................................--SCIDNNE................
ENSTGUP00000017519  .....................................................TCQCPLGFTgpf.............
ENSTGUP00000006342  .....................................................RCACRTGFS................
ENSTGUP00000012356  .....................................................---------................
ENSTGUP00000011389  .....................................................VDEC----Etg..............
ENSTGUP00000006963  .....................................................VDEN-----................
ENSTGUP00000002877  .....................................................---------................
ENSTGUP00000006342  .....................................................TCVCLPGFT................
ENSTGUP00000010582  .....................................................CLICAAGEGdsc.............
ENSTGUP00000005344  .....................................................CKICARRL-................
ENSTGUP00000017519  .....................................................--NCLLGTS................
ENSTGUP00000000773  .....................................................VSSCPQYYYgnkdnnv.........
ENSTGUP00000011389  .....................................................--------Evidp............
ENSTGUP00000009572  .....................................................---------................
ENSTGUP00000006342  .....................................................VDECSLGAN................
ENSTGUP00000006342  .....................................................KCSCPRGTQgvh.............
ENSTGUP00000012510  .....................................................HCQCKEGFAmgprgqced.......
ENSTGUP00000007392  .....................................................--RCGAGLS................
ENSTGUP00000012362  .....................................................VCKCHPRYTqehrgdtcsrvdh...
ENSTGUP00000001337  .....................................................SCKCLPGFTgvl.............
ENSTGUP00000016176  .....................................................NKTCQIQSYcak.............
ENSTGUP00000012943  .....................................................--------Slvtdgcdc........
ENSTGUP00000012578  .....................................................---------................
ENSTGUP00000002877  .....................................................--------Rcilrnp..........
ENSTGUP00000004439  .....................................................--LCSAGYTgal.............
ENSTGUP00000006342  .....................................................SCECTEGFT................
ENSTGUP00000015640  .....................................................---------................
ENSTGUP00000001337  .....................................................CVNCPLGTY................
ENSTGUP00000003906  .....................................................---------................
ENSTGUP00000006280  .....................................................RCICSPGYAgdh.............
ENSTGUP00000013140  .....................................................---CNPGYA................
ENSTGUP00000009269  .....................................................VPECQPAMYlsreprr.........
ENSTGUP00000006342  .....................................................ECTCEPGYT................
ENSTGUP00000012183  .....................................................---------................
ENSTGUP00000010478  .....................................................LKNCPPGFTpsvqsthydlensveg
ENSTGUP00000000998  .....................................................--PCRRGFIpnirtgacqdvde...
ENSTGUP00000002105  .....................................................VCRCLPGYDgslcetdide......
ENSTGUP00000012510  .....................................................RCLCENGFK................
ENSTGUP00000003906  .....................................................CKDIDECTQsa..............
ENSTGUP00000010696  .....................................................ICTCLPGFSgdgracedvde.....
ENSTGUP00000003792  .....................................................IDLCPSGMTkaengtcidvde....
ENSTGUP00000014137  .....................................................SCLCAANFTgrfcryrrlp......
ENSTGUP00000008560  .....................................................--QCPEGFLgttcedk.........
ENSTGUP00000004653  .....................................................---------................
ENSTGUP00000010098  .....................................................TCSCRPGYTgsnceieine......
ENSTGUP00000001570  .....................................................VCLCPPNYT................
ENSTGUP00000006280  .....................................................NIARNSSCL................
ENSTGUP00000017519  .....................................................HCQCQVGYT................
ENSTGUP00000005606  .....................................................---------................
ENSTGUP00000000755  .....................................................CKVCAQQLGelcsl...........
ENSTGUP00000013140  .....................................................CIDQPGNYF................
ENSTGUP00000003982  .....................................................QPICQPG--................
ENSTGUP00000007100  .....................................................RINCEDTDE................
ENSTGUP00000011980  .....................................................CRVCAKQ--................
ENSTGUP00000011110  .....................................................TCACKPGFTgvd.............
ENSTGUP00000001480  .....................................................CFPCKPGTFapaagsaa........
ENSTGUP00000012362  .....................................................GKTCRNKDI................
ENSTGUP00000006169  .....................................................NCVCKPGYTgn..............
ENSTGUP00000004439  .....................................................SCLCAANFTgrfcryrrlp......
ENSTGUP00000017519  .....................................................-SPCMNG--................
ENSTGUP00000002520  .....................................................---------................
ENSTGUP00000015133  .....................................................--KCFPGFTgktcnqdlne......
ENSTGUP00000016380  .....................................................CSKCAEGTYslgsgikfdewdelpa
ENSTGUP00000007065  .....................................................---------................
ENSTGUP00000016679  .....................................................--VCKAGWR................
ENSTGUP00000003906  .....................................................---------................
ENSTGUP00000002463  .....................................................CFACKPGTFsdkpgasg........
ENSTGUP00000004353  .....................................................---------................
ENSTGUP00000003982  .....................................................ICRCHKGFDlmyigg..........
ENSTGUP00000003906  .....................................................IDECERGTH................
ENSTGUP00000012383  .....................................................---------................
ENSTGUP00000012383  .....................................................---------................
ENSTGUP00000012510  .....................................................---------................
ENSTGUP00000008485  .....................................................IDI------................
ENSTGUP00000004172  .....................................................IRACKSPTEacqfisslkllhrags
ENSTGUP00000006467  .....................................................ICECPQGFLgmhcekakprl.....
ENSTGUP00000016677  .....................................................--VCKAGWRgenceedine......
ENSTGUP00000001309  .....................................................VCICNYGFVgngrth..........
ENSTGUP00000012926  .....................................................--------Ldide............
ENSTGUP00000004782  .....................................................---------................
ENSTGUP00000004439  .....................................................VCRCPPGFA................
ENSTGUP00000001809  .....................................................---------................
ENSTGUP00000009278  .....................................................---------................
ENSTGUP00000017513  .....................................................CRGCPSGTFkasqgdeg........
ENSTGUP00000004936  .....................................................CERCSPGFYgnpfsgrsdd......
ENSTGUP00000005796  .....................................................RDPCPAGKY................
ENSTGUP00000012223  .....................................................VYDCSDGYDegvh............
ENSTGUP00000002463  .....................................................---------................
ENSTGUP00000012223  .....................................................---------................
ENSTGUP00000010755  .....................................................CQACGPGTFkskqgegp........
ENSTGUP00000008559  .....................................................---------................
ENSTGUP00000012383  .....................................................CFPCGGGLVtkye............
ENSTGUP00000013638  .....................................................---------................
ENSTGUP00000013585  .....................................................--TCKAGYQpvddera.........
ENSTGUP00000015533  .....................................................FRGCPAGFAaleelmecveg.....
ENSTGUP00000004876  .....................................................---------................
ENSTGUP00000007088  .....................................................CKACPAGTF................
ENSTGUP00000012227  .....................................................SCECEPGYRmvsssggfsvt.....
ENSTGUP00000007981  .....................................................---------................
ENSTGUP00000011389  .....................................................RQLCLGDTF................
ENSTGUP00000008033  .....................................................---------................
ENSTGUP00000001337  .....................................................ECICEKGYYgkglqhe.........
ENSTGUP00000013896  .....................................................---------................
ENSTGUP00000017687  .....................................................---------................
ENSTGUP00000003497  .....................................................TCTCPNDQVachs............
ENSTGUP00000012223  .....................................................---------................
ENSTGUP00000012933  .....................................................---------................
ENSTGUP00000007100  .....................................................-TQCTDGYEwdpvrqrckdide...
ENSTGUP00000011594  .....................................................---------................


                                           40               50              60                      
                                            |                |               |                      
d1m6ba3               ......................NQCC....HDECA...GGCSGP......QDTDCF........ACRHFND.......
ENSTGUP00000000773  ......................CSAC....HSTCD...-TCTGK......HSSRCL........SCKLGWYrq.....
ENSTGUP00000009269  ......................CRRC....HKGCE...-RCVGR......GPSQCT........ACKRNLYhhpe...
ENSTGUP00000000773  ......................CKKC....SPNCE...-TCVGG......HNDQCM........TCKSGYYlnev...
ENSTGUP00000001808  ......................CREC....HSSCA...-GCVGN......SSQDCT........ACLAPGVll.....
ENSTGUP00000000773  ......................CKRC....DASCL...-DCSGQ......GDRNCT........SCPSGYNld.....
ENSTGUP00000001808  ......................CTAC....GQFCE...-RCSP-......EAARCV........SCAAGKLlh.....
ENSTGUP00000000773  ......................CKRC....SEMCQ...-ECI--......HDEICT........ECMDEFFly.....
ENSTGUP00000001808  ......................CQRC....DQPCL...-RCH--......QADKCS........LCPAPFFll.....
ENSTGUP00000000773  ......................CEPC....HRSCV...-TCVGY......SYKDCT........GCKNSFQls.....
ENSTGUP00000001808  ......................CKRC....HPSCK...-SCTGE......GPLSCS........SCKAGLVlsh....
ENSTGUP00000012223  ......................-FPC....SQQCI...-NTY--......GTYKC-........LCAEGYEtqpdn..
ENSTGUP00000001863  ......................---C....DPLCSd..VGCWGP......GPFHCF........SCRFFDR.......
ENSTGUP00000011850  ......................---C....NELCSs..DGCWGP......GPDQCL........SCKRFIR.......
ENSTGUP00000007382  ......................CPPV....PPDCP...EAARQP......GCGCCQ........ICALGPGqp.....
ENSTGUP00000001863  ......................SDCC....HNQCA...AGCTGP......RESDCL........ACRKFRD.......
ENSTGUP00000012383  ......................ERTC....DHTCI...-NYP--......GSFEC-........-------.......
ENSTGUP00000006963  ......................GKNCvd..HDECA...-ATN--......------........MCLNGMCinedg..
ENSTGUP00000010696  ......................CYTG....THNCD...-TNA--......------........VCRPGTGn......
ENSTGUP00000004353  ......................LKVD....GKSCT...-GCTSP......DNGGCSq.......ICSSLSPs......
ENSTGUP00000010903  ......................----....--SCQ...------......DVNECAeeg.....YCSQGCTnseg...
ENSTGUP00000001809  ......................----....-----...-NCQ--......DIDECSfdr.....TCDHLCIntpg...
ENSTGUP00000011850  ......................SDCC....HRECA...GGCSGP......KDTDCF........ACMNFND.......
ENSTGUP00000014972  ......................CADG....SHGCQ...HHCVSTr.....GSYSC-........-------.......
ENSTGUP00000000773  ......................CHLC....HHTCL...-DCSGS......EPNKCT........TCGTDKRgverfly
ENSTGUP00000012926  ......................----....QQLCA...----NVp.....GSYSCT........-------.......
ENSTGUP00000000998  ......................CRIS....PDLCGh..GSCVNTp.....GSFEC-........ECFEGYEsgfmm..
ENSTGUP00000006963  ......................CSIG....NPCGN...GTCTNVv.....GSFEC-........SCHEGFEpgp....
ENSTGUP00000012362  ......................CAVE....KHACE...QICVNTl.....GSYVC-........-------.......
ENSTGUP00000008559  ......................----....-----...------......------........-------.......
ENSTGUP00000006963  ......................CEQY....PCGNG...-TCKNTv.....GSYNC-........LCYPGFEltr....
ENSTGUP00000000998  ......................L---....-LICEdi.DECSS-......GETLCQ........RHAECVNipg....
ENSTGUP00000000998  ......................GVNCvd..TDECS...-IGNPC......GNGTCT........N-----Vvg.....
ENSTGUP00000001809  ......................CEREd...NAGCV...HECVNIp.....GNYRC-........T------.......
ENSTGUP00000000998  ......................GKNCvd..HDECA...-TTNM-......------........-CLNGMCinedg..
ENSTGUP00000003792  ......................ISAD....GRTCQ...------......DIDECAlggh....SCHAGQDcenlpg.
ENSTGUP00000012128  ......................---C....QGGCA...-TCS--......DYNGCL........SCKPRLFfvlerig
ENSTGUP00000000998  ......................SSPCv...HG---...-DCVNTp.....GSYHC-........KCHEGFQstpt...
ENSTGUP00000005188  ......................CADG....SHGCQ...HHCVSTr.....GSYSC-........-------.......
ENSTGUP00000006963  ......................----....-----...------......------........-------.......
ENSTGUP00000008033  ......................----....-----...-NVSRC......AALSCQy.......RCHSSPS.......
ENSTGUP00000006963  ......................CRIS....PDLCGs..GTCVNTp.....GSFEC-........ECFDGYEsgfmm..
ENSTGUP00000012383  ......................NGGC....VHECI...-NI--P......GNYRC-........TCYDGFMlahd...
ENSTGUP00000001808  ......................----....-----...------......ASDHCD........SCRDPRKrlq....
ENSTGUP00000012183  ....................ypGRLC....AHKCE...---NTP......GSYYC-........-------.......
ENSTGUP00000001588  ......................---C....ARGCD...-LCS--......EFNGCL........RCSPKLFillernd
ENSTGUP00000006963  ......................PDPA....GTNCV...------......DVDECSmngl....LCDNGLCrntpg..
ENSTGUP00000009278  ......................LSST....GDQCEdv.DECLQ-......DSNVCLrg......SCINTEG.......
ENSTGUP00000000449  ......................GQCC....HSECL...GDCTEPn.....DPGRCV........ACRNFYL.......
ENSTGUP00000006963  ......................CQTK....QHNCQ...FLCVNTl.....GGFTC-........-------.......
ENSTGUP00000007100  ......................-DECtl..PPYCH...HRCVNTp.....GSYYC-........QCNAGFQlasn...
ENSTGUP00000013892  ......................GENC....EEDIN...-ECED-......FNGGCSq.......RCSN-FPg......
ENSTGUP00000006963  ......................TQQC....SANAQ...-CVNSP......GSYHC-........-------.......
ENSTGUP00000013142  ......................GHRC....EVNID...-ECM--......-SSPCLnng.....SCIDGIS.......
ENSTGUP00000008559  ......................CDNDf...NGGCV...HECFNIp.....GNYRC-........TCYDGFMlahd...
ENSTGUP00000012223  ......................CDECsln.NGGCS...HQCSVVpg....G-----........-------.......
ENSTGUP00000016176  ......................KVPD....KNFCQ...------......DINECLrfg.....TCSQLCNnt.....
ENSTGUP00000013537  ......................CAPG....RHGCG...QICVSNn.....GSYVC-........-------.......
ENSTGUP00000000998  ......................PTED....SKACQdi.DECT--......FQNICVfg......TCQNLPG.......
ENSTGUP00000013307  ......................GKNC....EIETN...-EC---......ESNPCQngg.....RCKDLVN.......
ENSTGUP00000007218  ......................CEID....IDECA...-SRPCR......NQGTCL........NHMDRY-.......
ENSTGUP00000006963  ......................----....----Adi.DECEN-......NPDICDgg......QCSNIPG.......
ENSTGUP00000013140  ......................GHRC....EVNID...-ECM--......-SSPCLnng.....SCIDGIS.......
ENSTGUP00000002415  ......................CYP-....-----...------......------........-------.......
ENSTGUP00000003999  ......................---C....HAACK...-TCTGS......SNKDCQ........DCKEGWIkne....
ENSTGUP00000011678  ......................----....-----...------......------........-------.......
ENSTGUP00000008956  ......................NECC....HPECL...GSCTAPd.....NNTACV........ACRNYYY.......
ENSTGUP00000012362  ......................CSLQ....DHGCE...QECVNTd.....DSYFC-........-------.......
ENSTGUP00000015313  ......................----....-----...------......------........-------.......
ENSTGUP00000009278  ......................CDQA....PHLCSl..GRCENTe.....GSFLC-........ICQAGFMased...
ENSTGUP00000010351  ......................----....-----...------......------........-------.......
ENSTGUP00000015843  ......................CSFS....EFLCQ...HECVNGp.....GSYYC-........-------.......
ENSTGUP00000017519  ......................I---....-NECH...------......-SNPCQnda.....TCLDKIG.......
ENSTGUP00000010098  ......................GKHC....DDNVD...-DC---......ASFPCVngg.....TCQDGIN.......
ENSTGUP00000006963  ......................CESR....GMICK...-NLI--......G-----........-------.......
ENSTGUP00000003792  ......................NARCvd..IDECE...------......SRDTCQh.......ECRNSLG.......
ENSTGUP00000017519  ......................GGDC....DSNID...-DCL--......-SNPCQnga.....SCVDGID.......
ENSTGUP00000007738  ......................PN--....--PCQ...GSCRALp.....GGFEC-........-------.......
ENSTGUP00000007419  ......................CQAI....PGICQg..GNCINTv.....G-----........-------.......
ENSTGUP00000000998  ......................CTAQ....PSLCGak.GQCLNTp.....GSYNC-........-------.......
ENSTGUP00000017519  ......................CLTE....INECD...------......-SHPCLnrg.....TCVDSLG.......
ENSTGUP00000006342  ......................GRNC....DTDID...-DC---......KPNPCHngg.....SCSDGIG.......
ENSTGUP00000012356  ......................----....-----...------......------........-------.......
ENSTGUP00000011389  ......................ESCC....SQFCI...-NYA--......GGYEC-........ACKAGFQlg.....
ENSTGUP00000006963  ......................----....-----...-ECS--......NPHMCGsa......SCYNTLG.......
ENSTGUP00000002877  ......................----....-----...------......------........VCHHTSS.......
ENSTGUP00000006342  ......................GSYC....EHNIN...-EC---......DSKPCLngg.....TCQDSYG.......
ENSTGUP00000010582  ......................GRKE....DPPCG...------......DSLDC-........RYPMGKRfa.....
ENSTGUP00000005344  ......................----....-----...------......------........-------.......
ENSTGUP00000017519  ......................GVNC....ENNFD...-DC---......ASNPCIhg......DCIDGIN.......
ENSTGUP00000000773  ......................CERC....HSSCL...-TCEGK......GAFSCT........SCVWSYSll.....
ENSTGUP00000011389  ......................CTSG....NGGCS...QICQNEr.....GIAKC-........G------.......
ENSTGUP00000009572  ......................----....-----...-ECSM-......NNGGCSh.......ICKDLKI.......
ENSTGUP00000006342  ......................----....--PCEha.GKCINTq.....GSFQC-........QCLQGYS.......
ENSTGUP00000006342  ......................CEIN....VDDCS...-PFFDPvt....LGPKCFnng.....KCKDRVG.......
ENSTGUP00000012510  ......................VNECvd..PSSCPg..GRCVNTl.....GSYKCV........SCAAGYRpr.....
ENSTGUP00000007392  ......................CQP-....-----...------......------........-------.......
ENSTGUP00000012362  ......................CAES....NHGCE...QLCLNTg.....DSYVC-........-------.......
ENSTGUP00000001337  ......................CERN....IDECL...------......-SRPCRnga.....TCRDGIS.......
ENSTGUP00000016176  ......................HLKC....SQKCE...-QDK--......YNVKC-........SCYEGWMlepd...
ENSTGUP00000012943  ......................CKTC....ARQRG...ESCT--......EADTC-........-------.......
ENSTGUP00000012578  ......................----....--GCL...-SCS--......KDNGCI........RCQHKLFfflrreg
ENSTGUP00000002877  ......................CSDR....NGGCM...HRCHSHr.....GRARC-........E------.......
ENSTGUP00000004439  ......................CERD....VDECI...----S-......--EPCRnga.....LCRDGVD.......
ENSTGUP00000006342  ......................GAHC....EIDID...-EC---......DPDPCHyg......TCKDGIA.......
ENSTGUP00000015640  ......................----....-----...---S--......NALSCLma......NCQYGCDvl.....
ENSTGUP00000001337  ......................YSLE....HLTCQ...-SCWTGsyqdeeGQLECK........SCPSGSYteylhsr
ENSTGUP00000003906  ......................----....-----...---V--......DVDECQtgvh....RCGEGQLchnlpg.
ENSTGUP00000006280  ......................CEKD....INECA...-SNPCM......NGGHC-........--QDEIN.......
ENSTGUP00000013140  ......................GLKC....DQDID...-DCIVNace...HNSTCVdlrlryqcDCLSGWE.......
ENSTGUP00000009269  ......................CETC....PASTA...-RCFRP......GEEDCT........PCTPEGPap.....
ENSTGUP00000006342  ......................GRMC....NINID...-EC---......ASNPCHngg.....TCKDGIN.......
ENSTGUP00000012183  ......................--PC....SQQCR...----DTg.....SSYVC-........SCFVGYQlqpd...
ENSTGUP00000010478  ................piaphlCLPC....HPSCA...-TCVGP......GPNQCL........TCPAHSHfssl...
ENSTGUP00000000998  ......................CQAI....PGLCQg..GNCINTv.....GSYEC-........-------.......
ENSTGUP00000002105  ......................CLPS....PCHND...GTCHNLv.....GGFSC-........SCPEGFTgmacerd
ENSTGUP00000012510  ......................HSQE....TDDCVdm.DECKEY......GDAICGtw......RCQNSLG.......
ENSTGUP00000003906  ......................GILC....TFRCV...-NVP--......GSYQC-........-------.......
ENSTGUP00000010696  ......................CQQG....HCHPD...AFCYNTp.....GSFSC-........HCKAGYRgd.....
ENSTGUP00000003792  ......................C---....-----...------......------........--RSGSHqcrynql
ENSTGUP00000014137  ......................YTVCg...NEERN...LTCF--......NYGNCTdlggelscTCLPGFV.......
ENSTGUP00000008560  ......................IDPCa...SSPCQ...------......NNGTCYadslafscSCSPGFT.......
ENSTGUP00000004653  ......................RAFC....EEGCRyg.GTCV--......APNKC-........LCPSGFT.......
ENSTGUP00000010098  ......................CD--....ANPCKng.GSCTDLe.....NSYSC-........TCPPGFY.......
ENSTGUP00000001570  ......................GELC....DEVIN...-HCVP-......DLNPCQhes.....KCVPLDK.......
ENSTGUP00000006280  ......................PNPC....HNGG-...-TCVVSg.....DSFTC-........VCKEGWE.......
ENSTGUP00000017519  ......................GSYC....EVQLD...-ECD--......-SSPCQnga.....TCRDHLG.......
ENSTGUP00000005606  ......................---Cgd..IDECQ...------......NPGICSq.......ICINLKG.......
ENSTGUP00000000755  ......................HRPC....-----...------......------........-------.......
ENSTGUP00000013140  ......................CQCC....VKGFAg..PRCEI-......NVNECSsn......PCLHGYCydivd..
ENSTGUP00000003982  ......................----....---CKh..GECI--......GPNKC-........KCHPGYT.......
ENSTGUP00000007100  ......................CRTS....SYICQ...YQCVNEp.....GKFSC-........-------.......
ENSTGUP00000011980  ......................----....-----...------......------........-------.......
ENSTGUP00000011110  ......................C---....EHEIS...-ECD--......-SNPCRngg.....SCTDMEN.......
ENSTGUP00000001480  ......................CQPC....PDD--...-TFSGK......GATVCQ........PCDPDTYaepg...
ENSTGUP00000012362  ......................CKSV....NHGCE...HVCVNSg.....DSYTC-........KCHDGFLlred...
ENSTGUP00000006169  ......................GTIC....KAFCK...DGCR--......NGGACIasnvc...ACPQGFT.......
ENSTGUP00000004439  ......................YTVCg...NEERN...LTCF--......NYGNCTdlggelscTCLPGFV.......
ENSTGUP00000017519  ......................----....-----...GTCHQTsd....FTFEC-........NCLPGFEgsv....
ENSTGUP00000002520  ......................----....-----...------......------........-------.......
ENSTGUP00000015133  ......................CGLK....PRPCE...HRCMNTh.....GSYKC-........-------.......
ENSTGUP00000016380  gfsnvatfmdtavssseskansCNNS....SWTPR...GNYIES......NRDDCT........-------.......
ENSTGUP00000007065  ......................----....---CV...-LCS--......EDNGCI........TCHHRLFlliwrdg
ENSTGUP00000016679  ......................GENC....EEDIN...-ECED-......FNGGCSq.......RCSN-FPg......
ENSTGUP00000003906  ......................----....-----...-SCE--......DLDECLtgaq....ACSSGQLcentlg.
ENSTGUP00000002463  ......................CQVC....PRDTY...-SEK--......GAKECT........KCKEEMYyaeeg..
ENSTGUP00000004353  ......................----....-----...------......------........-------.......
ENSTGUP00000003982  ......................KYQC....HDID-...-ECSL-......GHHQCG........SFSHCYNtpg....
ENSTGUP00000003906  ......................SCKV....NFVCQ...-NTE--......GSFYCEskq.....R------.......
ENSTGUP00000012383  ......................----....HEACS...-TGQVL......QDGKCV........TCSTGTFysge...
ENSTGUP00000012383  ......................-AKN....QKDCK...LTCNY-......GNGGCQh.......TCDDTDT.......
ENSTGUP00000012510  ......................----....-----...-ECED-......PAVQCLgg......ECRNTLG.......
ENSTGUP00000008485  ......................-D--....-----...-ECST-......GKAVCSynr.....RCVNTFG.......
ENSTGUP00000004172  .....................lCRQK....DPECDketSECTDFd.....GVALC-........QCKSGYFkynkm..
ENSTGUP00000006467  ......................CSTG....PCRNG...GTCREAd.....GEYHC-........TCPYRFT.......
ENSTGUP00000016677  ......................CEDF....NGGCS...QRCSNFp.....G-----........-------.......
ENSTGUP00000001309  ......................C---....Q--DK...DECQIG......ASKICGnht.....LCHNTHG.......
ENSTGUP00000012926  ......................CRTI....PEACR...------......GDM---........VCVNQNG.......
ENSTGUP00000004782  ......................----....-----...------......------........-------.......
ENSTGUP00000004439  ......................GTHC....DEDVN...-ECYTN......------........PCQNGGIcenfpg.
ENSTGUP00000001809  ......................----....-----...------......LASKCV........SCSQGTYyhgq...
ENSTGUP00000009278  ......................----....---CG...-ILNGC......ENGRCV........RVQEGY-.......
ENSTGUP00000017513  ......................CVHC....PINSR...-TTSE-......GATNC-........VCRNGYYradadpv
ENSTGUP00000004936  ......................CKPC....PCPGR...SPCTEVpst...GEVVCT........HCPPGQR.......
ENSTGUP00000005796  ......................GSQC....VHSCG...-SCKRSqpcsp.VDGFCL........ACQPGWN.......
ENSTGUP00000012223  ......................CREL....LPRCQ...-Q----......--MNCQh.......RCAITRN.......
ENSTGUP00000002463  ......................----....-----...------......--SSCR........ACALGSEqs.....
ENSTGUP00000012223  ......................----....-----...------......---PCGdda.....FCNQTKS.......
ENSTGUP00000010755  ......................CSPC....PPNSR...-TTSG-......AAMVC-........TCRNGFFradtdpa
ENSTGUP00000008559  ......................-SKN....QRSCI...LTCNH-......GNGGCQh.......TCDDADH.......
ENSTGUP00000012383  ......................G---....-----...-----Av.....SFQDCEtkv.....HCSPGHYynst...
ENSTGUP00000013638  ......................----....-----...------......----C-........LCAVGFEev.....
ENSTGUP00000013585  ......................CQAC....APGFF...-KVSV-......GDDPCH........LCPAHSHaplpg..
ENSTGUP00000015533  ......................CEVG....QWSEW...GTCSR-......------........-------.......
ENSTGUP00000004876  ......................----....-----...------......------........-------.......
ENSTGUP00000007088  ......................----....-----...------......------........-------.......
ENSTGUP00000012227  ......................CEKC....PENMS...-GVTR-......DGWNCI........TCPRGLTs......
ENSTGUP00000007981  ......................----....-----...------......----C-........LCNAGYEer.....
ENSTGUP00000011389  ......................GQDC....SLRCE...-DCL--......HGGRCNsersgc..VCPPGWA.......
ENSTGUP00000008033  ......................QQQC....MNPCN...----Q-......FNGGCSh.......ICAPGPA.......
ENSTGUP00000001337  ......................CTAC....PPGTY...-KPEGSpg....GISTCI........SCPDENHtsppgst
ENSTGUP00000013896  ......................----....-----...------......------........-------.......
ENSTGUP00000017687  ......................----....-----...------......------........------Flee....
ENSTGUP00000003497  ......................FLPCtlgdGPACL...-SCAPD......NRTRCG........SCNAGYMls.....
ENSTGUP00000012223  ......................----....-----...GGC---......-----Sh.......ICLLGSShk.....
ENSTGUP00000012933  ......................----....-----...-----P......NSQGCV........VCPPGSYfq.....
ENSTGUP00000007100  ......................CEIV....PDAC-...------......-----Kggm.....KCVNHYG.......
ENSTGUP00000011594  ......................-PQC....DKECLciyGKCDNRid....SDGTCLpg......SCRAGYT.......


                             70                                                                     
                              |                                                                     
d1m6ba3               ......SGACVP..................................................................
ENSTGUP00000000773  ......GKGCVS..................................................................
ENSTGUP00000009269  ......MGTCVL..................................................................
ENSTGUP00000000773  ......TNSCIT..................................................................
ENSTGUP00000001808  ......EGRCLP..................................................................
ENSTGUP00000000773  ......TGVCVIgt................................................................
ENSTGUP00000001808  ......QGQCLP..................................................................
ENSTGUP00000000773  ......DGKCVQ..................................................................
ENSTGUP00000001808  ......GGVCVP..................................................................
ENSTGUP00000000773  ......NGQCLNptnslpagkfwrgkfptelmhimktylqdily..................................
ENSTGUP00000001808  ......TGTCAP..................................................................
ENSTGUP00000012223  ......PNGCKSlsdeepfliladhheirkistdgsnytllkqglnnviaidfdyreefiywidssrpngsrinrmsl
ENSTGUP00000001863  ......QKECVK..................................................................
ENSTGUP00000011850  ......GRTCID..................................................................
ENSTGUP00000007382  ......CGVYTA..................................................................
ENSTGUP00000001863  ......DATCKD..................................................................
ENSTGUP00000012383  ......----L-..................................................................
ENSTGUP00000006963  ......SFKCI-..................................................................
ENSTGUP00000010696  ......RFFCE-..................................................................
ENSTGUP00000004353  ......SWECA-..................................................................
ENSTGUP00000010903  ......GFQCW-..................................................................
ENSTGUP00000001809  ......SFQCL-..................................................................
ENSTGUP00000011850  ......SGACVT..................................................................
ENSTGUP00000014972  ......------..................................................................
ENSTGUP00000000773  ......HGQCRD..................................................................
ENSTGUP00000012926  ......------..................................................................
ENSTGUP00000000998  ......MKNCMD..................................................................
ENSTGUP00000006963  ......MMNCED..................................................................
ENSTGUP00000012362  ......------..................................................................
ENSTGUP00000008559  ......-KSCQDvdecsferacdhtcinhpgtfec...........................................
ENSTGUP00000006963  ......NNDCVDid................................................................
ENSTGUP00000000998  ......SFRCE-..................................................................
ENSTGUP00000000998  ......GFECA-..................................................................
ENSTGUP00000001809  ......------..................................................................
ENSTGUP00000000998  ......SFKCI-..................................................................
ENSTGUP00000003792  ......SFRCVL..................................................................
ENSTGUP00000012128  ...mkqIGVCLS..................................................................
ENSTGUP00000000998  ......K-----..................................................................
ENSTGUP00000005188  ......------..................................................................
ENSTGUP00000006963  ......--RCE-..................................................................
ENSTGUP00000008033  ......GGMCY-..................................................................
ENSTGUP00000006963  ......MKNCMDid................................................................
ENSTGUP00000012383  ......GHNCLDvd................................................................
ENSTGUP00000001808  ......DGRCVE..................................................................
ENSTGUP00000012183  ......------..................................................................
ENSTGUP00000001588  ...irqIGICLP..................................................................
ENSTGUP00000006963  ......SYSC--..................................................................
ENSTGUP00000009278  ......SYKCT-..................................................................
ENSTGUP00000000449  ......DGRCVE..................................................................
ENSTGUP00000006963  ......----K-..................................................................
ENSTGUP00000007100  ......NHTCVDin................................................................
ENSTGUP00000013892  ......SFRCL-..................................................................
ENSTGUP00000006963  ......------..................................................................
ENSTGUP00000013142  ......SYKCH-..................................................................
ENSTGUP00000008559  ......GHNCL-..................................................................
ENSTGUP00000012223  ......--RIVC..................................................................
ENSTGUP00000016176  ......KGSHVC..................................................................
ENSTGUP00000013537  ......------..................................................................
ENSTGUP00000000998  ......MFRCA-..................................................................
ENSTGUP00000013307  ......GFTCL-..................................................................
ENSTGUP00000007218  ......--ECR-..................................................................
ENSTGUP00000006963  ......EYRCL-..................................................................
ENSTGUP00000013140  ......SYKCH-..................................................................
ENSTGUP00000002415  ......------..................................................................
ENSTGUP00000003999  ......DGACVDldecats...........................................................
ENSTGUP00000011678  ......------..................................................................
ENSTGUP00000008956  ......EGVCLP..................................................................
ENSTGUP00000012362  ......------..................................................................
ENSTGUP00000015313  ......------..................................................................
ENSTGUP00000009278  ......GTDCIDfd................................................................
ENSTGUP00000010351  ......------..................................................................
ENSTGUP00000015843  ......------..................................................................
ENSTGUP00000017519  ......GFTCL-..................................................................
ENSTGUP00000010098  ......DYSCT-..................................................................
ENSTGUP00000006963  ......TFVCI-..................................................................
ENSTGUP00000003792  ......SFQCV-..................................................................
ENSTGUP00000017519  ......SFSCI-..................................................................
ENSTGUP00000007738  ......----G-..................................................................
ENSTGUP00000007419  ......SFECK-..................................................................
ENSTGUP00000000998  ......------..................................................................
ENSTGUP00000017519  ......TYRCI-..................................................................
ENSTGUP00000006342  ......TFFCE-..................................................................
ENSTGUP00000012356  ......------..................................................................
ENSTGUP00000011389  ......TDGCA-..................................................................
ENSTGUP00000006963  ......SYRCV-..................................................................
ENSTGUP00000002877  ......GPVCT-..................................................................
ENSTGUP00000006342  ......TYKCT-..................................................................
ENSTGUP00000010582  ......KGVCQ-..................................................................
ENSTGUP00000005344  ......------..................................................................
ENSTGUP00000017519  ......RYNCA-..................................................................
ENSTGUP00000000773  ......NGMCNS..................................................................
ENSTGUP00000011389  ......------..................................................................
ENSTGUP00000009572  ......GYECE-..................................................................
ENSTGUP00000006342  ......GPRCEIdvn...............................................................
ENSTGUP00000006342  ......GYSCI-..................................................................
ENSTGUP00000012510  ......DGRCI-..................................................................
ENSTGUP00000007392  ......------..................................................................
ENSTGUP00000012362  ......------..................................................................
ENSTGUP00000001337  ......SFRCL-..................................................................
ENSTGUP00000016176  ......GESCRSldpfkpfiifsnrheirridlhrgdysvlvpglrntialdfhlnqsslywtdvvedkiyrgkllen
ENSTGUP00000012943  ......------..................................................................
ENSTGUP00000012578  ...mrqYGECLH..................................................................
ENSTGUP00000002877  ......------..................................................................
ENSTGUP00000004439  ......EYSCY-..................................................................
ENSTGUP00000006342  ......SFTCL-..................................................................
ENSTGUP00000015640  ......KGEVRC..................................................................
ENSTGUP00000001337  .....sISDCKA..................................................................
ENSTGUP00000003906  ......GYRCD-..................................................................
ENSTGUP00000006280  ......GFQCL-..................................................................
ENSTGUP00000013140  ......GKFCEKesn...............................................................
ENSTGUP00000009269  ......HWRCVP..................................................................
ENSTGUP00000006342  ......GFTCL-..................................................................
ENSTGUP00000012183  ......GLTCEDin................................................................
ENSTGUP00000010478  ......D-----..................................................................
ENSTGUP00000000998  ......------..................................................................
ENSTGUP00000002105  ......INECL-..................................................................
ENSTGUP00000012510  ......SYRCIM..................................................................
ENSTGUP00000003906  ......----A-..................................................................
ENSTGUP00000010696  ......GFRCVLgeaektkcqhereaafgsggaffprgvraghfip................................
ENSTGUP00000003792  centrgSYRCV-..................................................................
ENSTGUP00000014137  ......GERCEKdid...............................................................
ENSTGUP00000008560  ......GPTCAQlidfcaln..........................................................
ENSTGUP00000004653  ......GSHCEKeadid.............................................................
ENSTGUP00000010098  ......GKNCELsam...............................................................
ENSTGUP00000001570  ......GTRCE-..................................................................
ENSTGUP00000006280  ......GPTCTQntn...............................................................
ENSTGUP00000017519  ......GYQCE-..................................................................
ENSTGUP00000005606  ......GYKCE-..................................................................
ENSTGUP00000000755  ......------..................................................................
ENSTGUP00000013140  ......GFYCL-..................................................................
ENSTGUP00000003982  ......GKTCN-..................................................................
ENSTGUP00000007100  ......----V-..................................................................
ENSTGUP00000011980  ......------..................................................................
ENSTGUP00000011110  ......SYHCL-..................................................................
ENSTGUP00000001480  ......SGSCKPrp................................................................
ENSTGUP00000012362  ......GKTCR-..................................................................
ENSTGUP00000006169  ......GPSCETetdid.............................................................
ENSTGUP00000004439  ......GERCEKdid...............................................................
ENSTGUP00000017519  ......CGHNVD..................................................................
ENSTGUP00000002520  ......------..................................................................
ENSTGUP00000015133  ......----Y-..................................................................
ENSTGUP00000016380  ......-----Vsliyavhlkksgsvffeyqyidnniffeffiqndqckemdstadkwvkltdngewgshsvtlksgs
ENSTGUP00000007065  ...irqYGMCVH..................................................................
ENSTGUP00000016679  ......SFRCL-..................................................................
ENSTGUP00000003906  ......SFSCVShsg...............................................................
ENSTGUP00000002463  ......SSACIErppctskdffqihtpcdkeg..............................................
ENSTGUP00000004353  ......GAMCQ-..................................................................
ENSTGUP00000003982  ......SYKCI-..................................................................
ENSTGUP00000003906  ......------..................................................................
ENSTGUP00000012383  ......HNQCV-..................................................................
ENSTGUP00000012383  ......GPVCG-..................................................................
ENSTGUP00000012510  ......SYECH-..................................................................
ENSTGUP00000008485  ......SFYCK-..................................................................
ENSTGUP00000004172  ......DHSCR-..................................................................
ENSTGUP00000006467  ......GKHCE-..................................................................
ENSTGUP00000016677  ......SFRCL-..................................................................
ENSTGUP00000001309  ......SFYCV-..................................................................
ENSTGUP00000012926  ......GYLCVPrtnpvyrspylspysnvyppppapgpvpnyptvtrpl.............................
ENSTGUP00000004782  ......------..................................................................
ENSTGUP00000004439  ......NYTCH-..................................................................
ENSTGUP00000001809  ......TEQCV-..................................................................
ENSTGUP00000009278  ......--TCD-..................................................................
ENSTGUP00000017513  ......DMPCTTipsapqavissvnetslmlewsp...........................................
ENSTGUP00000004936  ......GKRCE-..................................................................
ENSTGUP00000005796  ......GTLCKD..................................................................
ENSTGUP00000012223  ......GTRCY-..................................................................
ENSTGUP00000002463  ......GSSCV-..................................................................
ENSTGUP00000012223  ......SLLCQ-..................................................................
ENSTGUP00000010755  ......DSACTSvpsaprnvisnvnetslvlewse...........................................
ENSTGUP00000008559  ......GPVCG-..................................................................
ENSTGUP00000012383  ......THRCI-..................................................................
ENSTGUP00000013638  ......DGSCV-..................................................................
ENSTGUP00000013585  ......SQECV-..................................................................
ENSTGUP00000015533  ......------..................................................................
ENSTGUP00000004876  ......-GKCL-..................................................................
ENSTGUP00000007088  ......------..................................................................
ENSTGUP00000012227  ......EGNCK-..................................................................
ENSTGUP00000007981  ......NGECQ-..................................................................
ENSTGUP00000011389  ......GIICNE..................................................................
ENSTGUP00000008033  ......GAECQ-..................................................................
ENSTGUP00000001337  .....sLED--C..................................................................
ENSTGUP00000013896  ......-GRCI-..................................................................
ENSTGUP00000017687  ......SHSCT-..................................................................
ENSTGUP00000003497  ......QGLC--..................................................................
ENSTGUP00000012223  ......ARTCR-..................................................................
ENSTGUP00000012933  ......DDECI-..................................................................
ENSTGUP00000007100  ......GYLCLPrtaqiivnereeaaaestsgrnsvirrtpadpqrappnpthqi.......................
ENSTGUP00000011594  ......GSLCEQqivpceaslqlchadadcqlsdgtvsc.......................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ngsdikvvhntavpnalavdwigknlywsdtekriievsklnglyptvlvskrvkfprdlsldpqagylywidccesp
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  galtsfevviqyglatpeglavdwiagniywvesnldqievakldgtmrttllagdiehpraialdprygilfwtdwd
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  nilywrttgilmgskvvkpvlvknitiegvaytsecf.........................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  higrvgmdgsrqsvvietqisrpmaltidyvnhrlywadenhiefsdmdgshrhkvpnqdipgvialtlfedyiywtd
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  aslprieaasmsgegrrtihketgsggwpngltvdylekrilwidarsdaiysalydgtghievlrgheylshpfavt
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                          80                        
                                                                           |                        
d1m6ba3               ..........................................RCP.....QPLVYN..........K......LTF..
ENSTGUP00000000773  ..........................................QCP.....AGYFAQns........T......GSC..
ENSTGUP00000009269  ..........................................LCP.....PGFYAEer........Q......KRC..
ENSTGUP00000000773  ..........................................NCP.....DGFYLDkn........K......IVC..
ENSTGUP00000001808  ..........................................SCP.....EGLFSH..........R......NRC..
ENSTGUP00000000773  ..........................................VCK.....DGEYLDd.........S......QEC..
ENSTGUP00000001808  ..........................................QCP.....QGHFPSs.........S......GRC..
ENSTGUP00000000773  ..........................................ECP.....SHFYPE..........D......KHC..
ENSTGUP00000001808  ..........................................KCG.....QRYYTDea........Q......REC..
ENSTGUP00000000773  ..........................................PEI.....QGKKYR..........N......RKL..
ENSTGUP00000001808  ..........................................LCS.....LGYYRDd.........R......HTC..
ENSTGUP00000012223  .....gktkslsrahktsgsdrlslinswhtitdiqvyhsyrQ--.....-----Pdvs.......R......HVC..
ENSTGUP00000001863  ..........................................QCNilqgePREFEK..........D......SKC..
ENSTGUP00000011850  ..........................................SCNly...DGEFREfan.......G......SVC..
ENSTGUP00000007382  ..........................................RCR.....LGL---..........-......---..
ENSTGUP00000001863  ..........................................TCP.....PLVLYN..........P......TTY..
ENSTGUP00000012383  ..........................................-CH.....KGYTLYg.........L......THC..
ENSTGUP00000006963  ..........................................-CK.....PGFVLAp.........D......GRF..
ENSTGUP00000010696  ..........................................-CS.....IGFRGD..........G......NIC..
ENSTGUP00000004353  ..........................................-CF.....PGYKLQqd........R......KHCta
ENSTGUP00000010903  ..........................................-CE.....QGYELRpd........K......RSCka
ENSTGUP00000001809  ..........................................-CH.....KGYTLY..........Gl.....THC..
ENSTGUP00000011850  ..........................................QCP.....QTFVYN..........P......TTF..
ENSTGUP00000014972  ..........................................RCR.....PGYYLShn........K......RSC..
ENSTGUP00000000773  ..........................................NCP.....PGHYHL..........E......HSC..
ENSTGUP00000012926  ..........................................-CN.....PGFTLNdd........G......RSC..
ENSTGUP00000000998  ..........................................---.....------..........-......---..
ENSTGUP00000006963  ..........................................---.....------..........I......NEC..
ENSTGUP00000012362  ..........................................QCY.....DGYELDan........G......KSC..
ENSTGUP00000008559  ..........................................TCN.....RGYALY..........G......FTH..
ENSTGUP00000006963  ..........................................ECSs....FGQVCR..........N......GRC..
ENSTGUP00000000998  ..........................................-CA.....TGYRLSp.........G......GAC..
ENSTGUP00000000998  ..........................................-CD.....EGFEPGp.........M......MTC..
ENSTGUP00000001809  ..........................................-CY.....DGFRLAhd........G......HNC..
ENSTGUP00000000998  ..........................................-CK.....PGFVLAp.........N......GRY..
ENSTGUP00000003792  ..........................................RCG.....SGFRRTpd........G......LGC..
ENSTGUP00000012128  ..........................................SCP.....SGYYGTryp.......Di.....NKC..
ENSTGUP00000000998  ..........................................---.....------..........-......QAC..
ENSTGUP00000005188  ..........................................RCR.....PGYYLShn........K......RSC..
ENSTGUP00000006963  ..........................................-CN.....MGYKQDa.........N......GDC..
ENSTGUP00000008033  ..........................................-CP.....AGYTVSsnd.......S......RTC..
ENSTGUP00000006963  ..........................................EC-.....------..........-......---..
ENSTGUP00000012383  ..........................................ECL.....D----N..........N......GGC..
ENSTGUP00000001808  ..........................................TCE.....QGFYQH..........G......GAC..
ENSTGUP00000012183  ..........................................TCT.....VGFKLSad........G......RSC..
ENSTGUP00000001588  ..........................................SCP.....LGYFGLr.........Ntdm...NKC..
ENSTGUP00000006963  ..........................................SCP.....RGYLFSpe........T......DTC..
ENSTGUP00000009278  ..........................................-CP.....DGFQQIa.........N......RGC..
ENSTGUP00000000449  ..........................................NCP.....PGHYRFe.........G......WRC..
ENSTGUP00000006963  ..........................................-CP.....PGFTQH..........H......TAC..
ENSTGUP00000007100  ..........................................ECD.....AN----..........-......---..
ENSTGUP00000013892  ..........................................-CE.....DGYFMHsn........KrdcgdiNEC..
ENSTGUP00000006963  ..........................................ACA.....EGFTGD..........G......FTC..
ENSTGUP00000013142  ..........................................-CK.....QGFTGT..........N......---..
ENSTGUP00000008559  ..........................................---.....-----D..........T......DEC..
ENSTGUP00000012223  ..........................................SCP.....AGFNLTtd........N......KTC..
ENSTGUP00000016176  ..........................................SCA.....KNFMKT..........D......NMCka
ENSTGUP00000013537  ..........................................DCY.....EGYTLNpd........N......KTC..
ENSTGUP00000000998  ..........................................-CD.....DGYELDrs........G......GNC..
ENSTGUP00000013307  ..........................................-CS.....QGFSGV..........-......---..
ENSTGUP00000007218  ..........................................-CA.....PGYAGVnc........D......TEI..
ENSTGUP00000006963  ..........................................-CY.....DGFIVSt.........Dm.....KNC..
ENSTGUP00000013140  ..........................................-CK.....QGFTGTncei......Ni.....NEC..
ENSTGUP00000002415  ..........................................---.....------..........-......---..
ENSTGUP00000003999  ..........................................PCK.....DHQYCLntdg......S......FSC..
ENSTGUP00000011678  ..........................................---.....------..........-......---..
ENSTGUP00000008956  ..........................................TCP.....PNTYKFe.........G......WRC..
ENSTGUP00000012362  ..........................................QCQ.....EGFRLNpd........K......KTC..
ENSTGUP00000015313  ..........................................---.....------..........-......---..
ENSTGUP00000009278  ..........................................ECS.....RPYTCG..........E......GFC..
ENSTGUP00000010351  ..........................................---.....------..........-......---..
ENSTGUP00000015843  ..........................................TCP.....SGYNLLdd........S......RSC..
ENSTGUP00000017519  ..........................................-CM.....PGFKGV..........-......-HC..
ENSTGUP00000010098  ..........................................-CP.....PGYNGK..........-......---..
ENSTGUP00000006963  ..........................................-CP.....PGMTQRpd........G......EGC..
ENSTGUP00000003792  ..........................................-CP.....AGYRLMpn........G......KTC..
ENSTGUP00000017519  ..........................................-CL.....PGFHGDkcqtd.....T......NEC..
ENSTGUP00000007738  ..........................................-CE.....PGYVLAad........G......RGC..
ENSTGUP00000007419  ..........................................-CP.....AGHKFNev........T......QKC..
ENSTGUP00000000998  ..........................................ECQ.....KGFSLDss........G......VNC..
ENSTGUP00000017519  ..........................................-CP.....LGYTGK..........-......-NC..
ENSTGUP00000006342  ..........................................-CL.....AGFRGP..........-......-KC..
ENSTGUP00000012356  ..........................................---.....------..........-......---..
ENSTGUP00000011389  ..........................................-CDdv...DECRLD..........N......GN-..
ENSTGUP00000006963  ..........................................-CP.....SGFSYDqf........S......HAC..
ENSTGUP00000002877  ..........................................-CN.....FGFRLEed........Q......KSC..
ENSTGUP00000006342  ..........................................-CP.....QGYTGLnc........Q......NLV..
ENSTGUP00000010582  ..........................................-C-.....------..........-......---..
ENSTGUP00000005344  ..........................................---.....------..........-......---..
ENSTGUP00000017519  ..........................................-CK.....PGFTGP..........-......---..
ENSTGUP00000000773  ..........................................DCF.....VGEYKEn.........K......LKC..
ENSTGUP00000011389  ..........................................-CH.....PGHSLAad........K......KSC..
ENSTGUP00000009572  ..........................................-CP.....PGYKLLd.........K......KTC..
ENSTGUP00000006342  ..........................................ECL.....SNPCQN..........D......ATC..
ENSTGUP00000006342  ..........................................-CP.....PGFVGErce.......Gdv....NEC..
ENSTGUP00000012510  ..........................................---.....------..........-......---..
ENSTGUP00000007392  ..........................................---.....------..........-......---..
ENSTGUP00000012362  ..........................................QCS.....EGFVINe.........Dl.....KTC..
ENSTGUP00000001337  ..........................................-CV.....AGYTGQnc........E......VNI..
ENSTGUP00000016176  lyggevywtdwrtntlakankwtghnvtvvqrtntqpfdlqvY--.....------..........-......--Hps
ENSTGUP00000012943  ..........................................---.....------..........-......---..
ENSTGUP00000012578  ..........................................SCP.....SGYYGLrtp.......Dm.....NRC..
ENSTGUP00000002877  ..........................................-CH.....PGYQLApd........G......KAC..
ENSTGUP00000004439  ..........................................-CV.....PGYQG-..........-......KHC..
ENSTGUP00000006342  ..........................................-CQ.....PGYTGH..........-......---..
ENSTGUP00000015640  ..........................................RCPs....PGLQLGpd........G......RTC..
ENSTGUP00000001337  ..........................................QCK.....RGTYSP..........Ngl....ETC..
ENSTGUP00000003906  ..........................................-CK.....MGYQYDsf........S......RSC..
ENSTGUP00000006280  ..........................................-CP.....AGFSGNlc........Q......LDI..
ENSTGUP00000013140  ..........................................ECN.....SEPCRN..........N......GTC..
ENSTGUP00000009269  ..........................................ACR.....EGFYPAdshglp....N......KVC..
ENSTGUP00000006342  ..........................................-CP.....EGFHDP..........-......---..
ENSTGUP00000012183  ..........................................ECI.....TGTHNCgi........G......QTC..
ENSTGUP00000010478  ..........................................---.....------..........-......---..
ENSTGUP00000000998  ..........................................KCP.....AGHKQSet........S......HRC..
ENSTGUP00000002105  ..........................................---.....SNP---..........-......---..
ENSTGUP00000012510  ..........................................GCQ.....PGFHWTp.........L......GDC..
ENSTGUP00000003906  ..........................................-CPe....QGYTMAan........G......RTC..
ENSTGUP00000010696  ..........................................QCD.....EHGNYL..........P......TQCha
ENSTGUP00000003792  ..........................................-CP.....RGFRAQga........ArpcvdiNEC..
ENSTGUP00000014137  ..........................................ECS.....SDPCLN..........G......GLC..
ENSTGUP00000008560  ..........................................PCA.....HGICRSvgt.......S......YRC..
ENSTGUP00000004653  ..........................................ECA.....EGIIE-..........-......---..
ENSTGUP00000010098  ..........................................TCA.....DGPCFN..........G......GRC..
ENSTGUP00000001570  ..........................................-CL.....PGYS--..........G......KHC..
ENSTGUP00000006280  ..........................................DCS.....PHPCYN..........S......GTC..
ENSTGUP00000017519  ..........................................-CV.....AGYQGV..........N......C--..
ENSTGUP00000005606  ..........................................-CS.....RGYQMDla........T......GVCka
ENSTGUP00000000755  ..........................................---.....------..........-......---..
ENSTGUP00000013140  ..........................................-CN.....PGYAG-..........-......---..
ENSTGUP00000003982  ..........................................---.....--QDLNec........G......LKP..
ENSTGUP00000007100  ..........................................-CP.....EGYQVVg.........G......RTC..
ENSTGUP00000011980  ..........................................---.....------..........-......---..
ENSTGUP00000011110  ..........................................-CP.....PGYYGThc........E......HSA..
ENSTGUP00000001480  ..........................................PCT.....DKDFFYt.........H......TACda
ENSTGUP00000012362  ..........................................---.....-----N..........K......DLC..
ENSTGUP00000006169  ..........................................ECS.....DGFVQ-..........-......---..
ENSTGUP00000004439  ..........................................ECS.....SDPCLN..........G......GLC..
ENSTGUP00000017519  ..........................................DCP.....NHKCLN..........G......GVC..
ENSTGUP00000002520  ..........................................---.....SNACKS..........T......ARC..
ENSTGUP00000015133  ..........................................-CL.....NGYMLMp.........D......GTC..
ENSTGUP00000016380  ..........................................ACK.....PGTFSDkpg.......A......SGC..
ENSTGUP00000007065  ..........................................TCP.....PGYFGVr.........Glev...NRC..
ENSTGUP00000016679  ..........................................-CE.....DGYFMHsn........K......RDCgg
ENSTGUP00000003906  ..........................................MCA.....EGFILNr.........H......RKC..
ENSTGUP00000002463  ..........................................KTQ.....IMYKWIe.........P......KIC..
ENSTGUP00000004353  ..........................................-CL.....KGFTRK..........G......KSC..
ENSTGUP00000003982  ..........................................-CK.....EGYRDN..........G......TNC..
ENSTGUP00000003906  ..........................................-CM.....DGFLQDp.........E......GNC..
ENSTGUP00000012383  ..........................................PCS.....PGTYQDteg.......Q......LTC..
ENSTGUP00000012383  ..........................................-CH.....QKYALHsd........G......RTCie
ENSTGUP00000012510  ..........................................-CQ.....TGFELIn.........G......TIC..
ENSTGUP00000008485  ..........................................-CQ.....LGYELKy.........T......NGH..
ENSTGUP00000004172  ..........................................ACE.....DGYKLE..........N......ETC..
ENSTGUP00000006467  ..........................................---.....------..........-......---..
ENSTGUP00000016677  ..........................................-CE.....DGYFMHsn........K......RDCgg
ENSTGUP00000001309  ..........................................-CL.....DGYRAS..........N......NNK..
ENSTGUP00000012926  ..........................................MCR.....FGFQLDe.........N......NQC..
ENSTGUP00000004782  ..........................................-CP.....LGFIPDpg........Q......LYC..
ENSTGUP00000004439  ..........................................-CPpadk.EGIFYG..........G......WNC..
ENSTGUP00000001809  ..........................................PCP.....PGTYQEkeg.......Q......LSC..
ENSTGUP00000009278  ..........................................-CF.....DGYHLDma........K......MTC..
ENSTGUP00000017513  ..........................................PRD.....SGGRED..........-......---..
ENSTGUP00000004936  ..........................................LCD.....DGFFGDplgq......Rgpv...HPC..
ENSTGUP00000005796  ..........................................PCA.....PGFHGD..........Gcl....QPC..
ENSTGUP00000012223  ..........................................-CR.....DGYETSgd........G......RSC..
ENSTGUP00000002463  ..........................................PCP.....PGHFIEke........S......SQC..
ENSTGUP00000012223  ..........................................-CK.....PGFQRNrr........N......RQC..
ENSTGUP00000010755  ..........................................PQD.....TGGRDDlly.......N......VIC..
ENSTGUP00000008559  ..........................................-CH.....PKYVMHvd........G......KTCle
ENSTGUP00000012383  ..........................................RCP.....VGTYQPefg.......Q......NYC..
ENSTGUP00000013638  ..........................................ACQ.....RGFYRHsld.......A......KRC..
ENSTGUP00000013585  ..........................................-CQ.....NRYYRSas........D......NS-..
ENSTGUP00000015533  ..........................................---.....------..........-......---..
ENSTGUP00000004876  ..........................................-CK.....AGYEEK..........N......NTC..
ENSTGUP00000007088  ..........................................---.....------..........-......---..
ENSTGUP00000012227  ..........................................-CP.....NNEILVersvdgvllsE......ARC..
ENSTGUP00000007981  ..........................................ACK.....IGYYKAlst.......D......AAC..
ENSTGUP00000011389  ..........................................TCP.....PGTFGT..........-......---..
ENSTGUP00000008033  ..........................................-CPs....EGRWYLann.......N......KHC..
ENSTGUP00000001337  ..........................................TCR.....EGYRAV..........G......QTC..
ENSTGUP00000013896  ..........................................-CS.....VGYEEL..........E......GSC..
ENSTGUP00000017687  ..........................................-CP.....SEQPSCqg........S......IPC..
ENSTGUP00000003497  ..........................................---.....------..........-......---..
ENSTGUP00000012223  ..........................................-CR.....TGFILAtd........G......RSCkr
ENSTGUP00000012933  ..........................................PCP.....LGYYQYqtg.......H......SFC..
ENSTGUP00000007100  ..........................................QCA.....AGYEQSd.........H......NVC..
ENSTGUP00000011594  ..........................................VCK.....PGYEGD..........G......LSC..


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  igpkpfllfangqdirqisfdgtdytslldwqmgvvlaldsdpvenkiyfahtalkwieranldgsdrekvvhgaidt
ENSTGUP00000010903  lgpepvllfanridirqvlphrseytlllnnlenaialdfhhskelvfwsdvtldrimranlngsnveevvstglesp
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  egsehqilyiaddnkirsmypfnpnsayepafqgdenvridamdiyvkgnkiywtnwhtgrisyrelptsssastasn
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  rqplapnpceanggk...............................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  gsgycwcvdrdgneidgtrsgpgvrppclstaappvvvgpsvrpdtvplppgthllfaqsgkiehvplegnnmkknga
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  vgkepsliftnrrdirkiglerkeyiqlveqlrnsialdadiaeqklywadfsqkaifsasidtrdkvgthirildni
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  agetqlmykwaepkic..............................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  retsgeppslpaqclltrgregkergsnyssllelhkacfdidecae...............................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  kdeaaiesseynatsvadvdkrvkrrllmetcavnn..........................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  retsgeppslpaqclltrgregyffslihpayffsvhacvcyidecae..............................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  seeaavevsegnttaaadvdkrvkrrllmetcavnn..........................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  pknelflfygkgrpgiirgmdlntkmsdeymipienlvnpraldfhaesnyiyfadttsfligrqkidgteretilkd
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  peglavdwinrklywtdrgkvciersnlngmqrkmiiwenlsqprgiaihpfakrlfwtdmgvnpridssslegfdrr
ENSTGUP00000010903  gglaidwihdklywtdsgtsrievanldgthrkvllwqnlekpraialhpmegtiywtdwgntprieysnmdgsnrri
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  rnrrqidggvthlnisglkmprgiaidwvagniywtdsgrdvievaqmkgenrktlisgmidephaivvdplrgtmyw
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  kallhipdkvvigvaydcvdkmvywtdisgpsisraslhggepttiiktdlgspegiavdhlgrnifwtdsqldriev
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  hspagiavdwvykniywsdstaktisvasldgtkrkvlflselrepasiavdplsgfmywsdwgepakiekagmngfd
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  dldnvegiavdwignnlywtndghrktiavarlekaaqsrktllegdmshprgivvdpvngwmywtdweedeidasvg
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  vvasaglvwpsgialdyladklywcdakqavvesanldgsgrrilaqndvghpfavavfedhlwfsdwarpslvrvdk
ENSTGUP00000010903  iadthlfwpngltidyaghrmywvdakhhvieradldgrnrkavisqglphpfaitvfedslywtdwhtksinsankf
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000016176  sdwgnhpkietaamdgtlretlvqdniqwptglavdyhnerlywadaklsvigsirlngtdpvvaidnkrglshpfsi
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  arldgrqrrilfdtglvnpraivvdpvrgnlywtdwnreapkietsymdgtnrrilvkddlglpngltfdpyssmlcw
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  rqqlvtteiqwpngialdlvksrlywldsklhmlssvdlngqdrrivlkshmflphplaltifedrvywidgeneavy
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  riekawmdgysrqvfvtskmlwpngltldyranvlywcdayydhieriylngtdrkvvyngkdlnhpfglshhgnyiy
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               .............................................................................Q
ENSTGUP00000000773  .............................................................................E
ENSTGUP00000009269  .............................................................................L
ENSTGUP00000000773  .............................................................................R
ENSTGUP00000001808  .............................................................................S
ENSTGUP00000000773  .............................................................................Q
ENSTGUP00000001808  .............................................................................T
ENSTGUP00000000773  .............................................................................F
ENSTGUP00000001808  .............................................................................T
ENSTGUP00000000773  .............................................................................L
ENSTGUP00000001808  .............................................................................R
ENSTGUP00000012223  .............................................................................T
ENSTGUP00000001863  .............................................................................L
ENSTGUP00000011850  .............................................................................V
ENSTGUP00000007382  .............................................................................-
ENSTGUP00000001863  .............................................................................Q
ENSTGUP00000012383  .............................................................................G
ENSTGUP00000006963  .............................................................................C
ENSTGUP00000010696  .............................................................................Y
ENSTGUP00000004353  ........................................ktgqnrvrlrgsmlrpssvvvvhplakpgtnpclyenG
ENSTGUP00000010903  ......................................................tgknqeiirnklhfpmdihtlhpQ
ENSTGUP00000001809  .............................................................................G
ENSTGUP00000011850  .............................................................................Q
ENSTGUP00000014972  .............................................................................T
ENSTGUP00000000773  .............................................................................V
ENSTGUP00000012926  .............................................................................Q
ENSTGUP00000000998  .............................................................................-
ENSTGUP00000006963  .............................................................................A
ENSTGUP00000012362  .............................................................................V
ENSTGUP00000008559  .............................................................................C
ENSTGUP00000006963  .............................................................................F
ENSTGUP00000000998  .............................................................................V
ENSTGUP00000000998  .............................................................................E
ENSTGUP00000001809  .............................................................................L
ENSTGUP00000000998  .............................................................................C
ENSTGUP00000003792  .............................................................................Q
ENSTGUP00000012128  .............................................................................A
ENSTGUP00000000998  .............................................................................I
ENSTGUP00000005188  .............................................................................T
ENSTGUP00000006963  .............................................................................I
ENSTGUP00000008033  .............................................................................V
ENSTGUP00000006963  .............................................................................-
ENSTGUP00000012383  .............................................................................Q
ENSTGUP00000001808  .............................................................................L
ENSTGUP00000012183  .............................................................................E
ENSTGUP00000001588  .............................................................................I
ENSTGUP00000006963  .............................................................................E
ENSTGUP00000009278  .............................................................................Q
ENSTGUP00000000449  .............................................................................V
ENSTGUP00000006963  .............................................................................I
ENSTGUP00000007100  .............................................................................N
ENSTGUP00000013892  .............................................................................V
ENSTGUP00000006963  .............................................................................S
ENSTGUP00000013142  .............................................................................-
ENSTGUP00000008559  .............................................................................I
ENSTGUP00000012223  .............................................................................E
ENSTGUP00000016176  ...................difedyiygvtyinnrifkihkfghkpvtnltsglnhatdvvlyhqykqpevtnpcdrK
ENSTGUP00000013537  .............................................................................S
ENSTGUP00000000998  .............................................................................T
ENSTGUP00000013307  .............................................................................-
ENSTGUP00000007218  .............................................................................D
ENSTGUP00000006963  .............................................................................V
ENSTGUP00000013140  .............................................................................L
ENSTGUP00000002415  .............................................................................-
ENSTGUP00000003999  .............................................................................K
ENSTGUP00000011678  .............................................................................-
ENSTGUP00000008956  .............................................................................V
ENSTGUP00000012362  .............................................................................K
ENSTGUP00000015313  .............................................................................-
ENSTGUP00000009278  .............................................................................I
ENSTGUP00000010351  .............................................................................-
ENSTGUP00000015843  .............................................................................Q
ENSTGUP00000017519  .............................................................................-
ENSTGUP00000010098  .............................................................................-
ENSTGUP00000006963  .............................................................................T
ENSTGUP00000003792  .............................................................................Q
ENSTGUP00000017519  .............................................................................L
ENSTGUP00000007738  .............................................................................S
ENSTGUP00000007419  .............................................................................D
ENSTGUP00000000998  .............................................................................E
ENSTGUP00000017519  .............................................................................K
ENSTGUP00000006342  .............................................................................E
ENSTGUP00000012356  .............................................................................-
ENSTGUP00000011389  .............................................................................-
ENSTGUP00000006963  .............................................................................H
ENSTGUP00000002877  .............................................................................T
ENSTGUP00000006342  .............................................................................R
ENSTGUP00000010582  .............................................................................-
ENSTGUP00000005344  .............................................................................-
ENSTGUP00000017519  .............................................................................-
ENSTGUP00000000773  .............................................................................E
ENSTGUP00000011389  .............................................................................L
ENSTGUP00000009572  .............................................................................G
ENSTGUP00000006342  .............................................................................L
ENSTGUP00000006342  .............................................................................L
ENSTGUP00000012510  .............................................................................-
ENSTGUP00000007392  .............................................................................-
ENSTGUP00000012362  .............................................................................S
ENSTGUP00000001337  .............................................................................N
ENSTGUP00000016176  .............................................................................G
ENSTGUP00000012943  .............................................................................-
ENSTGUP00000012578  .............................................................................S
ENSTGUP00000002877  .............................................................................E
ENSTGUP00000004439  .............................................................................D
ENSTGUP00000006342  .............................................................................-
ENSTGUP00000015640  .............................................................................V
ENSTGUP00000001337  .............................................................................E
ENSTGUP00000003906  .............................................................................I
ENSTGUP00000006280  .............................................................................D
ENSTGUP00000013140  .............................................................................M
ENSTGUP00000009269  .............................................................................K
ENSTGUP00000006342  .............................................................................-
ENSTGUP00000012183  .............................................................................V
ENSTGUP00000010478  .............................................................................-
ENSTGUP00000000998  .............................................................................E
ENSTGUP00000002105  .............................................................................-
ENSTGUP00000012510  .............................................................................I
ENSTGUP00000003906  .............................................................................R
ENSTGUP00000010696  vdagtkrlecmnpnqlgrrkiiegiqypfgvtsygknlyytdwrrdavvavdrtislendnfqphkrsrlygittafA
ENSTGUP00000003792  .............................................................................E
ENSTGUP00000014137  .............................................................................Q
ENSTGUP00000008560  .............................................................................L
ENSTGUP00000004653  .............................................................................-
ENSTGUP00000010098  .............................................................................T
ENSTGUP00000001570  .............................................................................E
ENSTGUP00000006280  .............................................................................V
ENSTGUP00000017519  .............................................................................-
ENSTGUP00000005606  ............................................gankftgndlvtlvnnlndaqdiivyhelvqpsG
ENSTGUP00000000755  .............................................................................-
ENSTGUP00000013140  .............................................................................-
ENSTGUP00000003982  .............................................................................R
ENSTGUP00000007100  .............................................................................Q
ENSTGUP00000011980  .............................................................................-
ENSTGUP00000011110  .............................................................................L
ENSTGUP00000001480  .............................................................................S
ENSTGUP00000012362  .............................................................................K
ENSTGUP00000006169  .............................................................................-
ENSTGUP00000004439  .............................................................................Q
ENSTGUP00000017519  .............................................................................V
ENSTGUP00000002520  .............................................................................K
ENSTGUP00000015133  .............................................................................A
ENSTGUP00000016380  .............................................................................Q
ENSTGUP00000007065  .............................................................................T
ENSTGUP00000016679  .............................................................................N
ENSTGUP00000003906  .............................................................................V
ENSTGUP00000002463  .............................................................................R
ENSTGUP00000004353  .............................................................................Y
ENSTGUP00000003982  .............................................................................I
ENSTGUP00000003906  .............................................................................V
ENSTGUP00000012383  .............................................................................E
ENSTGUP00000012383  .............................................................................G
ENSTGUP00000012510  .............................................................................K
ENSTGUP00000008485  .............................................................................Y
ENSTGUP00000004172  .............................................................................V
ENSTGUP00000006467  .............................................................................-
ENSTGUP00000016677  .............................................................................N
ENSTGUP00000001309  .............................................................................T
ENSTGUP00000012926  .............................................................................A
ENSTGUP00000004782  .............................................................................V
ENSTGUP00000004439  .............................................................................T
ENSTGUP00000001809  .............................................................................D
ENSTGUP00000009278  .............................................................................V
ENSTGUP00000017513  .............................................................................L
ENSTGUP00000004936  .............................................................................E
ENSTGUP00000005796  .............................................................................P
ENSTGUP00000012223  .............................................................................T
ENSTGUP00000002463  .............................................................................K
ENSTGUP00000012223  .............................................................................E
ENSTGUP00000010755  .............................................................................K
ENSTGUP00000008559  .............................................................................G
ENSTGUP00000012383  .............................................................................I
ENSTGUP00000013638  .............................................................................L
ENSTGUP00000013585  .............................................................................-
ENSTGUP00000015533  .............................................................................-
ENSTGUP00000004876  .............................................................................Q
ENSTGUP00000007088  .............................................................................-
ENSTGUP00000012227  .............................................................................I
ENSTGUP00000007981  .............................................................................A
ENSTGUP00000011389  .............................................................................-
ENSTGUP00000008033  .............................................................................I
ENSTGUP00000001337  .............................................................................E
ENSTGUP00000013896  .............................................................................H
ENSTGUP00000017687  .............................................................................A
ENSTGUP00000003497  .............................................................................-
ENSTGUP00000012223  ......................................wtdymngsifqldlvtrnvtllrserpplfglqiydprkQ
ENSTGUP00000012933  .............................................................................I
ENSTGUP00000007100  .............................................................................Q
ENSTGUP00000011594  .............................................................................S


                                        90                      100            110                  
                                         |                        |              |                  
d1m6ba3               L..............E...PNPHT.........KYQY...G...GVCVA....SCPH.NFVVD....Q..TSC.....
ENSTGUP00000000773  R..............C...HKSCK.........ECMG...Tr..ATDCV....SCNT.HFYLLhs..T..NEC.....
ENSTGUP00000009269  K..............C...HQSCK.........KCVG...E...ADKCT....ACKE.GFSLA....G..ESC.....
ENSTGUP00000000773  K..............C...SENCK.........TCV-...E...FQICT....ECRH.GLSLH....G..TRC.....
ENSTGUP00000001808  A..............C...HPSCK.........TCHGp..S...AWECS....TCHP.HATLD....G..GKC.....
ENSTGUP00000000773  L..............C...EISCQ.........KCIG...Pe..SDHCI....SCPL.RRVFD....D..GRC.....
ENSTGUP00000001808  A..............C...HASCS.........TCEG...Pl..ATHCT....SCSF.PLALR....Q..GLC.....
ENSTGUP00000000773  P..............C...HADCK.........DCNGp..N...SDDCT....ACTF.SLFVLy...N..GMC.....
ENSTGUP00000001808  A..............C...PPGCL.........ECD-...S...GSLCH....LCDR.TTFLK....N..KIC.....
ENSTGUP00000000773  S..............C...DSSCM.........TCET...S...ADVCT....SCSE.GKFLI....H..DTC.....
ENSTGUP00000001808  P..............C...SRQCR.........SCD-...S...AAGCT....SCRD.AAKVLl...F..GECq....
ENSTGUP00000012223  Lnngg..........C...SHLCL.........LAP-...D...QLHSC....ACPT.NFYLAad..N..RTC.....
ENSTGUP00000001863  P..............C...HPECLvqnstmynaTCTGp..G...PDNCM....KCAH.--FID....G..PHC.....
ENSTGUP00000011850  E..............C...DPQCEkmeenmi..TCYGp..G...PDHCT....KCFH.--FKD....G..PNC.....
ENSTGUP00000007382  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000001863  M..............D...VNPEG.........KYSF...G...ATCVK....ECPH.NYVVTd...H..GSC.....
ENSTGUP00000012383  Didecsisngs....C...DFGCL.........NTM-...G...SYEC-....VCPP.GKKLHw...N..---.....
ENSTGUP00000006963  T..............D...IDECQ.........TSG-...-...-----....ICMN.GHCINt...E..GSF.....
ENSTGUP00000010696  Dide...........C...SEQPG.........LCG-...S...NADC-....----.--NNQ....P..GTY.....
ENSTGUP00000004353  G..............C...HQICE.........NSF-...G...IVHC-....KCHP.GFGKT....-..---.....
ENSTGUP00000010903  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000001809  Didecsinrgg....C...KFGC-.........----...-...-----....----.--INT....P..GSY.....
ENSTGUP00000011850  L..............E...HNHNA.........KYTY...G...AFCVK....KCPH.NFVVD....S..SSC.....
ENSTGUP00000014972  Midy...........C...SFGNH.........SCQ-...-...-HECV....S---.----I....P..NGH.....
ENSTGUP00000000773  P..............C...PGHCE.........VCL-...N...SSHCK....RCFR.GYYLT....Q..NMCq....
ENSTGUP00000012926  Dvnectsenp.....C...TQTCV.........NTY-...G...SFLC-....RCEP.GYELEa...D..GVN.....
ENSTGUP00000000998  -..............-...-----.........-INE...C...ERDPL....LCRG.GICMNt...D..GSF.....
ENSTGUP00000006963  Qnpll..........C...AFRCI.........NTY-...G...FYEC-....----.-----....-..---.....
ENSTGUP00000012362  Vvdycaldnhg....C...QHECV.........NTK-...D...SYYC-....----.-----....-..---.....
ENSTGUP00000008559  A..............D...INECS.........INNG...Gc..QQLCV....NTLG.DY---....-..---.....
ENSTGUP00000006963  N..............E...I----.........----...G...SFKC-....----.-----....-..---.....
ENSTGUP00000000998  -..............-...-----.........----...G...RNECQeipnVCSH.GDCVDt...E..GSY.....
ENSTGUP00000000998  Dinecslnpll....C...AFRCI.........NTF-...G...SYEC-....TCPS.GYALR....-..---.....
ENSTGUP00000001809  Dldecsegngg....C...QQTCV.........NMM-...G...SYEC-....FCRE.GFFLS....-..---.....
ENSTGUP00000000998  V..............D...IDECE.........TPG-...-...-----....ICMN.GWCINt...E..GSF.....
ENSTGUP00000003792  Dinecqesns.....C...HQRCF.........NTI-...G...SFHC-....GCDP.GFQLK....G..RKCmd...
ENSTGUP00000012128  K..............C...KADCD.........TCF-...T...RNFCT....KCKS.GFYLY....S..GKC.....
ENSTGUP00000000998  Dide...........C...IMNGV.........----...-...-----....MCRN.GRCVNt...D..GSF.....
ENSTGUP00000005188  Midy...........C...SFGNH.........SCQ-...-...-HECV....S---.----I....P..NGH.....
ENSTGUP00000006963  Dvde...........Ct..SNPCSng.......DCVNtp.G...SYYC-....KCHA.GFQRTpt..K..QACidide
ENSTGUP00000008033  Dfddcqmwgv.....C...DQLCE.........DRV-...G...HHQC-....HCVE.GYFLEh...H..RHC.....
ENSTGUP00000006963  -..............-...-----.........----...-...ERNPL....LCRG.GTCVNt...E..GSF.....
ENSTGUP00000012383  -..............-...-QICV.........NTM-...G...SYEC-....QCKE.GFFLS....D..NQH.....
ENSTGUP00000001808  A..............C...NETCS.........ACT-...N...GFECS....SCQA.PLLLK....D..GQC.....
ENSTGUP00000012183  Dlnecesnp......C...SQECA.........NVY-...G...SYQC-....YCRR.GFQLS....-..---.....
ENSTGUP00000001588  K..............Ck..IENCE.........SCF-...S...RNFCT....KCKE.GLYLH....K..GRC.....
ENSTGUP00000006963  -..............-...-----.........----...D...INECEss..PCVN.GACRN....Nl.GSF.....
ENSTGUP00000009278  Dinecersdl.....Csp.HGECL.........NT--...-...-----....----.-----....D..GSY.....
ENSTGUP00000000449  Tfsf...........C...QELHN.........KCKNa..R...ESGC-....----.-HVIH....N..NEC.....
ENSTGUP00000006963  Dnne...........C...GSHPT.........LCG-...S...KGICQ....NTP-.-----....-..GSF.....
ENSTGUP00000007100  P..............C...AQQCY.........NIL-...G...SFIC-....QCNP.GFELS....S..DRI.....
ENSTGUP00000013892  L..............H...PNICG.........----...-...TAIC-....----.--KNT....Q..GKY.....
ENSTGUP00000006963  Dvde...........C...AENVN.........----...-...-----....LCEN.GQCLNa...P..GAF.....
ENSTGUP00000013142  -..............-...-----.........-C--...-...EININ....ECLP.NPCLH....G..SRCidlid
ENSTGUP00000008559  Fnngg..........C...QHLCV.........NTV-...G...SYEC-....RCKE.GFFLS....D..NQH.....
ENSTGUP00000012223  Imdycskhlk.....C...SQVCE.........QHK-...N...TVKC-....SCYE.GWKLSkd..G..ESC.....
ENSTGUP00000016176  K..............C...EWLCL.........LSP-...-...SGPVC....TCPN.GKRLD....N..GTCvvvps
ENSTGUP00000013537  Aldmcapgrhd....C...AQVCL.........SND-...G...SYSC-....GCYE.GYTLNpd..K..KTC.....
ENSTGUP00000000998  D..............-...-----.........----...-...INECAdpv.NCIN.GLCVNt...P..GSY.....
ENSTGUP00000013307  -..............-...-----.........FCEM...D...IDFCEpn..PCQN.GAKCYdl..G..GDY.....
ENSTGUP00000007218  E..............Ca..S----.........----...-...----D....PCQN.GALCN....DhvGFY.....
ENSTGUP00000006963  Dvne...........C...DLNSN.........ICM-...-...FGEC-....----.--ENT....K..GSF.....
ENSTGUP00000013140  Pnp............C...LHGRL.........NDMG...N...-----....----.--LID....G..YQC.....
ENSTGUP00000002415  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000003999  A..............C...DASCV.........GCTGe..G...PGKCK....TCAS.GYVKE....D..EACtdvne
ENSTGUP00000011678  -..............-...-----.........----...-...-----....-CPG.GPVPD....A..CGC.....
ENSTGUP00000008956  Tref...........C...SKVPA.........TDA-...-...-----....SEYE.KFVIH....N..DEC.....
ENSTGUP00000012362  Kvnfcalgqhd....C...EHECV.........NME-...-...ELFVC....KCHP.RYTQEhr..G..DTC.....
ENSTGUP00000015313  -..............-...---CG.........KCDL...Al..CSEPK....DCPA.GTVLD....R..CGC.....
ENSTGUP00000009278  -..............-...-----.........-NTL...G...SYRCE....YCDS.GYQMNr...R..GEC.....
ENSTGUP00000010351  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000015843  Dine...........C...EIRNF.........TCT-...S...QQTCF....NIPG.EYKCL....D..PV-.....
ENSTGUP00000017519  -..............-...-----.........----...-...EQDID....ECLS.NPCVN....N..GVCldkvn
ENSTGUP00000010098  -..............-...--NCS.........TPV-...S...RCEHN....PCHN.GATCHer..N..NRY.....
ENSTGUP00000006963  D..............-...-----.........----...-...ENECR....SKPG.--VCE....N..GRCvnvvg
ENSTGUP00000003792  Didecleenin....Cgs.NQMCF.........NMR-...G...SYQCIdt..PCPP.NYQREph..S..GFC.....
ENSTGUP00000017519  Sep............C...-RNGG.........TCTHyv.N...SYTC-....----.-----....-..---.....
ENSTGUP00000007738  Dvdecesgp......C...QHQCH.........NFP-...G...GFQC-....HCRP.GY---....-..---.....
ENSTGUP00000007419  Dide...........C...STIPG.........ICD-...-...GGECS....NTVS.SYF--....-..---.....
ENSTGUP00000000998  Dvdecdgnhr.....C...QHGCQ.........NVL-...G...GYRC-....GCPQ.GYVQHyq..W..NQC.....
ENSTGUP00000017519  Slvdl..........Cs..KSPCKnrg......TCVQ...T...-----....----.---LA....Q..TRC.....
ENSTGUP00000006342  E..............D...INECA.........SNPCk..N...GANCT....DCVN.SYTC-....-..---.....
ENSTGUP00000012356  -..............-...-----.........----...-...-----....-CTP.GVSLV....K..DGCgc...
ENSTGUP00000011389  -..............C...DHFCV.........NSL-...G...SYEC-....ACKE.GYRL-....-..---.....
ENSTGUP00000006963  Dvnecssaknp....C...SYGCS.........NTE-...G...GYLC-....GCPP.GYYRVg...Q..GHC.....
ENSTGUP00000002877  Dinecdtgshc....C...QQDCY.........NYP-...G...GYEC-....SCHA.GYRLS....T..DGC.....
ENSTGUP00000006342  W..............Cd..SSPCKngg......KCWQt..S...NLY--....----.-----....-..---.....
ENSTGUP00000010582  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000005344  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000017519  -..............-...-----.........RCNA...D...IDECTss..PCHN.GGTCI....NevNGF.....
ENSTGUP00000000773  R..............C...DSSCT.........ECKGp..G...PLNCT....VCPA.SMQLFle..E..SRC.....
ENSTGUP00000011389  Dvdecaegrar....C...AHRCV.........NTP-...G...SFSC-....ACSP.GFELG....-..---.....
ENSTGUP00000009572  Didecenpda.....C...SQICI.........NYK-...G...DYKC-....ECYE.GYEMDtl..S..KNC.....
ENSTGUP00000006342  Dqigefqci......C...MPGYE.........GVY-...C...EINTD....ECAS.SPCLH....N..GNCldkin
ENSTGUP00000006342  Snp............Cd..AR---.........----...G...TQNCV....QRVN.DYK--....-..--C.....
ENSTGUP00000012510  -..............-...-----.........----...D...VDECLveg.TCAH.GQCVNl...D..GSF.....
ENSTGUP00000007392  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000012362  Rvdh...........CalsDHGCEh........LCVN...Gd..RSYTC....QCFE.GYRLR....-..---.....
ENSTGUP00000001337  D..............Ca..SSPCL.........----...-...-----....---N.QATCV....DalNSY.....
ENSTGUP00000016176  P..............C...SHLCL.........INYN...R...TLSC-....ACPH.LMKLDkd..N..T--.....
ENSTGUP00000012943  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000012578  R..............Cr..IENCD.........SCF-...S...RDFCT....KCKS.GFYSH....R..GRC.....
ENSTGUP00000002877  Dvnecltglam....C...AHQCL.........NTR-...G...SFKC-....TCNP.GYELGad..G..K--.....
ENSTGUP00000004439  L..............E...VNECA.........SE--...-...-----....PCLN.GATCL....NqiGHY.....
ENSTGUP00000006342  R..............C...DININ.........ECQ-...-...---SQ....PCKN.GGTCQdr..N..NAY.....
ENSTGUP00000015640  Didecatgrvl....Cpr.FRHCV.........NTF-...G...SYIC-....----.-----....-..---.....
ENSTGUP00000001337  T..............C...PLGTY.........QPSF...G...SRNCI....SCPE.NTLTV....Kr.GAVdvsac
ENSTGUP00000003906  Dinecwnypgrl...C...QHTCE.........NTP-...G...SYHC-....TCSS.GFRLSyd..G..KHCed...
ENSTGUP00000006280  Y..............Ce..PNPCQ.........----...-...-----....---N.GAQCFnlamD..YFC.....
ENSTGUP00000013140  D..............Lf..NSYRC.........TCTAgwtGpdcSEDIN....ECES.EPCLN....G..ATCfesvk
ENSTGUP00000009269  R..............C...DDHCS.........ACE-...G...SSNCL....RCKE.GYSLL....G..GSC.....
ENSTGUP00000006342  K..............C...LSEVN.........ECNS...N...PCIHG....KCHD.G--LN....G..YKC.....
ENSTGUP00000012183  N..............Tlg.SFRCQ.........RDT-...-...-----....SCGT.GYELTd...D..SRCkdide
ENSTGUP00000010478  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000000998  Dvdecgaipgv....C...DGGDC.........TNTV...G...SYVC-....----.-----....-..---.....
ENSTGUP00000002105  -..............-...-----.........----...-...-----....-CKN.GAACQnf..P..GSF.....
ENSTGUP00000012510  D..............I...DE-CA.........NE--...-...----T....LCGS.HGFCEns..D..GSF.....
ENSTGUP00000003906  Dide...........C...AIGTH.........NCS-...A...AETCY....NIQG.SFRCL....-..---.....
ENSTGUP00000010696  Q..............C...PGGHN.........YCTV...N...NGGCTh...LCLA.----T....P..GGR.....
ENSTGUP00000003792  Q..............V...PKPCAl........HCTNtp.G...SFKC-....FCLP.GQQLL....-..---.....
ENSTGUP00000014137  N..............Ll..NKFH-.........----...-...-----....----.-----....-..---.....
ENSTGUP00000008560  C..............Ip..GYHGL.........YCEE...E...YNECLsa..PCQN.GATCR....DlvNSY.....
ENSTGUP00000004653  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000010098  D..............N...PDGGY.........SCR-...-...-----....-CPL.GYSGF....N..---.....
ENSTGUP00000001570  V..............D...DDDCV.........GH--...-...-----....KCRH.GAACV....DavNGY.....
ENSTGUP00000006280  Dgenwyrce......C...APGFAgp.......DCRI...N...INECQss..PCAF.GATCI....DeiNGY.....
ENSTGUP00000017519  -..............-...----E.........YEV-...D...ECQFQ....PCQN.GGTCI....DlvNHF.....
ENSTGUP00000005606  -..............-...RNWCE.........EHMA...N...GGCSY....LCLP.APQINeh..S..PKY.....
ENSTGUP00000000755  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000013140  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000003982  P..............C...KHRCM.........NTY-...G...SYKC-....YCLN.GYMLMp...D..GTCsnals
ENSTGUP00000007100  Dinecettne.....Cre.DEICW.........NYH-...G...GFRCYprn.PCQE.PYVLTs...E..NRC.....
ENSTGUP00000011980  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000011110  -..............-...-----.........----...-...-----....TCID.SPCFN....G..GTClekeq
ENSTGUP00000001480  E..............El..PQAVR.........LPSS...Gv..KTRCP....PCNP.GFAKG....N..GST.....
ENSTGUP00000012362  S..............I...DHGCEh........VCINnn.N...SYSC-....QCHE.GFVLRq...D..GRT.....
ENSTGUP00000006169  -..............-...-----.........-CD-...S...RANC-....----.--INL....P..GWY.....
ENSTGUP00000004439  N..............Ll..NKFH-.........----...-...-----....----.-----....-..---.....
ENSTGUP00000017519  Dgvntyncr......Cpp.QWTGQ.........FCTE...D...VDEC-....----.--QLQ....P..NACqnggt
ENSTGUP00000002520  -..............-...-----.........----...-...-----....----.RTVLD....D..CGC.....
ENSTGUP00000015133  Ssrtcamvn......C...QYGCE.........EVK-...G...QVQC-....LCPS.GGLQLgpn.G..RTCid...
ENSTGUP00000016380  V..............C...PRDTY.........SEK-...G...AKECT....KCKE.EIKTQ....EglSMCshrlf
ENSTGUP00000007065  K..............Cr..SPSCE.........SCF-...N...RDFCM....MCKD.NFTCT....M..ASA.....
ENSTGUP00000016679  I..............C...AQLCV.........NSPG...-...SYSC-....----.-----....-..---.....
ENSTGUP00000003906  Dine...........C...VTERH.........TCQ-...R...REHC-....----.-----....-..---.....
ENSTGUP00000002463  E..............D...LPDAL.........TLPP...Sge.RQDCP....PCNP.GFYNN....A..SSS.....
ENSTGUP00000004353  Dvdecavhmdr....C...NRSVA.........DCINt..E...GGYVC....KCLE.GYTGD....G..VHCyd...
ENSTGUP00000003982  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000003906  Dine...........C...TSLPE.........PCK-...P...GFNCI....NTVG.SYTCQ....R..NML.....
ENSTGUP00000012383  P..............C...PSNDG.........QGVA...G...ARNVS....ECGG.NWQCS....P..GHYssdgf
ENSTGUP00000012383  G..............C...DRTCK.........DTA-...-...TGVR-....----.-----....-..---.....
ENSTGUP00000012510  D..............-...MNECL.........NSE-...-...-----....ICSP.NGECLns..Q..GSY.....
ENSTGUP00000008485  N..............Cvd.VNECV.........TNRH...R...CNLHA....ECLN.----T....Q..GSF.....
ENSTGUP00000004172  S..............C...PFG--.........----...-...-----....----.-----....-..---.....
ENSTGUP00000006467  -..............-...-----.........----...-...IGKPD....PCAS.GPCQN....G..GTCfhyig
ENSTGUP00000016677  I..............C...AQLCV.........NSP-...-...-----....---G.S----....-..---.....
ENSTGUP00000001309  F..............I...PNDGT.........NCT-...D...IDECEesg.LCGH.NARCVnt..E..GSY.....
ENSTGUP00000012926  Dvde...........C...ASDSH.........QCN-...P...TQICI....NTEG.GYTC-....-..---.....
ENSTGUP00000004782  -..............D...LDECQ.........TLK-...-...-----....QCQH.ECRNS....P..GSY.....
ENSTGUP00000004439  E..............V...LHGCTdh.......QCQ-...N...NGIC-....--IP.HLKNG....Q..HGF.....
ENSTGUP00000001809  L..............C...PRGDT.........FGPIgatN...ITGCTg...QCPP.GQHSAd...G..FKP.....
ENSTGUP00000009278  Dvne...........C...-----.........--NE...L...NNRMS....LCKN.AKCINt...E..GSY.....
ENSTGUP00000017513  V..............Y...NIICK.........SCGA...G...RGACT....RCGD.N----....-..---.....
ENSTGUP00000004936  P..............Cqc.HG--Nvdlnavg..NCDP...V...SGRCL....RCLY.NTMGD....-..--H.....
ENSTGUP00000005796  R..............C...QHG-E.........PCDP...Q...TGSCL....RCDP.GWM--....G..PSC.....
ENSTGUP00000012223  Dvnecdmygs.....C...SQMCV.........NTD-...G...SYTC-....SCVE.GYVLQpd..N..KSC.....
ENSTGUP00000002463  E..............C...PANTF.........LSIHqvyG...KEACI....PCGP.GSKSTkd..H..SAC.....
ENSTGUP00000012223  Dinecmvfgt.....C...SQHCH.........NLK-...G...SYRC-....ACEK.NYKEK....N..NSC.....
ENSTGUP00000010755  K..............C...SVERR.........LC--...-...-----....----.-----....-..---.....
ENSTGUP00000008559  G..............C...DRTCK.........DTS-...-...TGVHC....SCPV.GFTLQfd..G..KTC.....
ENSTGUP00000012383  T..............C...PGNTS.........TDFD...G...STNVT....HCKN.-----....-..---.....
ENSTGUP00000013638  K..............C...PPNSL.........SNES...G...ATSC-....SCNA.GFYRA....-..---.....
ENSTGUP00000013585  -..............-...-----.........----...-...-----....----.-----....-..--Dapctg
ENSTGUP00000015533  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000004876  V..............C...RPGFF.........KASP...H...SPSCS....KCPPhSYTLD....E..AST.....
ENSTGUP00000007088  -..............-...-----.........KASQ...G...AGLCV....PCPP.NSRSTa...E..ASP.....
ENSTGUP00000012227  H..............C...NGSEE.........SFSApdaS...GSRCV....RCEK.TFIQV....S..KSC.....
ENSTGUP00000007981  K..............C...PPHSY.........SIWE...G...STSC-....TCDR.GFFRA....E..NDAasmpc
ENSTGUP00000011389  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000008033  V..............-...-DNG-.........----...-...-----....----.-----....-..---.....
ENSTGUP00000001337  VvhcpelkppenghfV...QNVCN.........NYF-...N...AACGI....RCKT.GFDLV....G..SSI.....
ENSTGUP00000013896  A..............C...RPGFY.........KAFA...G...NVKCS....KCPP.HSLTHi...E..ATS.....
ENSTGUP00000017687  L..............Ge..GPACA.........SCDQd..N...STRCG....TCNH.GYVLA....Q..GSC.....
ENSTGUP00000003497  -..............-...-----.........----...-...-----....----.-----....-..---.....
ENSTGUP00000012223  Q..............G...DNACR.........VNNG...Gc..STLCL....AIPG.GR---....-..---.....
ENSTGUP00000012933  K..............C...PVGKT.........TNSY...G...AISA-....----.-----....-..DHC.....
ENSTGUP00000007100  Dide...........C...ATGTH.........----...-...-----....----.-----....-..---.....
ENSTGUP00000011594  Kvdp...........C...-----.........----...-...-----....----.-----....-..---.....


                                                                         120         130            
                                                                           |           |            
d1m6ba3               ...................................................VRACP..PDKMEVDKNGL.......KM
ENSTGUP00000000773  ...................................................VSSCP..QYYYGNKDN--.......NV
ENSTGUP00000009269  ...................................................VPECQ..PAMYLSREP--.......RR
ENSTGUP00000000773  ...................................................AIRCE..EGKYHNG----.......RE
ENSTGUP00000001808  ...................................................RTGCK..EEQYLSLM---.......GY
ENSTGUP00000000773  ...................................................VMQCP..RGKFEFK----.......QH
ENSTGUP00000001808  ...................................................LENCG..EGFYQDH----.......NI
ENSTGUP00000000773  ...................................................FKECP..EGSYYEEAT--.......KD
ENSTGUP00000001808  ...................................................VSACG..QGFYGNPQT--.......RE
ENSTGUP00000000773  ...................................................VSLCP..PKYFGNIAS--.......GE
ENSTGUP00000001808  ...................................................NESCA..QQYYLDFST--.......KT
ENSTGUP00000012223  ...................................................LSNCT..ASQF-------.......--
ENSTGUP00000001863  ...................................................VKSCP..AGVLGENDTLVwkyadgnNV
ENSTGUP00000011850  ...................................................VEKCP..DGLQGANSFIFkyaded.RE
ENSTGUP00000007382  ...................................................-----..-----------.......--
ENSTGUP00000001863  ...................................................VRSCN..ADTYEVEENGV.......RK
ENSTGUP00000012383  ...................................................-----..--------K--.......KD
ENSTGUP00000006963  ...................................................RCDCP..PGLVVGVDG--.......RV
ENSTGUP00000010696  ...................................................RCECV..GGYQFAADG--.......RT
ENSTGUP00000004353  ...................................................-----..------QD---.......--
ENSTGUP00000010903  ...................................................-----..-----------.......--
ENSTGUP00000001809  ...................................................QCTCP..AGCKLHWNK--.......KD
ENSTGUP00000011850  ...................................................VRACP..SSKMEVEENGI.......KM
ENSTGUP00000014972  ...................................................YCRCR..SGFTLQPDS--.......KS
ENSTGUP00000000773  ...................................................KHSCR..EVSMSDPDS--.......ED
ENSTGUP00000012926  ...................................................C----..-----------.......--
ENSTGUP00000000998  ...................................................ECICP..PGHELTAEG--.......NT
ENSTGUP00000006963  ...................................................--TCP..VGYELREDQ--.......KM
ENSTGUP00000012362  ...................................................--RCH..PGFILNPDK--.......RT
ENSTGUP00000008559  ...................................................ECLCQ..SNYKLHWNK--.......KD
ENSTGUP00000006963  ...................................................--LCN..EGYELTLDG--.......KN
ENSTGUP00000000998  ...................................................VCICH..NGFKATGEQ--.......TM
ENSTGUP00000000998  ...................................................-----..------EDR--.......RM
ENSTGUP00000001809  ...................................................-----..------DNQ--.......HT
ENSTGUP00000000998  ...................................................RCECL..GGLAIGVDG--.......RV
ENSTGUP00000003792  ...................................................VN---..-----------.......--
ENSTGUP00000012128  ...................................................LEKCP..DGLEANNHT--.......ME
ENSTGUP00000000998  ...................................................QCICN..AGFEITPDG--.......KN
ENSTGUP00000005188  ...................................................YCRCR..SGFTLQPDS--.......KS
ENSTGUP00000006963  ...............................cvqngvlckngrcvntegsfQCICN..AGFELTTNG--.......KN
ENSTGUP00000008033  ...................................................R----..-----------.......--
ENSTGUP00000006963  ...................................................RCDCP..LGHELSPSQ--.......EE
ENSTGUP00000012383  ...................................................-----..-----------.......-T
ENSTGUP00000001808  ...................................................VPSRG..EGYVQDQ----.......LL
ENSTGUP00000012183  ...................................................-----..------D----.......--
ENSTGUP00000001588  ...................................................YVTCP..EGYAAANGT--.......ME
ENSTGUP00000006963  ...................................................HCECS..SGSKLDPTG--.......LI
ENSTGUP00000009278  ...................................................QCICE..RGFSVSADG--.......RT
ENSTGUP00000000449  ...................................................VHECP..SGYIMNSSN--.......LH
ENSTGUP00000006963  ...................................................TCECQ..RGFSLDSTG--.......LN
ENSTGUP00000007100  ...................................................--NCE..D----------.......--
ENSTGUP00000013892  ...................................................ECQCP..EGYMYNSTS--.......KN
ENSTGUP00000006963  ...................................................RCECE..MGFTPASDS--.......KS
ENSTGUP00000013142  .................................................gyQCSCE..PGWTS------.......--
ENSTGUP00000008559  ...................................................-----..-----------.......-T
ENSTGUP00000012223  ...................................................VSTDP..-----------.......--
ENSTGUP00000016176  .................................................ptVSPCP..PTTR-------.......--
ENSTGUP00000013537  ...................................................-----..-----------.......--
ENSTGUP00000000998  ...................................................LCNCP..QDFELNPTG--.......VG
ENSTGUP00000013307  ...................................................YCACP..DDYDGKN----.......--
ENSTGUP00000007218  ...................................................TCTCA..PGYQGAQ----.......--
ENSTGUP00000006963  ...................................................ICHCQ..AGYSVKKGT--.......TG
ENSTGUP00000013140  ...................................................--SCE..PGWT-------.......--
ENSTGUP00000002415  ...................................................-----..-----------.......--
ENSTGUP00000003999  .............................cnlpekvcmkenqdcvntsgsyKCVCS..EGFEDKD----.......GT
ENSTGUP00000011678  ...................................................CRVCG..-----------.......--
ENSTGUP00000008956  ...................................................MAECP..SGFIRNGSQS-.......MF
ENSTGUP00000012362  ...................................................-----..-----------.......--
ENSTGUP00000015313  ...................................................CLECGnvEGQICDLDQGN.......--
ENSTGUP00000009278  ...................................................-----..-----------.......--
ENSTGUP00000010351  ...................................................-----..--QICDLDN--.......--
ENSTGUP00000015843  ...................................................--RCE..EPYLQINE---.......NR
ENSTGUP00000017519  .................................................rfLCVCP..PGFSG------.......--
ENSTGUP00000010098  ...................................................VCECA..RGYGGL-----.......--
ENSTGUP00000006963  .................................................syRCECN..EGFLSSPSG--.......IE
ENSTGUP00000003792  ...................................................LKSCP..AN---------.......--
ENSTGUP00000017519  ...................................................--KCP..PGFQGTN----.......--
ENSTGUP00000007738  ...................................................-----..-----------.......--
ENSTGUP00000007419  ...................................................-CKCP..PGFYTAPDG--.......LK
ENSTGUP00000000998  ...................................................-----..-----------.......--
ENSTGUP00000017519  ...................................................--VCP..PGWT-------.......--
ENSTGUP00000006342  ...................................................--TCP..SGFSG------.......IH
ENSTGUP00000012356  ...................................................CKVCA..-----------.......--
ENSTGUP00000011389  ...................................................-----..-----------.......--
ENSTGUP00000006963  ...................................................-----..-----------.......--
ENSTGUP00000002877  ...................................................GCDDV..DECSANNGGCE.......HT
ENSTGUP00000006342  ...................................................HCECN..SGWT-------.......--
ENSTGUP00000010582  ...................................................-----..-----------.......--
ENSTGUP00000005344  ...................................................-----..-----------.......--
ENSTGUP00000017519  ...................................................RCVCP..EGFHH------.......PH
ENSTGUP00000000773  ...................................................-----..-----------.......--
ENSTGUP00000011389  ...................................................-----..-----------.......--
ENSTGUP00000009572  ...................................................-----..-----------.......--
ENSTGUP00000006342  .................................................efHCECP..TGFNG------.......--
ENSTGUP00000006342  ...................................................--ECR..PGYA-------.......--
ENSTGUP00000012510  ...................................................RCSCY..RGYDVAPDG--.......KS
ENSTGUP00000007392  ...................................................-----..-----------.......--
ENSTGUP00000012362  ...................................................-----..------NDG--.......KT
ENSTGUP00000001337  ...................................................VCKCP..PGFT-------.......--
ENSTGUP00000016176  ...................................................-----..-----------.......--
ENSTGUP00000012943  ...................................................-----..-----------.......--
ENSTGUP00000012578  ...................................................FRGCP..AGFAALEEL--.......ME
ENSTGUP00000002877  ...................................................-----..-----------.......--
ENSTGUP00000004439  ...................................................VCICP..LGYTGTNC---.......--
ENSTGUP00000006342  ...................................................NCICL..KGTTGPN----.......--
ENSTGUP00000015640  ...................................................-----..-----------.......--
ENSTGUP00000001337  ...................................gvpclagefsrtgltpCHPCP..RDYYQPDPGK-.......SY
ENSTGUP00000003906  ...................................................VN---..-----------.......--
ENSTGUP00000006280  ...................................................--NCP..EDYEGKN----.......--
ENSTGUP00000013140  ...............................................pgqfVCICP..PFYTG------.......--
ENSTGUP00000009269  ...................................................VTN--..-----------.......ET
ENSTGUP00000006342  ...................................................--DCD..PGWSGTNC---.......--
ENSTGUP00000012183  ...............................................cetgTHNCP..PDFICQNTPG-.......--
ENSTGUP00000010478  ...................................................-----..-----------.......--
ENSTGUP00000000998  ...................................................--SCP..RGFVSSPDG--.......SR
ENSTGUP00000002105  ...................................................NCVCK..TGYTGK-----.......--
ENSTGUP00000012510  ...................................................RCLCD..RGYESSPSG--.......HH
ENSTGUP00000003906  ...................................................SFECP..SNYRKVSD---.......MR
ENSTGUP00000010696  ...................................................TCRCP..DNTV-------.......--
ENSTGUP00000003792  ...................................................-----..-----------.......--
ENSTGUP00000014137  ...................................................-----..-----------.......--
ENSTGUP00000008560  ...................................................ECVCL..AEYE-------.......--
ENSTGUP00000004653  ...................................................-----..-----CHTN--.......SR
ENSTGUP00000010098  ...................................................-----..-----------.......--
ENSTGUP00000001570  ...................................................TCVCP..QGF--------.......--
ENSTGUP00000006280  ...................................................RCICP..PGR--------.......--
ENSTGUP00000017519  ...................................................KCSCP..PGTRG------.......--
ENSTGUP00000005606  ...................................................TCACP..AGYFLQEDG--.......LR
ENSTGUP00000000755  ...................................................-----..-----------.......--
ENSTGUP00000013140  ...................................................-----..-----------.......--
ENSTGUP00000003982  ..................................clmancqygcdvlkgevRCRCPs.PGLQLGPDG--.......RT
ENSTGUP00000007100  ...................................................VC---..-----------.......--
ENSTGUP00000011980  ...................................................-----..-----------.......--
ENSTGUP00000011110  ...............................................gasyTCVCP..FGFTGSN----.......--
ENSTGUP00000001480  ...................................................CQPCP..YGFYSNG----.......SA
ENSTGUP00000012362  ...................................................CRRCT..E----------.......--
ENSTGUP00000006169  ...................................................HCECR..DGY--------.......--
ENSTGUP00000004439  ...................................................-----..-----------.......--
ENSTGUP00000017519  ...........................................ctnhnggyACVCV..NGWSGDD----.......--
ENSTGUP00000002520  ...................................................CRVCA..-----------.......--
ENSTGUP00000015133  ...................................................IDECS..TGKAVCSYN--.......RR
ENSTGUP00000016380  ..qmahryimvhsqtlrkgitqimykwiepkicredlpdaltlppsgerqdCPPCN..PGFYNNAS---.......SS
ENSTGUP00000007065  ...................................................FGCCP..AGTAAQTGT--.......RE
ENSTGUP00000016679  ...................................................-----..-----------.......--
ENSTGUP00000003906  ...................................................-----..-----------.......--
ENSTGUP00000002463  ...................................................CTPCP..PGTFSDGT---.......QE
ENSTGUP00000004353  ...................................................IDECK..TGSHTCGEN--.......MT
ENSTGUP00000003982  ...................................................-----..-----------.......--
ENSTGUP00000003906  ...................................................--SCS..RGYHSNEEG--.......TR
ENSTGUP00000012383  .................................................kpCTVCP..LGMYQPEPGR-.......TL
ENSTGUP00000012383  ...................................................-CSCP..VGFTLQPDG--.......KT
ENSTGUP00000012510  ...................................................FCICA..PGFSSVAGG--.......VS
ENSTGUP00000008485  ...................................................QCKCK..QGYQGSGFD--.......--
ENSTGUP00000004172  ...................................................-----..-----------.......--
ENSTGUP00000006467  .................................................kyKCDCP..PGYTG------.......--
ENSTGUP00000016677  ...................................................-----..-----------.......--
ENSTGUP00000001309  ...................................................MCYCN..DGYK-------.......--
ENSTGUP00000012926  ...................................................--SCT..EGYW-------.......--
ENSTGUP00000004782  ...................................................RCLCP..TGY--------.......--
ENSTGUP00000004439  ...................................................SCICP..PGYTGI-----.......--
ENSTGUP00000001809  ...................................................CQPCP..RGSYQPEVGR-.......AL
ENSTGUP00000009278  ...................................................KCLCL..PGYVPSDKP--.......NY
ENSTGUP00000017513  ...................................................-----..-----------.......--
ENSTGUP00000004936  ...................................................CERCR..PGFYGDALAPSpa.....GK
ENSTGUP00000005796  ...................................................NNSCP..VGTFGDGCQ--.......FL
ENSTGUP00000012223  ...................................................-----..-----------.......--
ENSTGUP00000002463  ...................................................FSDCL..VSYVKDNQ---.......--
ENSTGUP00000012223  ...................................................-----..-----------.......--
ENSTGUP00000010755  ...................................................-----..-----------.......--
ENSTGUP00000008559  ...................................................-----..-----------.......--
ENSTGUP00000012383  ...................................................-----..-----------.......--
ENSTGUP00000013638  ...................................................-----..------PSEGQ.......--
ENSTGUP00000013585  .............ipsaprdlsyeiigsnvlltwrlpkdlggrkdvffnviCKVCP..AGSV-------.......--
ENSTGUP00000015533  ...................................................-----..-----------.......--
ENSTGUP00000004876  ...................................................SCLCE..EHYFRKES---.......--
ENSTGUP00000007088  ...................................................LCACR..NGYYRADFD--.......--
ENSTGUP00000012227  ...................................................DCN--..-----------.......--
ENSTGUP00000007981  trppsapqhlisnvnetsvnlewsppqnkggredisynvvckrcgagepsrC----..-----------.......--
ENSTGUP00000011389  ...................................................-----..-----------.......--
ENSTGUP00000008033  ...................................................-----..-----------.......--
ENSTGUP00000001337  ...................................................RLCQP..NG---------.......--
ENSTGUP00000013896  ...................................................VCQCE..KGYFR------.......--
ENSTGUP00000017687  ...................................................-----..-----------.......--
ENSTGUP00000003497  ...................................................-----..-----------.......--
ENSTGUP00000012223  ...................................................VCACA..DNQLLEENS--.......TT
ENSTGUP00000012933  ...................................................VTPCQ..G----------.......--
ENSTGUP00000007100  ...................................................-----..-----------.......--
ENSTGUP00000011594  ...................................................-----..-----------.......--


                         140                                                                        
                           |                                                                        
d1m6ba3               CEP.CGGLCP-k..................................................................
ENSTGUP00000000773  CER.CHSSCL-tce................................................................
ENSTGUP00000009269  CET.CPAS---tarc...............................................................
ENSTGUP00000000773  CEP.CHRSCA-tcag...............................................................
ENSTGUP00000001808  CVD.CHPLCQ-qcv................................................................
ENSTGUP00000000773  CHL.CHHTCL-dcsg...............................................................
ENSTGUP00000001808  CKG.CHPSC--rsca...............................................................
ENSTGUP00000000773  CQA.CNRTCQ-tcss...............................................................
ENSTGUP00000001808  C--.-------e..................................................................
ENSTGUP00000000773  CEK.CGHDC--...................................................................
ENSTGUP00000001808  CRE.CDWSC--...................................................................
ENSTGUP00000012223  ---.-------rc.................................................................
ENSTGUP00000001863  CQL.CHPNC--trgckgpglegc.......................................................
ENSTGUP00000011850  CHP.CHPNC--tqgcrgpashdc.......................................................
ENSTGUP00000007382  ---.-------rchiptgesrplsaliqghgtclpase........................................
ENSTGUP00000001863  CKK.CDGLC--skvcng.............................................................
ENSTGUP00000012383  C--.-------vevvkclpn..........................................................
ENSTGUP00000006963  CVD.-------thv................................................................
ENSTGUP00000010696  CV-.-------avehevnhcqrgth.....................................................
ENSTGUP00000004353  ---.-------gkschalds..........................................................
ENSTGUP00000010903  ---.-------rqpagrnrcgdnnggcthlclpsskdytcacptgfrktsshaca.......................
ENSTGUP00000001809  CV-.-------alvkc..............................................................
ENSTGUP00000011850  CKP.CTDIC--p..................................................................
ENSTGUP00000014972  C--.-------ra.................................................................
ENSTGUP00000000773  CIP.CSDGCQ-nc.................................................................
ENSTGUP00000012926  ---.-------sdmdecsfseflc......................................................
ENSTGUP00000000998  CID.-------inec...............................................................
ENSTGUP00000006963  CKD.-------ldecaeglhdc........................................................
ENSTGUP00000012362  C--.-------gk.................................................................
ENSTGUP00000008559  C--.-------ve.................................................................
ENSTGUP00000006963  C--.-------vd.................................................................
ENSTGUP00000000998  CMD.-------idec...............................................................
ENSTGUP00000000998  C--.-------rdldecaeglhdc......................................................
ENSTGUP00000001809  CIQ.-------rpeegmnc...........................................................
ENSTGUP00000000998  CV-.-------dthmr..............................................................
ENSTGUP00000003792  ---.-------ecrq...............................................................
ENSTGUP00000012128  CTS.-------ivhcetsewspwspcmkkgktc.............................................
ENSTGUP00000000998  CVD.-------hdec...............................................................
ENSTGUP00000005188  C--.-------ra.................................................................
ENSTGUP00000006963  CVD.-------hdec...............................................................
ENSTGUP00000008033  ---.-------antsagvasiifsngrdlligdlygrnfrtlvqsqnrgiavgvdfhfylhrifwtdtvqdkvfsini
ENSTGUP00000006963  C--.-------l..................................................................
ENSTGUP00000012383  C--.-------ihrsie.............................................................
ENSTGUP00000001808  CTA.CHESC--sscwg..............................................................
ENSTGUP00000012183  ---.-------idgisced...........................................................
ENSTGUP00000001588  C--.-------s..................................................................
ENSTGUP00000006963  CI-.-------dslkgtc............................................................
ENSTGUP00000009278  CE-.-------dvdec..............................................................
ENSTGUP00000000449  CTP.CAGPC--...................................................................
ENSTGUP00000006963  CED.-------vdecdgn............................................................
ENSTGUP00000007100  ---.-------tdecrtssyic........................................................
ENSTGUP00000013892  CED.-------idec...............................................................
ENSTGUP00000006963  CQD.-------tdec...............................................................
ENSTGUP00000013142  ---.-------srceininec.........................................................
ENSTGUP00000008559  C--.-------ihrseegms..........................................................
ENSTGUP00000012223  ---.-------feafiifsirheirkidlhkrdysllvpglrntialdfhfsqsllywtdvvedkiyrgklsdtggvs
ENSTGUP00000016176  ---.-------vdl................................................................
ENSTGUP00000013537  ---.-------saadvcvpgrhhc......................................................
ENSTGUP00000000998  C--.-------v..................................................................
ENSTGUP00000013307  C--.-------shlkdhck...........................................................
ENSTGUP00000007218  ---.-------cevdinec...........................................................
ENSTGUP00000006963  C--.-------t..................................................................
ENSTGUP00000013140  ---.-------ssrce..............................................................
ENSTGUP00000002415  ---.-------prgeprplrtlmhgqgictd...............................................
ENSTGUP00000003999  C--.-------vq.................................................................
ENSTGUP00000011678  ---.-------aeegeacggagppcgeglqcvlppgavpasatvrkraaagrcqctssepvcgsd.............
ENSTGUP00000008956  CSP.CEGPC--...................................................................
ENSTGUP00000012362  ---.-------sr.................................................................
ENSTGUP00000015313  ---.-------hfygqcgdhlecrldadaarfgevpepqcvcksqeiicgpng.........................
ENSTGUP00000009278  ---.-------ed.................................................................
ENSTGUP00000010351  ---.-------tnhfygkcgehlecrldagdmrhgevpepqcaclshlalcgsdg.......................
ENSTGUP00000015843  C--.-------mc.................................................................
ENSTGUP00000017519  ---.-------avcqididdc.........................................................
ENSTGUP00000010098  ---.-------ncqf...............................................................
ENSTGUP00000006963  C--.-------ld.................................................................
ENSTGUP00000003792  ---.-------dlec...............................................................
ENSTGUP00000017519  ---.-------cesnidec...........................................................
ENSTGUP00000007738  ---.-------ssa................................................................
ENSTGUP00000007419  CID.V------rpgfc..............................................................
ENSTGUP00000000998  ---.-------v..................................................................
ENSTGUP00000017519  ---.-------gaycdvpnvsc........................................................
ENSTGUP00000006342  C--.-------enntpdc............................................................
ENSTGUP00000012356  ---.-------kqagepcneadvcdphkglycdysedepryetgvcayl.............................
ENSTGUP00000011389  ---.-------ghsrwacva..........................................................
ENSTGUP00000006963  ---.-------v..................................................................
ENSTGUP00000002877  CQN.LPGS---fqcgcdighkldgdrrscis...............................................
ENSTGUP00000006342  ---.-------glycdvpsvsc........................................................
ENSTGUP00000010582  ---.-------klsaqvcgsdg........................................................
ENSTGUP00000005344  ---.-------gepcdflhvcdqsqglicdyssasagtagicnfeddeegcevng.......................
ENSTGUP00000017519  CQS.QADGC--l..................................................................
ENSTGUP00000000773  ---.-------...................................................................
ENSTGUP00000011389  ---.-------adgrrcy............................................................
ENSTGUP00000009572  -K-.-------avgkspyliftnrhevrkidlvkrdysriipmlknvvaldvevstnriywcdlfyrkiysayidkas
ENSTGUP00000006342  ---.-------hlcqfdidec.........................................................
ENSTGUP00000006342  ---.-------grrcdtvvdgck.......................................................
ENSTGUP00000012510  CQ-.-------d..................................................................
ENSTGUP00000007392  ---.-------wreearplqalledrglcnna..............................................
ENSTGUP00000012362  C--.-------kr.................................................................
ENSTGUP00000001337  ---.-------gsrcet.............................................................
ENSTGUP00000016176  ---.-------tc.................................................................
ENSTGUP00000012943  ---.-------dfhrglycdysgdrpryeigvcaqivg........................................
ENSTGUP00000012578  CVEgC------evgqwsewgtcsrnnkt..................................................
ENSTGUP00000002877  ---.-------rcyr...............................................................
ENSTGUP00000004439  ---.-------eveidecl...........................................................
ENSTGUP00000006342  ---.-------ceinlddc...........................................................
ENSTGUP00000015640  ---.-------rchkgfdlm..........................................................
ENSTGUP00000001337  CLS.CP-----...................................................................
ENSTGUP00000003906  ---.-------ecdn...............................................................
ENSTGUP00000006280  ---.-------cshlkdhc...........................................................
ENSTGUP00000013140  ---.-------tlceveinecl........................................................
ENSTGUP00000009269  CTK.CT-----dk.................................................................
ENSTGUP00000006342  ---.-------dinnnec............................................................
ENSTGUP00000012183  ---.-------sfrcr..............................................................
ENSTGUP00000010478  ---.-------lscs...............................................................
ENSTGUP00000000998  C--.-------l..................................................................
ENSTGUP00000002105  ---.-------tcdstvnyc..........................................................
ENSTGUP00000012510  CI-.-------d..................................................................
ENSTGUP00000003906  C--.-------erisc..............................................................
ENSTGUP00000010696  ---.-------gvdci..............................................................
ENSTGUP00000003792  ---.-------gdgksc.............................................................
ENSTGUP00000014137  ---.-------clcdvnfagdrce......................................................
ENSTGUP00000008560  ---.-------grhcelykdpcv.......................................................
ENSTGUP00000004653  CVN.LP-----gwyhcecrsgfhdn.....................................................
ENSTGUP00000010098  ---.-------cekkidyc...........................................................
ENSTGUP00000001570  ---.-------sgllcet............................................................
ENSTGUP00000006280  ---.-------sgpgcqe............................................................
ENSTGUP00000017519  ---.-------rfceenvddc.........................................................
ENSTGUP00000005606  C--.-------t..................................................................
ENSTGUP00000000755  ---.-------ghhkglycdfskihrgsgiclah............................................
ENSTGUP00000013140  ---.-------lkcdqdiddc.........................................................
ENSTGUP00000003982  CVD.-------idecatgrvlc........................................................
ENSTGUP00000007100  ---.-------p..................................................................
ENSTGUP00000011980  ---.-------lgelcterdpcdhhkglfcdfgspanrrigvctardgapcvfsg.......................
ENSTGUP00000011110  C--.-------ekkvdrct...........................................................
ENSTGUP00000001480  CLS.CP-----v..................................................................
ENSTGUP00000012362  ---.-------g..................................................................
ENSTGUP00000006169  ---.-------hd.................................................................
ENSTGUP00000004439  ---.-------clcdvnfagdrce......................................................
ENSTGUP00000017519  ---.-------cskniddcf..........................................................
ENSTGUP00000002520  ---.-------aalgetcyrtvsgmdgvkcgpglkcqfyteeddfgdefgick.........................
ENSTGUP00000015133  CVN.-------tfgsfyckcqlgyel....................................................
ENSTGUP00000016380  CTP.CPPG---...................................................................
ENSTGUP00000007065  CQEtC------ep.................................................................
ENSTGUP00000016679  ---.-------ycdgkkgfklskdmknc..................................................
ENSTGUP00000003906  ---.-------vntmgsfrc..........................................................
ENSTGUP00000002463  CKA.CPA----g..................................................................
ENSTGUP00000004353  CTN.TEGN---ftcscadhasgtgvgcks.................................................
ENSTGUP00000003982  ---.-------l..................................................................
ENSTGUP00000003906  CVD.-------vdecqtgvhrc........................................................
ENSTGUP00000012383  CFP.CGG----g..................................................................
ENSTGUP00000012383  C--.-------kd.................................................................
ENSTGUP00000012510  CQD.-------vdec...............................................................
ENSTGUP00000008485  ---.-------ca.................................................................
ENSTGUP00000004172  ---.-------lggfnc.............................................................
ENSTGUP00000006467  ---.-------rhcet..............................................................
ENSTGUP00000016677  ---.-------yscycdgkkgfklskdmknc...............................................
ENSTGUP00000001309  ---.-------le.................................................................
ENSTGUP00000012926  ---.-------l..................................................................
ENSTGUP00000004782  ---.-------r..................................................................
ENSTGUP00000004439  ---.-------hcet...............................................................
ENSTGUP00000001809  CFP.CGGG---lttrheg............................................................
ENSTGUP00000009278  CT-.-------p..................................................................
ENSTGUP00000017513  ---.-------vqf................................................................
ENSTGUP00000004936  CAP.CDC----n..................................................................
ENSTGUP00000005796  CPE.C------v..................................................................
ENSTGUP00000012223  ---.-------ka.................................................................
ENSTGUP00000002463  ---.-------s..................................................................
ENSTGUP00000012223  ---.-------ia.................................................................
ENSTGUP00000010755  ---.-------trcdd..............................................................
ENSTGUP00000008559  ---.-------k..................................................................
ENSTGUP00000012383  ---.-------qhcg...............................................................
ENSTGUP00000013638  ---.-------niactrppsaprnvsfsllgtqlslwwqppsdhggrkdltytvfcqrchflscepce..........
ENSTGUP00000013585  ---.-------gpcvrcgds..........................................................
ENSTGUP00000015533  ---.-------nnktc..............................................................
ENSTGUP00000004876  ---.-------d..................................................................
ENSTGUP00000007088  ---.-------ppaaactsvpsgprnvisivnetsiilewhppretggrddvtynivckkcrsdrracsrcddnvdfv
ENSTGUP00000012227  ---.-------tp.................................................................
ENSTGUP00000007981  ---.-------rscgsgvhfspq.......................................................
ENSTGUP00000011389  ---.-------gcagvcg............................................................
ENSTGUP00000008033  ---.-------trcdtgfftc.........................................................
ENSTGUP00000001337  ---.-------qwsgseatc..........................................................
ENSTGUP00000013896  ---.-------aek................................................................
ENSTGUP00000017687  ---.-------rp.................................................................
ENSTGUP00000003497  ---.-------kp.................................................................
ENSTGUP00000012223  CT-.-------i..................................................................
ENSTGUP00000012933  ---.-------ge.................................................................
ENSTGUP00000007100  ---.-------sc.................................................................
ENSTGUP00000011594  ---.-------avlnpggcninaecvqtgpgehrcvcqagwtgdgrdcs.............................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  dgsdfqevlnisvdtpenlavdwinnklyvvetsvnridmvnldgtnrvtliaenlgnprgialdptvgylffsdwds
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  aievvvqhglatpegltvdwiagniywidsnldqievakldgtlrttliagamehpraialdprygilfwtdwdanfp
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  dtaeqvilidsqlnspeglaidwvhkniywtdsgnktisvatadgsrrrtlfnsdlsepraiavdptqrfmywsdwgd
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  lsgdpkverafmdgtnrqdliktklgwpagitldivskrlywvdsrfdyietvtydglqrrtvahggsliphpygitl
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  riesasmsgaerkiiykdmdtgawpngltvdhfekrivwtdarsdaiysalydgtsmieiirgheylshpfavslygs
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  kariekaglngvgrqvlvtdniewpngitldllnqrlywvdsklhslscidfngsnrkvlissvddlshpfglavfed
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                                                                                    
                                                                                                    
d1m6ba3               ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000007382  ..............................................................................
ENSTGUP00000001863  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000010903  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000011850  ..............................................................................
ENSTGUP00000014972  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000012128  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000005188  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000008033  fehnvyftdwtkmavvkankfsesnpqviyhsslrpygvtvyhaarqpfvrnpcgsnnggceqvcvlshktdndglgy
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000001808  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000001588  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000000449  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000013892  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013142  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012223  evywtdwrtntlakankwtgqnvsviqktsaqpfdlqiyhpsrqpqapnpcsanegrgpcshmclinhnrsaacacph
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000013537  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000013307  ..............................................................................
ENSTGUP00000007218  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000002415  ..............................................................................
ENSTGUP00000003999  ..............................................................................
ENSTGUP00000011678  ..............................................................................
ENSTGUP00000008956  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000015313  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000010351  ..............................................................................
ENSTGUP00000015843  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000007738  ..............................................................................
ENSTGUP00000007419  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012356  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000006963  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000010582  ..............................................................................
ENSTGUP00000005344  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000000773  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000009572  rvfwtdleneaifsanrlngldisilaenlnnphdivvfhelkqpkapdscelspqpnggcdylclpapqisphspky
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000007392  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000016176  ..............................................................................
ENSTGUP00000012943  ..............................................................................
ENSTGUP00000012578  ..............................................................................
ENSTGUP00000002877  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000015640  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000009269  ..............................................................................
ENSTGUP00000006342  ..............................................................................
ENSTGUP00000012183  ..............................................................................
ENSTGUP00000010478  ..............................................................................
ENSTGUP00000000998  ..............................................................................
ENSTGUP00000002105  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000010696  ..............................................................................
ENSTGUP00000003792  ..............................................................................
ENSTGUP00000014137  ..............................................................................
ENSTGUP00000008560  ..............................................................................
ENSTGUP00000004653  ..............................................................................
ENSTGUP00000010098  ..............................................................................
ENSTGUP00000001570  ..............................................................................
ENSTGUP00000006280  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000005606  ..............................................................................
ENSTGUP00000000755  ..............................................................................
ENSTGUP00000013140  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011980  ..............................................................................
ENSTGUP00000011110  ..............................................................................
ENSTGUP00000001480  ..............................................................................
ENSTGUP00000012362  ..............................................................................
ENSTGUP00000006169  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000017519  ..............................................................................
ENSTGUP00000002520  ..............................................................................
ENSTGUP00000015133  ..............................................................................
ENSTGUP00000016380  ..............................................................................
ENSTGUP00000007065  ..............................................................................
ENSTGUP00000016679  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000004353  ..............................................................................
ENSTGUP00000003982  ..............................................................................
ENSTGUP00000003906  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000012510  ..............................................................................
ENSTGUP00000008485  ..............................................................................
ENSTGUP00000004172  ..............................................................................
ENSTGUP00000006467  ..............................................................................
ENSTGUP00000016677  ..............................................................................
ENSTGUP00000001309  ..............................................................................
ENSTGUP00000012926  ..............................................................................
ENSTGUP00000004782  ..............................................................................
ENSTGUP00000004439  ..............................................................................
ENSTGUP00000001809  ..............................................................................
ENSTGUP00000009278  ..............................................................................
ENSTGUP00000017513  ..............................................................................
ENSTGUP00000004936  ..............................................................................
ENSTGUP00000005796  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000002463  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000010755  ..............................................................................
ENSTGUP00000008559  ..............................................................................
ENSTGUP00000012383  ..............................................................................
ENSTGUP00000013638  ..............................................................................
ENSTGUP00000013585  ..............................................................................
ENSTGUP00000015533  ..............................................................................
ENSTGUP00000004876  ..............................................................................
ENSTGUP00000007088  ..............................................................................
ENSTGUP00000012227  ..............................................................................
ENSTGUP00000007981  ..............................................................................
ENSTGUP00000011389  ..............................................................................
ENSTGUP00000008033  ..............................................................................
ENSTGUP00000001337  ..............................................................................
ENSTGUP00000013896  ..............................................................................
ENSTGUP00000017687  ..............................................................................
ENSTGUP00000003497  ..............................................................................
ENSTGUP00000012223  ..............................................................................
ENSTGUP00000012933  ..............................................................................
ENSTGUP00000007100  ..............................................................................
ENSTGUP00000011594  ..............................................................................


                                         
                                         
d1m6ba3               ...................
ENSTGUP00000000773  ...................
ENSTGUP00000009269  ...................
ENSTGUP00000000773  ...................
ENSTGUP00000001808  ...................
ENSTGUP00000000773  ...................
ENSTGUP00000001808  ...................
ENSTGUP00000000773  ...................
ENSTGUP00000001808  ...................
ENSTGUP00000000773  ...................
ENSTGUP00000001808  ...................
ENSTGUP00000012223  ...................
ENSTGUP00000001863  ...................
ENSTGUP00000011850  ...................
ENSTGUP00000007382  ...................
ENSTGUP00000001863  ...................
ENSTGUP00000012383  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000010696  ...................
ENSTGUP00000004353  ...................
ENSTGUP00000010903  ...................
ENSTGUP00000001809  ...................
ENSTGUP00000011850  ...................
ENSTGUP00000014972  ...................
ENSTGUP00000000773  ...................
ENSTGUP00000012926  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000012362  ...................
ENSTGUP00000008559  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000001809  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000003792  ...................
ENSTGUP00000012128  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000005188  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000008033  rcrcilgfdlhvdgrhcva
ENSTGUP00000006963  ...................
ENSTGUP00000012383  ...................
ENSTGUP00000001808  ...................
ENSTGUP00000012183  ...................
ENSTGUP00000001588  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000009278  ...................
ENSTGUP00000000449  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000007100  ...................
ENSTGUP00000013892  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000013142  ...................
ENSTGUP00000008559  ...................
ENSTGUP00000012223  lmklssdkktcy.......
ENSTGUP00000016176  ...................
ENSTGUP00000013537  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000013307  ...................
ENSTGUP00000007218  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000013140  ...................
ENSTGUP00000002415  ...................
ENSTGUP00000003999  ...................
ENSTGUP00000011678  ...................
ENSTGUP00000008956  ...................
ENSTGUP00000012362  ...................
ENSTGUP00000015313  ...................
ENSTGUP00000009278  ...................
ENSTGUP00000010351  ...................
ENSTGUP00000015843  ...................
ENSTGUP00000017519  ...................
ENSTGUP00000010098  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000003792  ...................
ENSTGUP00000017519  ...................
ENSTGUP00000007738  ...................
ENSTGUP00000007419  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000017519  ...................
ENSTGUP00000006342  ...................
ENSTGUP00000012356  ...................
ENSTGUP00000011389  ...................
ENSTGUP00000006963  ...................
ENSTGUP00000002877  ...................
ENSTGUP00000006342  ...................
ENSTGUP00000010582  ...................
ENSTGUP00000005344  ...................
ENSTGUP00000017519  ...................
ENSTGUP00000000773  ...................
ENSTGUP00000011389  ...................
ENSTGUP00000009572  tcacpdnmwlgpdmkkcyk
ENSTGUP00000006342  ...................
ENSTGUP00000006342  ...................
ENSTGUP00000012510  ...................
ENSTGUP00000007392  ...................
ENSTGUP00000012362  ...................
ENSTGUP00000001337  ...................
ENSTGUP00000016176  ...................
ENSTGUP00000012943  ...................
ENSTGUP00000012578  ...................
ENSTGUP00000002877  ...................
ENSTGUP00000004439  ...................
ENSTGUP00000006342  ...................
ENSTGUP00000015640  ...................
ENSTGUP00000001337  ...................
ENSTGUP00000003906  ...................
ENSTGUP00000006280  ...................
ENSTGUP00000013140  ...................
ENSTGUP00000009269  ...................
ENSTGUP00000006342  ...................
ENSTGUP00000012183  ...................
ENSTGUP00000010478  ...................
ENSTGUP00000000998  ...................
ENSTGUP00000002105  ...................
ENSTGUP00000012510  ...................
ENSTGUP00000003906  ...................
ENSTGUP00000010696  ...................
ENSTGUP00000003792  ...................
ENSTGUP00000014137  ...................
ENSTGUP00000008560  ...................
ENSTGUP00000004653  ...................
ENSTGUP00000010098  ...................
ENSTGUP00000001570  ...................
ENSTGUP00000006280  ...................
ENSTGUP00000017519  ...................
ENSTGUP00000005606  ...................
ENSTGUP00000000755  ...................
ENSTGUP00000013140  ...................
ENSTGUP00000003982  ...................
ENSTGUP00000007100  ...................
ENSTGUP00000011980  ...................
ENSTGUP00000011110  ...................
ENSTGUP00000001480  ...................
ENSTGUP00000012362  ...................
ENSTGUP00000006169  ...................
ENSTGUP00000004439  ...................
ENSTGUP00000017519  ...................
ENSTGUP00000002520  ...................
ENSTGUP00000015133  ...................
ENSTGUP00000016380  ...................
ENSTGUP00000007065  ...................
ENSTGUP00000016679  ...................
ENSTGUP00000003906  ...................
ENSTGUP00000002463  ...................
ENSTGUP00000004353  ...................
ENSTGUP00000003982  ...................
ENSTGUP00000003906  ...................
ENSTGUP00000012383  ...................
ENSTGUP00000012383  ...................
ENSTGUP00000012510  ...................
ENSTGUP00000008485  ...................
ENSTGUP00000004172  ...................
ENSTGUP00000006467  ...................
ENSTGUP00000016677  ...................
ENSTGUP00000001309  ...................
ENSTGUP00000012926  ...................
ENSTGUP00000004782  ...................
ENSTGUP00000004439  ...................
ENSTGUP00000001809  ...................
ENSTGUP00000009278  ...................
ENSTGUP00000017513  ...................
ENSTGUP00000004936  ...................
ENSTGUP00000005796  ...................
ENSTGUP00000012223  ...................
ENSTGUP00000002463  ...................
ENSTGUP00000012223  ...................
ENSTGUP00000010755  ...................
ENSTGUP00000008559  ...................
ENSTGUP00000012383  ...................
ENSTGUP00000013638  ...................
ENSTGUP00000013585  ...................
ENSTGUP00000015533  ...................
ENSTGUP00000004876  ...................
ENSTGUP00000007088  ...................
ENSTGUP00000012227  ...................
ENSTGUP00000007981  ...................
ENSTGUP00000011389  ...................
ENSTGUP00000008033  ...................
ENSTGUP00000001337  ...................
ENSTGUP00000013896  ...................
ENSTGUP00000017687  ...................
ENSTGUP00000003497  ...................
ENSTGUP00000012223  ...................
ENSTGUP00000012933  ...................
ENSTGUP00000007100  ...................
ENSTGUP00000011594  ...................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048103 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Chaetomium globosum CBS 148.51
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Candida albicans SC5314
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Glycine max v109 - Soybean
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
No