SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

Complement control module/SCR domain alignments

These alignments are sequences aligned to the 0049458 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                        10        20               30        40     
                                                         |         |                |         |     
d1ss2a_                .............eaefvricsksy------------LTLENGKVFLTG.....G..DLPALDGARVEFRCDPD...
hFl_ENSPANP00000010118 pctlsftemeknnlllkwdfdnrph------------------------.....-..---ILHGEYVEFICRGD...
hFl_ENSPANP00000007596 ........................i-------SCGDPGIPANGLRYGDD.....-..---YVVGQNVSYMCQPG...
hFl_ENSPANP00000016499 ....ckvpvkratvvyqgervkiqe-----------------------K.....F..KNGMLHGDKVSFFCKNK...
hFl_ENSPANP00000010016 ...pcviseenmnknniqlrwrnne------------------------.....-..KLYVKTGDTVEFQCKFL...
hFl_ENSPANP00000000866 ...pcviseenmnknniqlrwrnne------------------------.....-..KLYVKTGDTVEFQCKFL...
hFl_ENSPANP00000004497 .........................-------HCGSPDPIVNGHISGDG.....-..---FSYRDTVVYQCNPG...
hFl_ENSPANP00000006883 .........................-------SCGTPPEPFNGMVHINT.....-..--DTQFGSTVNYSCNEG...
hFl_ENSPANP00000017959 .........................------ITCPPPPVIYNGAHTGSS.....-..LEDFPYGTTVTYTCNPGper
hFl_ENSPANP00000018995 .........................------VRCGEPPGIMNGYASGSN.....-..---YSFGAMVAYSCNKG...
hFl_ENSPANP00000007596 .........................-------HCGTPELIVNGQVIGEN.....-..---YGYRDTVVYQCNPG...
hFl_ENSPANP00000006978 ....cviapeimekynitfkwaakq------------------------.....-..KLYSRTGEPVEFVCRSG...
hFl_ENSPANP00000004497 .........................------ITCGHPGNPAHGFTNGSE.....-..---FNLNDVVNFTCNTG...
hFl_ENSPANP00000007596 .........................------VSCGHPGSPIYGRTSGNG.....-..---FNFNDVVTFSCNIG...
hFl_ENSPANP00000004522 .........................-------HCGTPEPIVNGHINGEN.....-..---YSYRGSVVYQCNAG...
hFl_ENSPANP00000007596 ........................v-------NCSDPGIPANSKRESKI.....E..HGNFTYGTVVFYDCNPG...
hFl_ENSPANP00000018995 .........................------VDCGSPPVLANGQVRGDE.....-..---YTFQKEIEYTCNEG...
hFl_ENSPANP00000010166 ..pciiteenmnknniqlkgksdrn------------------------.....-..-YYAKTGDTIEFMCKLG...
hFl_ENSPANP00000018995 .........................------VSCGKPESPEHGFVIGSK.....-..---YTFESTIIYQCEPG...
hFl_ENSPANP00000007596 .........................------VQCGNPGTTANGKVFRID.....-..--GTAFPSSVIYSCMEG...
hFl_ENSPANP00000018995 ........................v-------FCGEPPAIKDAVITGSN.....-..---FTFKNTVTYTCKEG...
hFl_ENSPANP00000009778 .........................-------SCPNPGEIPNGQIDISN.....-..--GILFGAAISFSCNTG...
hFl_ENSPANP00000007596 .........................-------TCGDPGTPGHGSRQESD.....-..---FRTKSTVRFACDTG...
hFl_ENSPANP00000004497 ........................f--------CGDPGTPAHGSRLGDE.....-..---FKTKSLLRFSCEMG...
hFl_ENSPANP00000018995 ........................i-------SCKKPNPIMNGSIKGSN.....-..---YTYLSMLYYECDPG...
hFl_ENSPANP00000018995 ........................i-------KCKAPGNPENGYSSGDI.....-..---YTVGAEVTFSCQEG...
hFl_ENSPANP00000018995 ........................v-------LCTPPPLISFGVPVPSS.....-..--ALHFGSTVKYSCVGG...
hFl_ENSPANP00000006883 ........................i-------SCGLPPTIDNGDFFSAN.....-..KEYFHYGSVVTYHCNLGsgg
hFl_ENSPANP00000006883 .........................-------SCRNPRDPVNGMVHVIK.....-..--DIQFGSQINYSCTEG...
hFl_ENSPANP00000007596 .........................------VTCPTPPQISNGRLEGTN.....-..---FDWGFSVSYICSPG...
hFl_ENSPANP00000018995 .........................------VSCGKPAIPENGCIEELA.....-..---FTFGSKVTYRCNKG...
hFl_ENSPANP00000004497 ........................v-------LCPQPPPVQNGTVEGTD.....-..---FHWGSSISYSCVDG...
hFl_ENSPANP00000004522 .........................------ITCGHPGNPVNGITQGNQ.....-..---FNLNDVVKFVCNPG...
hFl_ENSPANP00000004522 ........................i-------SCGELPVPPNGHRIGTL.....-..---SVYGATAIFSCNSG...
hFl_ENSPANP00000016445 .........................------VSCGWLAPPPNGQKEGNR.....-..---YLAGSTIYFHCDNG...
hFl_ENSPANP00000016446 .........................------VSCGWLAPPPNGQKEGNR.....-..---YLAGSTIYFHCDNG...
hFl_ENSPANP00000007596 ........................i-------SCGELPTPPNGNKIGTQ.....-..---TSYGSTAIFTCDLG...
hFl_ENSPANP00000009779 .........................-------MCPHIQDPVNGEAILVN.....-..-GSYEFGSELHFICNEG...
hFl_ENSPANP00000018995 .........................------ISCGVPPPLENGFHSADD.....-..---FYAGSTVTYQCNNG...
hFl_ENSPANP00000011325 .........................FPICKSRDCDPPGNPAHGYFKGDN.....-..---FTLGSTISYYCKDR...
hFl_ENSPANP00000016499 ........................v--------CPFAGILENGAVRYTT.....-..---FEYPNTINFSCNTG...
hFl_ENSPANP00000018995 ........................v-------RCATPPQLANGVMEGLD.....-..---YGFMKEVAFHCHEG...
hFl_ENSPANP00000018995 .........................--------CGKPPPIQNGFMKGEI.....-..---FEVGSKVQFFCNEG...
hFl_ENSPANP00000018995 .......................hs------------------------.....-..-SNFLYGTMVSYTCNPG...
hFl_ENSPANP00000018995 ........................i-------HCDSPQPIENGFVEGAD.....-..---YSYGAMIIYSCFPG...
hFl_ENSPANP00000017959 ........................i-------HCHPPPVIVNGKHTGMM.....-..AENFLYGNEVSYECDQG...
hFl_ENSPANP00000014866 .........................------VSCPALNAPADGRKFGSK.....-..---YLVDHEVHFACNPG...
hFl_ENSPANP00000009778 ........................i-------YCPAPPQIDNGIIQGER.....-..-EHYGYRQSITYLCNRG...
hFl_ENSPANP00000017959 ........................e--------CQAPPNILNGQKEDRH.....-..MVRFNPGTSIKYSCNPG...
hFl_ENSPANP00000004497 .........................------VSCGNPGTPTNGMIVSSD.....-..--GILFSSSVIYACWEG...
hFl_ENSPANP00000009779 .........................---CKVVKCRFP-VVENGKQISGF.....-..GKKFYYKATVMFECDKG...
hFl_ENSPANP00000008669 .........................-------RCSNPGDLPNGHVEIKT.....-..--DLLFGSEIEFSCSEG...
hFl_ENSPANP00000004497 ........................v-------NCSDPGFVENAIRHGQQn....F..PESFEYGMSVLYHCKKG...
hFl_ENSPANP00000004497 .........................------ISCGDPGTLANGIQFGTD.....-..---FTFNQTVSYQCNPG...
hFl_ENSPANP00000018995 ........................v-------ECPQPEEIANGIIDVQG.....-..---LAYLSTALYTCKPG...
hFl_ENSPANP00000006883 ........................i-------SCKPPPTISNGDFYSNN.....-..RTSFHSGTVVTYQCHTGpdg
hFl_ENSPANP00000018995 ........................i-------ECPKPKEILNGNFSYTN.....-..---LHYGQTVTYSCNRG...
hFl_ENSPANP00000017959 ........................e--------CPALPMIHNGHHTSEN.....-..VSSIAPGLSVTYSCESG...
hFl_ENSPANP00000003595 .........................-------KCEPPPDIRNGKHSGGD.....-..REFYTYASSVTYTCNPY...
hFl_ENSPANP00000008669 ........................v-------KCEPPPDIRNGRHSGEE.....-..-DFYTYGFSVTYSCDSR...
hFl_ENSPANP00000007596 .........................-------SCPDPRPFRNGFVIGND.....-..---FTVGQTISFECFPG...
hFl_ENSPANP00000017959 .........................------VQCPRPQILRGRIVSGQK.....-..-DRYTYNDTVIFACMFG...
hFl_ENSPANP00000005863 .........................--------CPPLKIPERGNMTCLH.....S..AKAFQHQSSCGFSCEEG...
hFl_ENSPANP00000007596 ........................i-------SCGIPKAPTNGGILTTD.....-..---YLVGTRVTYFCNDG...
hFl_ENSPANP00000018995 .........................--------CGPPAHVENAIARGVH.....-..---YQYGDMITYSCYSG...
hFl_ENSPANP00000007596 ........................f--------CGDPGIPAQGKREGKS.....-..---FIYQSEVSFSCNSP...
hFl_ENSPANP00000006883 .........................--------CPHPPKIQNGHYIGGH.....-..VSLYLPGMTISYICDPG...
hFl_ENSPANP00000018995 ........................v-------KCSSPENINNGKYVLSG.....-..---LTYLSTASYSCDTG...
hFl_ENSPANP00000007596 .........................-------SCENPGVPRHGSQNNTF.....-..--GFQVGSVVQFHCKKG...
hFl_ENSPANP00000017959 .........................--------CQPPPKTPNGNHTGGN.....-..IARFSPGMSILYSCDQG...
hFl_ENSPANP00000019885 .........................--------CPELPEIPNGWKSPSQ.....-..-PELVHGTVVTYQCYPG...
hFl_ENSPANP00000011736 .........................--------CDAVTNPANGFVECFQ.....N..PGSFPWNTTCTFDCEEG...
hFl_ENSPANP00000018995 ........................i-------DCDLPIAPENGFLRFTE.....-..---SSMGSAVQYSCKPG...
hFl_ENSPANP00000006883 .........................--------CQPPPEILHGEHTPSH.....-..QDKFSPGQEVFYSCEPG...
hFl_ENSPANP00000007596 .........................LPECIMIDCGHPGVPPNAVLSGEK.....-..---YTFGSTVHYSCTGK...
hFl_ENSPANP00000004497 .........................-------TCPDPGTPHFGIQNSSR.....-..--GYEVGSTVFFRCRKG...
hFl_ENSPANP00000005863 .........................-PTCEAIKCPELFAPEQGSLDCSD.....T..HRGFNVGSTCHFSCNKG...
hFl_ENSPANP00000005863 .........................-PVCKAVQCQHLEAPSEGTMDCIH.....P..LAAFAYGSNCKFECQLG...
hFl_ENSPANP00000005863 .........................--------CGELELPQHVLMNCSH.....P..LGNFSFNSQCSFHCADG...
hFl_ENSPANP00000006883 .........................--------CQPPPEILHGEHTPSH.....-..QDKFSPGQEVFYSCEPG...
hFl_ENSPANP00000018995 .........................-------RCETPLEFLNGKADIEN.....-..---TTTGPNVVYSCNRG...
hFl_ENSPANP00000006883 ........................i-------FCPNPPAILNGRHTGTP.....-..LGDIPYGEEISYTCDPHpdr
hFl_ENSPANP00000005863 .........................-PECQAIPCTPLLSPQNGTMTCVQ.....P..LGSSSYKSTCHFNCDEG...
hFl_ENSPANP00000018995 ........................n--------CGPPEDLAHGFPNGFS.....-..---FIHGGHIQYQCFPG...
hFl_ENSPANP00000004497 .........................------VSCGIPESPGNGSFTGNE.....-..---FTLDSKVVYECHEG...
hFl_ENSPANP00000008129 .........................-PTCQVIQCEPLSAPDLGIMNCSH.....P..LASFSFSSACTFSCSEG...
hFl_ENSPANP00000006258 .........................--YCRQMRCHALPFITSGTYTCTN.....-..--GVLLDSRCDYSCSSG...
hFl_ENSPANP00000012036 .........................--------CGPPDDLPSGRVEYIT.....G..PEVTTYKAVIQYSCEET...
hFl_ENSPANP00000008216 .........................--------CSDLPEIQNGWKTTSH.....-..-TELVRGARITYQCDPG...
hFl_ENSPANP00000003595 ........................r--------CRNP-ELINGIVEVKK.....-..--DLLLGSTIEFSCSEG...
hFl_ENSPANP00000004522 .........................--------CPDPEPFANGIVRGAG.....-..---YNVGQSVTFECLPG...
hFl_ENSPANP00000014207 .........................-------SCGFPPRPAHGDVSVTD.....-..---LHPGGTATFHCDSG...
hFl_ENSPANP00000011736 .........................-------QCTALSNPEHGYMNCLP.....Sa.SGSFRNGSSCEFSCEQG...
hFl_ENSPANP00000018995 .........................------VSCGEPPKIENGFLENTT.....-..--GRIFESEVRYQCNPG...
hFl_ENSPANP00000007596 .........................-------YCSTPESPPHGYIISQT.....-..--GGQLNSVVRWACDRG...
hFl_ENSPANP00000004497 .........................-------TCNDPGMPQNGTRYGDS.....-..---REAGDTITFQCDPG...
hFl_ENSPANP00000006978 ........................v-------KCLPVKPPENGKIISGAme...P..DREYYFGQVVRFACNSG...
hFl_ENSPANP00000017959 ........................v-------QCSHV-HVANGYKISGK.....-..EPPYFYNDTVTFKCFNG...
hFl_ENSPANP00000008857 ........................e--------CPELQPPVHGKIEPSQ.....-..-AKYSFKDQVLISCDTG...
hFl_ENSPANP00000011736 .........................--------CTALESPEHGSLVCSH.....P..LGNFSYSSSCSVSCDRG...
hFl_ENSPANP00000006883 ........................i-------FCPNPPAILNGRHTGAL.....-..LGDIPYGKEISYTCDPHpdr
hFl_ENSPANP00000005863 .........................-PVCQALQCQDLPVPNEAQVNCSH.....P..FGAFRYQSVCSFTCNED...
hFl_ENSPANP00000005863 .........................LPTCEAISCEPLESPVHGSMDCSP.....S..LRTFQYDTNCSFRCAEG...
hFl_ENSPANP00000004497 ........................v-------FCGDPGIPAEGRLSGKS.....-..---FTYKSEVFFQCKSP...
hFl_ENSPANP00000004522 .........................-------TCGNPGRLPNGIQQGST.....-..---FNLGDKVRYSCNPG...
hFl_ENSPANP00000001032 .........................-------RCGKLNAPENGYMKCSS.....-..-DGDNYGATCEFSCIGG...
hFl_ENSPANP00000001032 .........................--ICKQKRCPTLAMPANGGFKCVD.....-..--GAYFNSRCEYYCSPG...
hFl_ENSPANP00000007596 .........................-------SCPEPQTPSSGIKIGDR.....-..---YMVGDVVSFQCDQG...
hFl_ENSPANP00000004497 .........................--------CHDPGIPINGRRFGDR.....-..---FLLGSSVSFHCDDG...
hFl_ENSPANP00000004497 ........................v-------KCEDPGIPNYGYRIRDE.....-..--GHFTDTVVLYSCNPG...
hFl_ENSPANP00000007596 ........................a--------CRDPGVPMNGTRNGDG.....-..---REPGDTVVFQCDPG...
hFl_ENSPANP00000012036 .........................--------CPYPMAPPNGHVSPVQ.....-..-AKYILKDSFSIFCEPG...
hFl_ENSPANP00000011736 .........................-PTCKAVTCRAIRQPQNGSVRCSHs....P..AGEFTFKSSCSFTCEEG...
hFl_ENSPANP00000004522 .........................-------SCPEPAVPSNGVKTGER.....-..---YLVNDVVSFQCEPG...
hFl_ENSPANP00000006258 .........................-------RCPTLKPPQHGYLTCTS.....-..-AGDNYGATCEYHCDGG...
hFl_ENSPANP00000010166 .........................--------CGPPPPISNGDTKSFP.....-..QKVYLPQSTVEYQCQSY...
hFl_ENSPANP00000004497 .........................--------CGDPGIPAYGKRMGSS.....-..---FLHGDTLTFECPAA...
hFl_ENSPANP00000006679 .........................--------CGIPESIENGKVEDPE.....-..--STLFGSVTRYTCEEP...
hFl_ENSPANP00000012347 ........................e---CRAIRCPRPQDFENGEYRPRS.....-..-PYYNVSDEISFHCYDG...
hFl_ENSPANP00000004497 .........................LPKCLAISCGHPGVPANAILTGEL.....-..---FTYGATVRYSCRGS...
hFl_ENSPANP00000004522 .........................-------SCGLPEAPKNGLVFGKE.....-..---YTVGTKAVYSCSEG...
hFl_ENSPANP00000011736 ........................v-------RCDAVHQPQRGLVRCAHs....P..IGEFTYKSSCAFSCEEG...
hFl_ENSPANP00000005863 .........................--------CPALTTPGQGTMHCRH.....H..PGTFGFNTTCYFGCNAG...
hFl_ENSPANP00000004497 .........................-------SCGSLSFPPNGNKIGTL.....-..---TVYGATAIFTCNTG...
hFl_ENSPANP00000006883 ........................t-----------PPNVENGILVSVN.....-..RSLFSLNEVVEFRCQPG...
hFl_ENSPANP00000006978 .........................-------KCGPPPPIDNGDITSFP.....-..LSLYAPDSSVEYKCQKL...
hFl_ENSPANP00000012346 .........................---CKPVRCPAPVSFENGIYTPRL.....-..-GSYPVGGNVSFECEDG...
hFl_ENSPANP00000007596 .........................-------SCFDPGNIMNGTRLGMD.....-..---YKLGSTVTYYCDAG...
hFl_ENSPANP00000018983 ........................i-------DCGTPPEVPNGYIIGNY.....-..--TSRLGSQVRYACREG...
hFl_ENSPANP00000018995 .........................--------CGSLPLIPNAFISESS.....-..---SWKENVITYSCRSG...
hFl_ENSPANP00000017959 .........................------ISCGSPPPILNGRISDYS.....-..-TPITLGTVIRYICSNG...
hFl_ENSPANP00000004497 .........................--------CFDPGNIMNGTRIGTD.....-..---FKLGSTITYQCDSG...
hFl_ENSPANP00000006626 .........................--------CSDPGGPVNGYKKITGgpgliN..GRHAKIGTVVSFFCNNS...
hFl_ENSPANP00000011325 .........................-------HCPDP-VLVNGEFSTSG.....-..--PVNVSDKITFKCNDH...
hFl_ENSPANP00000001070 .........................--------CLRPLAATNGYVNISE.....F..QTSFPVGTVISYRCFPG...
hFl_ENSPANP00000004497 ........................y--------CSLTHPLKNGGILNRT.....-..--AGAVGSKVHYFCKPG...
hFl_ENSPANP00000010118 ........................r------VACEEPPFIENGTANLHS.....-..-KIYYNGDKVTYACKSG...
hFl_ENSPANP00000004497 .........................-------SCLDPGIPVNGHRHGSD.....-..---FGIRSTVTFSCDPG...
hFl_ENSPANP00000016499 .........................--------CPFPLRPDNGFVNYPA.....-..KPVLYYKDKATFGCHDG...
hFl_ENSPANP00000008669 .........................--------CHFPPKIAHGHYKQAS.....-..-VYTFFKEEIIYECDKG...
hFl_ENSPANP00000007596 .........................-------QCSSVPEPRFGRRIGNE.....-..---FAVGSLVLFECNPG...
hFl_ENSPANP00000004522 ........................i-------KCEDPGTPQFGYKVHDE.....-..--GHFAGSSVSFSCDPG...
hFl_ENSPANP00000004522 .........................-------SCFDPGSIKNGTRVGSD.....-..---LKLGSSVTYYCHAG...
hFl_ENSPANP00000004522 .........................-------YCSLPRAPLHGFILGQT.....-..--STQPGGSIHFGCNAG...
hFl_ENSPANP00000014207 .........................-------TCPELPPPEWGWRTASH.....-..-GDLIRGTVLTYQCEPG...
hFl_ENSPANP00000004497 ........................n--------CPDPPPFQNGYMINSD.....-..---YSVGQSISFECYPG...
hFl_ENSPANP00000003595 .........................-PICEKIVCRRPQIPKAIFVSGFG.....-..-PLYTYKDSIVVNCEEG...
hFl_ENSPANP00000006883 ........................k--------CTAP-EVKNGIRVPGN.....-..RSFFSLNEIVRFRCQPG...
hFl_ENSPANP00000004522 .........................-------HCLDPGIPVNGQRHGND.....-..---FYVGALVTFSCDSG...
hFl_ENSPANP00000004497 .........................-------QCSSVPEPRYGRRIGSE.....-..---FSAGSIVRFECNPG...
hFl_ENSPANP00000004522 .........................-------SCNDPGIPQNGSRSGDS.....-..---WEAGDSTVFQCDPG...
hFl_ENSPANP00000005863 .........................-PTCRAVKCPELHVNKPIVMNCSN.....L..WGNFSYGSICSFHCLEG...
hFl_ENSPANP00000006978 .........................--------CGPPPPIDNGDTTSFP.....-..LSLYAPDSSVEYQCQNL...
hFl_ENSPANP00000014207 ........................m-------TCADPGEIANGHRTASD.....-..-AGFPVGSHVQYRCLPG...
hFl_ENSPANP00000017817 ........................v-------LCGPPPAVENASLIGTR.....-..KAKYNVHATVRYQCNEG...
hFl_ENSPANP00000010768 ........................v-------LCGPPPAVENASLIGTR.....-..KAKYNVHATVRYQCNEG...
hFl_ENSPANP00000017959 .........................-PHCKEVNCSSP-ADMDGIQKGLE.....P..RKMYQYGAVVTLECEDG...
hFl_ENSPANP00000008669 .........................---CEKITCHKP-DVSGEIVSGFG.....-..-PIYNYRDAIVFKCQKG...
hFl_ENSPANP00000008216 ........................m-------YCTDPGEVDHSTRLISD.....-..-PVLLVGTTIQYTCNPG...
hFl_ENSPANP00000006883 .........................---CKEVNCSFP-QFMNGISKELE.....M..KKVYHYGDYVTLECEDG...
hFl_ENSPANP00000006883 ...................lgqlhh-----------------GRVLVPF.....-..--NLQLGAKVSFVCDEG...
hFl_ENSPANP00000006978 ........................k------IPCSQPPQIEHGTINSSR.....Ss.QESYAHGTKLSYTCEYG...
hFl_ENSPANP00000010166 .........................--------CGPPPPISNGDTKSFP.....-..QKVYLPQSTVEYQCQSY...
hFl_ENSPANP00000011736 .........................---CQVVKCSSLAVLEKINMSCSG.....-..--EPVFGTVCNFACPEG...
hFl_ENSPANP00000012347 .........................-------YCSNPGIPIGTRKVGSR.....-..---YRLEDSVTYHCSRG...
hFl_ENSPANP00000009779 .........................-PLCEKILCTPPPKIKNGRHTFSE.....-..VEVFEYLDAVTYSCDPApgp
hFl_ENSPANP00000008216 ........................a--------CDNPGLPENGYQILYK.....-..-RLYLPGESLTFMCYEG...
hFl_ENSPANP00000018995 .........................-------KCPEPPLLENQLVLKEL.....-..---TTEVGVVTFSCKEG...
hFl_ENSPANP00000007596 .........................-------HCEDPGIPQFGYKISDQ.....-..--GHFAGSTIIYGCNPG...
hFl_ENSPANP00000008669 ........................l--------CLKP-ELVNGRLSVDK.....-..-NQYVEPETVTIQCDSG...
hFl_ENSPANP00000010016 .........................-------SCGPPPQLSNGEVKEIR.....-..KEEYGHNEVVEYYCNRN...
hFl_ENSPANP00000000866 .........................-------SCGPPPQLSNGEVKEIR.....-..KEEYGHNEVVEYYCNRN...
hFl_ENSPANP00000016499 .........................------ITCPPPSVPMFATLRVYK.....PsaGNNSFYQDTAVFECLPQ...
hFl_ENSPANP00000006978 .........................--------CGPPPPIDNGDTTSFP.....-..LSLYAPDSSVEYQCQNL...
hFl_ENSPANP00000019885 ........................t-------SCHDPGDVEHSRRLISS.....-..-PKFPVGATVQYICDQG...
hFl_ENSPANP00000007596 .........................-------SCKQPETPAHANVVGMD.....-..--LPSHGYTLIYTCQPG...
hFl_ENSPANP00000019850 .........................------ITCPPPVSVEHADIRVKS.....-..---YSLYSRERYICNSG...
hFl_ENSPANP00000012346 .........................-------HCPNPGISLGAVRTGSR.....-..---FGHGDKVRYRCSSN...
hFl_ENSPANP00000004522 .........................LPTCRIINCTDPGHQENSVRQVHAs....G..PHRFSFGTTVSYQCNHG...
hFl_ENSPANP00000004497 ........................a--------CQEPALPSNSIKIGDR.....-..---YMVNDVLSFQCEPG...
hFl_ENSPANP00000006978 ........................v------RSCGPPPELLNGNVKEKT.....-..KEEYRHSEVVEYYCNPR...
hFl_ENSPANP00000018995 .........................--------CSTP-VIEYGTVNGTD.....-..---FDCGKAARIQCFKG...
hFl_ENSPANP00000006978 .........................-PTCRDTSCVDPPTVKNAHLVSRQ.....-..MSQYASGERVRYECRSP...
hFl_ENSPANP00000004522 .........................-------KCPPPTILPNAEVVTEN.....-..-EEFNIGDIVRYRCLPG...
hFl_ENSPANP00000006883 ....................gqlph-----------------GRVLFPL.....-..--NLQLGAKVSFVCDEG...
hFl_ENSPANP00000010016 .........................--------CGPPPSINNGDITSFP.....-..LSVYPPWSTVTYRCQSF...
hFl_ENSPANP00000000866 .........................--------CGPPPSINNGDITSFP.....-..LSVYPPWSTVTYRCQSF...
hFl_ENSPANP00000018995 ........................c---------SDCPRLGGSVPHLRT.....A..SEDLKPGSKISLFCDPG...
hFl_ENSPANP00000007596 ........................l---------------EHGRWRIVN.....-..GSHYEYKTKVVFSCDPG...
hFl_ENSPANP00000003595 .........................---CEPALCLKP-EIVNGRLSVDK.....-..-DQYVEPENVTIECDSG...
hFl_ENSPANP00000009778 .........................--------CGPPPAVPNAQPALKG.....-..LTSFPENTIITYRCDEN...
hFl_ENSPANP00000004522 .........................-------QCSSVPEPRYGKRLGSD.....-..---FSVGAIVRFECNSG...
hFl_ENSPANP00000010118 .........................-------RCPPPPLPINSKIQTHS.....-..-TTYRHGEIVHIECELN...
hFl_ENSPANP00000008129 .........................--------CEPLEPPKLGTMDCTH.....P..LGDFSFSSQCAFNCSEG...
hFl_ENSPANP00000018995 ........................a------VSCDEPPNVDHASPETAH.....-..---RLFGDIAFYYCSDG...
hFl_ENSPANP00000006978 .........................--------CGHPGDTPFGYFSLIG.....-..GNVFEYGVKAVYTCNEG...
hFl_ENSPANP00000004522 .........................--------CPDPGVPVNGKRFGDS.....-..---LQLGSSISFLCDEG...
hFl_ENSPANP00000006978 .........................-PQCEGLPCKSPPEISHGVVAHTS.....-..-DSYQYGEEVTYKCSEG...
hFl_ENSPANP00000006978 ........................s-------TCGDIPELEHGYSELSS.....-..-PPYYYGDSVEFNCSES...
hFl_ENSPANP00000004497 .........................--------CDDPGVPAFSRRIGFH.....-..---FGVGDSLTFSCFPG...
hFl_ENSPANP00000014207 .........................--------CLNPGVPENGYQTLYK.....-..-HHYQAGESLRFFCYEG...
hFl_ENSPANP00000019885 .........................-------SCHFPHRPAYGDVTVTS.....-..---LHPGGSARFHCATG...
hFl_ENSPANP00000010118 ........................n--------CKHPPVVMNGAVADGL.....-..LASYAAGSSVEYRCNEY...
hFl_ENSPANP00000014934 ........................k--------CPQPKTLDEFTVIQ-N.....L..QPQYQFRDYFIATCKLG...
hFl_ENSPANP00000017959 ........................t-------SCPNP-EVKHGYKLNKT.....-..LSAYSHDDIVYVDCHPG...
hFl_ENSPANP00000010186 ........................f--------CPSPPALKDGFVQDEG.....-..-TTFPVGKNVVYTCNEG...
hFl_ENSPANP00000018995 .........................-------SCGPPPSVANAVATGEA.....-..---HTYESKVKLRCLEG...
hFl_ENSPANP00000014410 ........................v-------ACGEPPVVQHARTFGQK.....-..KDRYEINSLVRYQCTEG...
hFl_ENSPANP00000018995 .........................--------CPVPFVIPENALLSEK.....-..--EFYVDQNVSIKCREG...
hFl_ENSPANP00000004522 .........................--------CEEPEVPAYSIRKGLQ.....-..---FGVGDTLTFSCFPG...
hFl_ENSPANP00000006978 .........................-PSCIKTDCLSLPSFENAKPMGEK.....-..KDSYKSGEQVTYTCATN...
hFl_ENSPANP00000012271 .........................------VDCGPPEEVKHATLRFNG.....-..---TQLGAVALYACDRG...
hFl_ENSPANP00000010962 .........................------VDCGPPEEVKHATLRFNG.....-..---TQLGAVALYACDRG...
hFl_ENSPANP00000004497 .........................-------KCQPPPAVPQAEMLTED.....-..-DDFEIGDFVKYQCHPG...
hFl_ENSPANP00000004522 ................ehgrwrlif------------------------.....-..ETQYQFQAQLMLICDPG...
hFl_ENSPANP00000019852 .........................-------HCREPPPWENEATERIY.....-..--HFVVGQTVYYQCVQG...
hFl_ENSPANP00000019853 .........................-------HCREPPPWENEATERIY.....-..--HFVVGQTVYYQCVQG...
hFl_ENSPANP00000017959 .......................ys-------TCPEP-IVPGGYKTRGS.....-..VPPYRHGDFVTFACKTN...
hFl_ENSPANP00000009778 ........................s--------CGAPTRLKFASLKQLYi....P..QSYFPVGTVVEYECRPG...
hFl_ENSPANP00000015805 ........................i-------KCPQPKTLDEFTVIQN-.....L..QPQYQFRDYFIATCKLG...
hFl_ENSPANP00000003595 .........................--------CGPPPKLPFASPINPL.....Y..DTEFKTGTTLKYTCHPG...
hFl_ENSPANP00000010118 ........................g-------MCTSPPLIKHGDIISSI.....-..VDTYENGSSVEYRCFDH...
hFl_ENSPANP00000006679 .....................epak------------------------.....-..-AKYVFRDVVRITCLDG...
hFl_ENSPANP00000019885 ........................k-------PCHGLSAPENGARSPEK.....-..-RLHPAGATIHFSCAPG...
hFl_ENSPANP00000008216 .........................-------SCNFPRRPDSGDVTVMD.....-..---LHSGGVAHFHCHLG...
hFl_ENSPANP00000017951 .........................--------CGIPESIENGKVEDPE.....-..--STLFGSVTRCTCEEP...
hFl_ENSPANP00000007596 ........................v--------CQPPPPVPNAEMLTED.....-..-DEFEIGDIIRYQCLPG...
hFl_ENSPANP00000004497 ........................a--------CRQPETPAHADVRAID.....-..--LPTFGYTLVYTCHPG...
hFl_ENSPANP00000016499 .........................-------TCPKPDDLPFSIVVPLK.....-..-TFYQPGEEITYSCKPG...
hFl_ENSPANP00000004686 ........................v-------ACGQPPVVENAKTFGKM.....-..KPRYEINSLIRYHCKDG...
hFl_ENSPANP00000011618 .........................--------CPQPVPPENGFIRNEK.....-..-KLYSVGEDVEISCLTG...
hFl_ENSPANP00000010016 ........................v------KTCGYIPELQYGYVQQSV.....-..-PPYQHGVSVEVNCRNE...
hFl_ENSPANP00000000866 ........................v------KTCGYIPELQYGYVQQSV.....-..-PPYQHGVSVEVNCRNE...
hFl_ENSPANP00000017951 .....................epak------------------------.....-..-AKYVFRDVVRITCLDG...
hFl_ENSPANP00000017959 .........................--TCEEARCKPLGRFPNGKVKEPP.....-..--ILQVGVTANFFCDEG...
hFl_ENSPANP00000011325 .........................-------HCPELPPVNNSIFIAKE.....-..---VEGQILGTYVCIKG...
hFl_ENSPANP00000018983 ........................i-------NCGNPPEMRHAILVGNH.....-..--SSRLGGVARYVCQEG...
hFl_ENSPANP00000002642 ........................v-------ACGQPPVVENAKTFGKM.....-..KPRYEINSLIRYHCKDG...
hFl_ENSPANP00000010016 ........................q-------FCPPPPQIPNAQNMTTT.....-..-VNYQDGEKVAVLCKEN...
hFl_ENSPANP00000000866 ........................q-------FCPPPPQIPNAQNMTTT.....-..-VNYQDGEKVAVLCKEN...
hFl_ENSPANP00000018995 .........................--------CPLPENITHILVHGDD.....-..---FSVNRQVSVSCAEG...
hFl_ENSPANP00000019418 .........................-------TCAQLRLPPQATFQVLR.....-..GDGASVGTVLMFHCPSN...
hFl_ENSPANP00000017169 ........................v--------CPLPPEPENGGYICHPrp...C..RDPLTAGSVIEYLCAEG...
hFl_ENSPANP00000010953 .........................------VSCGPPPELPLAQVFGRP.....-..RLRYEVDTVLRYRCREG...
hFl_ENSPANP00000018943 .........................---CVPVTCDPPPPKFHGLYQCTN.....-..--GFQFNSECRIKCEDS...
hFl_ENSPANP00000003595 .....................ftgr------------------------.....-..-CVYAYGDNISYMCDEG...
hFl_ENSPANP00000008669 .........................--------CDPPPTLSFAAPVNIT.....TltETHFETGTTLKYTCRPG...
hFl_ENSPANP00000001070 ........................q-------VCPLPPMVSHGDFVCHPr....P..CERYNHGTVVEFYCDPG...
hFl_ENSPANP00000018995 .........................--------CEKPPSVSYSILESVS.....-..KAKFAAGSVVSFKCLEG...
hFl_ENSPANP00000004354 .........................--------CPKPPMIANGYVE---.....-..-------HLVRYQCKNY...
hFl_ENSPANP00000006883 .........................-------QCNAPEQLPFARPTELI.....D..EPEFSIGTHLKYECRPG...
hFl_ENSPANP00000012790 .........................-------KCGFPESVENGDFVHCE.....-..---ESGRRVLVYSCRHG...
hFl_ENSPANP00000006978 ........................q-------LCPPPPQIPNSRNMTTT.....-..-LNYQDGEKVSLLCQEN...
hFl_ENSPANP00000008216 .........................--------CYEP-YIQNGNFTTSD.....-..-PTYNIGTIVEFTCDPG...
hFl_ENSPANP00000001032 ......................ykt------------------------.....-..----ALGTRCDIRCQKG...
hFl_ENSPANP00000010166 .........................--------------IENGFISESS.....-..-SIYILNKEMQYKCKPG...
hFl_ENSPANP00000010166 ........................v---------------ENGFISESS.....-..-SIYILNKEMQYKCKPG...
hFl_ENSPANP00000006978 ........................s--------CDMP-VFKNARAKNNI.....-..-TWFKLNDTLDYECHDG...
hFl_ENSPANP00000010016 ........................e--------CHVPILEANVDAKPEK.....-..-ESYKVGDVLKFSCRKN...
hFl_ENSPANP00000000866 ........................e--------CHVPILEANVDAKPEK.....-..-ESYKVGDVLKFSCRKN...
hFl_ENSPANP00000004497 ......................gsl------------------------.....-..---NEYGAQVLLSCSPG...
hFl_ENSPANP00000013892 .....................ksyl-------------TLENGKVFLTG.....G..DLPALDGARVDFRCDPD...
hFl_ENSPANP00000008669 .........................--------CTNLPDIPHASWETYPrpk..K..EDVYVVGTILRYRCHPG...
hFl_ENSPANP00000003595 ......................sdh------------------------.....-..-EIFEIGTELKYLCKPG...
hFl_ENSPANP00000006978 .........................---CEEKTCNVP-HIPNGVYSPLR.....-..-IKHRTGDEIRYQCING...
hFl_ENSPANP00000019852 .....................lcdd----------DPPKITHATFKAVA.....-..---YKEGTMLNCECKRG...
hFl_ENSPANP00000019853 .....................lcdd----------DPPKITHATFKAVA.....-..---YKEGTMLNCECKRG...
hFl_ENSPANP00000018943 .........................--------CLAPPPVPNADLQTPR.....Cr.ENKHKVGSFCKYKCKPG...
hFl_ENSPANP00000001070 ........................v--------CADPGVPENGFRTPSA.....-..-GVFFEGSVTRFHCQDG...
hFl_ENSPANP00000006978 ......................yla----------------NGYNENNG.....-..-RKFVQGNTVEVACHPG...
hFl_ENSPANP00000006978 .........................LPVCYERECELPKIDVHLVPDPKK.....-..-DQYKVGEVLKFSCKLG...
hFl_ENSPANP00000006883 .........................--------CKTPEQFPFASPTIPI.....N..DFEFPVGTSLNYECHPG...
hFl_ENSPANP00000009779 .........................--------CEAPPTFEAMELIGKP.....-..KPYYKVGERVDYKCKKG...
hFl_ENSPANP00000018943 ........................d--------CSIP-DHHHVYAASFS.....C..PDGTTFGSQCSFQCRHP...
hFl_ENSPANP00000010186 .........................---CQKIACVLP-VLMDGIQSHPQ.....-..KPFYTVGEKVTVSCSGG...
hFl_ENSPANP00000006978 ........................s--------CKSP-DVIHGSPISQK.....-..-IIYKENERFQYKCNMG...
hFl_ENSPANP00000001070 .........................---CVQEECRIP-QIEDAEIHNKT.....-..---YRYGEKLIITCHEG...
hFl_ENSPANP00000006978 .........................--------CYFP-YLENGHNENNG.....-..-RKFVQGNFIEVACHPG...
hFl_ENSPANP00000006258 ......................nyh------------------------.....-..---SSLGTRCELSCDRG...
hFl_ENSPANP00000006978 ........................i---------------KNGFISESQ.....-..-YTYALNKQAKYQCKLG...
hFl_ENSPANP00000010016 ........................r-------MCSFP-FVKNGHSESSG.....-..-QIHLEGDTVQIVCNAG...
hFl_ENSPANP00000000866 ........................r-------MCSFP-FVKNGHSESSG.....-..-QIHLEGDTVQIVCNAG...
hFl_ENSPANP00000010118 ........................k-------KCTKP-DLSNGYISDVK.....-..-LLYKIQENMHYGCASG...
hFl_ENSPANP00000017959 ........................v------------------------.....-..----------NTSCQDG...
hFl_ENSPANP00000014207 .........................--------CFAP-FLAHGNVTTTD.....-..-PEYRPGALATFSCLPG...
hFl_ENSPANP00000011618 .........................---CQRTECIKPVVQEILTITPFQ.....-..-RLYRIGESIELTCPKG...
hFl_ENSPANP00000006978 ........................r-------KCYFP-YLENGYNENNG.....-..-RKFVQGNSIEVACHPG...
hFl_ENSPANP00000002841 ........................p--------CGDPPSFPHTILQGRT.....-..--GLEMGDELLYVCAPG...
hFl_ENSPANP00000006978 ................prknteilt---------------------GSW.....P..DHTYPEGTEAIYKCRPG...
hFl_ENSPANP00000017959 ......................irp------------------------.....-..--------HVNSSCDEG...
hFl_ENSPANP00000010166 ........................f--------CDTP-VLENSRAKSNG.....-..-MWFKLHDTLDYECYDG...
hFl_ENSPANP00000010166 ........................l--------CDTP-VFENSRAKSNG.....-..-MWFKLHDTLDYECYDG...
hFl_ENSPANP00000018943 .........................--------CPEL-AVENASLNCSS.....-..-SDRYHGAQCTVSCRTG...
hFl_ENSPANP00000008669 .......................hc------------------------.....-..--VYFYGDEISFSCHGI...
hFl_ENSPANP00000012347 ..................ikggsfr------------------------.....-..--LLQEGQALEYVCPSG...
hFl_ENSPANP00000010016 .....................pfaq------------------------.....-..---VPIGEVFYYSCEYN...
hFl_ENSPANP00000000866 .....................pfaq------------------------.....-..---VPIGEVFYYSCEYN...
hFl_ENSPANP00000012346 .........................--------CPQNVNISGGTFTLSH.....-..--GWAPGSLLIYSCPQG...
hFl_ENSPANP00000017959 .........................------------------------.....-..----------------N...
hFl_ENSPANP00000010166 ........................p--------CNFPEIQHGGLYYESKrr...P..YFPVAAGKSYSYYCDAN...

                                                        50                    60                    
                                                         |                     |                    
d1ss2a_                ...FHLV.............GS...S........RSVCS.....QG.....QWS..TP.....KPHCQ--vn.....
hFl_ENSPANP00000010118 ...TYPA.............--...-........-----.....--.....---..--.....-------elyitgs
hFl_ENSPANP00000007596 ...YTMEln...........GS...R........IRTCTi....NG.....TWS..GV.....MPTCRA-vtcptpp
hFl_ENSPANP00000016499 ...EKKCs............YT...E........DAQCI.....DG.....T--..--.....-------ievpkcf
hFl_ENSPANP00000010016 ...YKAKiss..........PS...F........RAICQ.....EG.....KF-..-E.....YPICE--rs.....
hFl_ENSPANP00000000866 ...YKAKiss..........PS...F........RAICQ.....EG.....KF-..-E.....YPICE--rs.....
hFl_ENSPANP00000004497 ...FRLV.............GT...S........VRICLq....DH.....KWS..GQ.....TPVCVP-itcghpg
hFl_ENSPANP00000006883 ...FRLI.............GS...P........STTCLv....SGnnv..TWD..KE.....APICEI-isckppp
hFl_ENSPANP00000017959 eveFSLI.............GE...S........TIRCTs....NDqerg.TWS..GP.....APLCE--.......
hFl_ENSPANP00000018995 ...FYIK.............GE...K........KSTCEa....TG.....QWS..SP.....IPTCHP-vscgepp
hFl_ENSPANP00000007596 ...FRLI.............GS...S........VRICQq....DH.....NWS..GQ.....LPSCVP-vscghpg
hFl_ENSPANP00000006978 ...YHLSpns..........HA...L........RTTCQ.....DG.....KL-..-E.....YPTCV--kr.....
hFl_ENSPANP00000004497 ...YLLQ.............GA...S........RAQCRs....NG.....QWS..SP.....LPTCRV-vncsdpg
hFl_ENSPANP00000007596 ...YLMQ.............GP...T........KAQCQa....NR.....QWS..HP.....PPVCKV-vncsdpg
hFl_ENSPANP00000004522 ...FRLI.............GM...S........VRICQq....DH.....HWS..GK.....TPFCVP-itcghpg
hFl_ENSPANP00000007596 ...YFLF.............GS...S........VLICQp....NG.....QWD..KP.....LPECIM-idcghpg
hFl_ENSPANP00000018995 ...FLLE.............GA...R........SQVCLa....NG.....SWS..GA.....TPDCVP-vrcatpp
hFl_ENSPANP00000010166 ...YNAN.............TSilsF........QAVCW.....EG.....---..--.....-------ileyprc
hFl_ENSPANP00000018995 ...YELE.............GN...R........ERVCQe....NR.....QWS..GG.....VAICK--etrcetp
hFl_ENSPANP00000007596 ...YILS.............GP...S........VRQCTa....NG.....TWS..GT.....LPNCTI-iscgdpg
hFl_ENSPANP00000018995 ...YTLA.............GP...D........TIECLa....NG.....KWS..RS.....DQQCLA-vscdepp
hFl_ENSPANP00000009778 ...YKLF.............GP...T........SSLCLa....SDsgv..QWS..DT.....LPECRE-iycpapp
hFl_ENSPANP00000007596 ...YILH.............GS...E........ERKCLa....NG.....SWT..GR.....QPECKA-vqcgnpg
hFl_ENSPANP00000004497 ...HQLR.............GS...P........ERTCLl....NG.....SWS..GL.....QPVCEA-vscgnpg
hFl_ENSPANP00000018995 ...YVLN.............GT...E........RRICQd....DK.....NWD..ED.....EPICIP-vdcgspp
hFl_ENSPANP00000018995 ...YQLM.............GV...T........KITCLe....SG.....EWN..HL.....IPYCKA-vscgkpa
hFl_ENSPANP00000018995 ...FFLR.............GN...S........TTFCQp....DG.....TWS..SP.....LPECVP-vecpqpe
hFl_ENSPANP00000006883 rklFELV.............GE...P........SIYCTs....NEdqvg.IWS..GP.....APQC---.......
hFl_ENSPANP00000006883 ...HRLI.............GS...S........SATCIi....SGntv..IWD..NE.....TPICEK-iscglpp
hFl_ENSPANP00000007596 ...YELS.............FP...A........VLTCVg....NG.....TWS..GE.....VPQCL--pkfcgdp
hFl_ENSPANP00000018995 ...YTLA.............GD...K........ESSCLa....NG.....SWS..HS.....SPVCEP-vkcsspe
hFl_ENSPANP00000004497 ...YQLS.............HS...A........ILSCEg....RG.....VWK..GE.....VPQCLP-vfcgdpg
hFl_ENSPANP00000004522 ...YMAE.............GA...A........RSQCLa....SG.....QWS..DM.....LPTCRI-inctdpg
hFl_ENSPANP00000004522 ...YTLV.............GS...R........VRECMa....NG.....LWS..GS.....EVRCL--aghcgtp
hFl_ENSPANP00000016445 ...YSLA.............GA...E........TSTCQa....DG.....TWS..SP.....TPECQ--p......
hFl_ENSPANP00000016446 ...YSLA.............GA...E........TSTCQa....DG.....TWS..SP.....TPECQ--p......
hFl_ENSPANP00000007596 ...FMLV.............GS...A........VRECLs....SG.....LWS..GS.....ETRCL--aghcgtp
hFl_ENSPANP00000009779 ...YYLI.............GK...D........ILYCEl....KDtva..IWS..GK.....PPLCEK-ilctppp
hFl_ENSPANP00000018995 ...YYLL.............GD...S........RMFCTd....NG.....SWN..GV.....SPSCLD-v......
hFl_ENSPANP00000011325 ...YYLV.............GM...Q........EQQCI.....DG.....EWS..SA.....LPVCK--l......
hFl_ENSPANP00000016499 ...FYLN.............GA...N........SAKCTe....EG.....QWS..PG.....IPVCAP-itcppps
hFl_ENSPANP00000018995 ...YMLH.............GA...S........KLTCQs....DG.....NWD..AE.....VPLCKP-vncgppe
hFl_ENSPANP00000018995 ...YELV.............GD...S........SWTCQk....SG.....KWD..KKl....NPKCV--pakcpep
hFl_ENSPANP00000018995 ...YELL.............GN...P........VLICQe....DG.....TWN..GS.....APSCIS-idcdlpi
hFl_ENSPANP00000018995 ...FQVA.............GH...A........MQTCE.....ES.....GWS..SS.....IPTCVP-idcglpp
hFl_ENSPANP00000017959 ...FYLL.............GE...K........KLQCRsdskgHG.....SWS..GP.....SPQC---.......
hFl_ENSPANP00000014866 ...FRLV.............GP...S........SVVCLp....NG.....TWT..GE.....QPRCRD-isecssq
hFl_ENSPANP00000009778 ...FTMI.............GE...H........SIYCTvndd.EG.....EWS..GP.....PPAC---r......
hFl_ENSPANP00000017959 ...YVLV.............GE...E........SIQCTs....EG.....VWT..PP.....VPQCK--vavce..
hFl_ENSPANP00000004497 ...YKTS.............GL...M........TRHCTa....NG.....TWT..GT.....APDCTI-iscgdpg
hFl_ENSPANP00000009779 ...YYLN.............GS...D........KIVCEs....NS.....TWD..PP.....VPKCLK-vl.....
hFl_ENSPANP00000008669 ...FVLI.............GS...T........SSHCEv....QDrgv..GWS..HP.....LPQCEI-vkceppp
hFl_ENSPANP00000004497 ...FYLL.............GS...S........ALTCMa....NG.....LWD..RS.....LPKCLA-iscghpg
hFl_ENSPANP00000004497 ...YLMEpv...........TS...A........TIRCTk....DG.....TWN..QS.....KPVCK--e......
hFl_ENSPANP00000018995 ...FELV.............GN...T........TTLCGe....NG.....HWL..GG.....KPTCKP-iecpkpk
hFl_ENSPANP00000006883 eqlFELV.............GE...R........SIYCTsk...DDqvg..AWS..SP.....PPRC---.......
hFl_ENSPANP00000018995 ...FQLE.............GP...S........ALTCLe....TG.....DWD..VD.....APSCNA-ihcdsp.
hFl_ENSPANP00000017959 ...YLLV.............GE...K........IINCLs....SG.....KWS..AV.....PPTCE--earckpl
hFl_ENSPANP00000003595 ...FSLI.............GN...A........SISCTve...NKtig..VWS..PN.....PPICEK-ivcrrpq
hFl_ENSPANP00000008669 ...FSLL.............GH...A........SISCTvenktTG.....VWR..PS.....PPTCE--k......
hFl_ENSPANP00000007596 ...YTLI.............GN...S........ALTCLhgv..SR.....NWN..HP.....LPRCEA-lcggnit
hFl_ENSPANP00000017959 ...FTLK.............GS...K........QIRCNa....KG.....TWE..PS.....APVCE--kecqapp
hFl_ENSPANP00000005863 ...FALV.............GP...E........VVQCTa....SG.....VWT..AP.....APVCKA-vqcqhle
hFl_ENSPANP00000007596 ...YRLSsk...........EL...T........TAVCQs....DG.....TWS..NHnk...TPRCVV-vtcpsi.
hFl_ENSPANP00000018995 ...YMLE.............GS...L........RSVCLe....NG.....TWT..-S.....PPICRA-vcrfp..
hFl_ENSPANP00000007596 ...FILV.............GS...S........TRICQa....DG.....TWS..GS.....SPHCI--e......
hFl_ENSPANP00000006883 ...YLLV.............GK...G........IIFCTd....QG.....IWS..QL.....DHYCKE-vncsfpq
hFl_ENSPANP00000018995 ...YSLQ.............GP...S........IIECMa....SG.....IWD..RA.....PPACHL-vfcgepp
hFl_ENSPANP00000007596 ...HLLQ.............GS...T........TRTCLp....DL.....TWS..GI.....QPECI--phsckqp
hFl_ENSPANP00000017959 ...YLLV.............GE...A........LLLCTh....EG.....TWN..RP.....APHCKE-vncssp.
hFl_ENSPANP00000019885 ...YQVV.............GS...S........VLMCQw....DL.....TWS..ED.....LPSCQR-vtschdp
hFl_ENSPANP00000011736 ...FELM.............GA...Q........SLQCTs....SG.....NWD..NE.....KPTCKA-vtcrai.
hFl_ENSPANP00000018995 ...HILV.............GS...D........LRLCLq....NR.....EWS..GA.....SPRCEA-isckk..
hFl_ENSPANP00000006883 ...YDLR.............GA...A........SLHCTp....QG.....DWS..PE.....APICT--vkscd..
hFl_ENSPANP00000007596 ...RSLL.............GQ...S........SRTCQl....NG.....HWS..GS.....QPHC---.......
hFl_ENSPANP00000004497 ...YHIQ.............GS...T........TRTCLa....NL.....TWS..GI.....QTECI--phacrqp
hFl_ENSPANP00000005863 ...FKLE.............GP...N........NVKCTt....SG.....RWS..AT.....PPACK--.......
hFl_ENSPANP00000005863 ...YRVR.............GL...D........TLRCIg....SG.....HWS..AP.....LPTCE--a......
hFl_ENSPANP00000005863 ...YQVN.............GP...S........KLECLa....SG.....IWT..HK.....PPQCL--aaqcppl
hFl_ENSPANP00000006883 ...YDLR.............GA...A........SLHCTp....QG.....DWS..PE.....APRCA--vkscd..
hFl_ENSPANP00000018995 ...YSLE.............GL...S........EAHCTe....NG.....TWS..HP.....VPLCK--pnpcpvp
hFl_ENSPANP00000006883 gmtFDLI.............GE...S........TIRCTsdlqgNG.....VWS..SP.....APRCE--.......
hFl_ENSPANP00000005863 ...FSLS.............GP...E........RLDCTr....SG.....RWT..DS.....PPTCE--a......
hFl_ENSPANP00000018995 ...YKLH.............GN...S........SRRCLs....NG.....SWS..GS.....SPSCL--pcrcstp
hFl_ENSPANP00000004497 ...FKLEps...........QQ...A........TAVCQe....DG.....LWS..NKgk...LPTCKP-vpcpsie
hFl_ENSPANP00000008129 ...TELI.............GE...K........KTICEs....SG.....IWS..NP.....NPICQ--k......
hFl_ENSPANP00000006258 ...YHLE.............GD...R........SRICMe....DG.....RWS..GG.....EPVCV--d......
hFl_ENSPANP00000012036 ...FYTMkv...........ND...G........KYVCEa....DG.....FWT..SSkgersPPVCEP-vcgl...
hFl_ENSPANP00000008216 ...YDIV.............GS...D........TLTCQw....DL.....SWS..SD.....PPFCEK-imyctdp
hFl_ENSPANP00000003595 ...FFLI.............GS...T........TSRCQi....QGkgv..DWS..DP.....LPECV--iakcepp
hFl_ENSPANP00000004522 ...YQLT.............GH...P........VLTCQhgt..NR.....NWD..HP.....LPKCE--vpcggni
hFl_ENSPANP00000014207 ...YQLQ.............GE...E........TLICL.....NGtrp..SWN..GE.....TPSCM--ascgg..
hFl_ENSPANP00000011736 ...FVLK.............GS...K........RLQCGp....TG.....EWD..NE.....KPTCEA-vrcdavh
hFl_ENSPANP00000018995 ...YKSI.............GS...P........VFVCQa....NR.....HWH..SE.....SP-----lmcipld
hFl_ENSPANP00000007596 ...FRLV.............GK...S........SAVCRk....SSygyh.AWD..AP.....VPACQA-iscgipk
hFl_ENSPANP00000004497 ...YQLQ.............GQ...A........KITCVql...NNrf...FWQ..PD.....PPTCI--va.....
hFl_ENSPANP00000006978 ...YKIE.............GD...N........EMHCSe....DG.....VWS..KE.....KPKCVE-isckspd
hFl_ENSPANP00000017959 ...FTLK.............GS...S........QIRCKa....NN.....TWD..PE.....IPVCE--ketcqpv
hFl_ENSPANP00000008857 ...YKVLkdnvem.......DT...F........QIECLk....DG.....TWS..NK.....IPTCKI-vdcrap.
hFl_ENSPANP00000011736 ...YLPS.............SV...E........TTQCMs....SG.....EWS..AP.....VPACKV-vecdav.
hFl_ENSPANP00000006883 gmtFNLI.............GE...S........TIRCTsdlqgNG.....VWS..SP.....APRCE--.......
hFl_ENSPANP00000005863 ...LLLV.............GA...S........VLQCLa....TG.....NWN..SV.....PPECQ--a......
hFl_ENSPANP00000005863 ...FMLR.............GA...D........IVRCDn....LG.....QWT..AP.....APVCQ--a......
hFl_ENSPANP00000004497 ...FILV.............GS...S........RRICQa....DG.....MWS..GI.....QPACI--d......
hFl_ENSPANP00000004522 ...FFLE.............GH...A........VLTCH.....AGsensaTWD..FP.....LPSCR--ad.....
hFl_ENSPANP00000001032 ...YELQ.............GS...P........ARVCQs....NL.....AWS..GT.....EPTCA--a......
hFl_ENSPANP00000001032 ...YTLK.............GE...R........TVTCMd....NK.....AWS..GR.....PASC---v......
hFl_ENSPANP00000007596 ...YSLQ.............GH...S........HITCM.....PGpvr..RWN..YP.....IPICL--aqcgg..
hFl_ENSPANP00000004497 ...FVKTq............GS...E........SITCIlq...DGnv...VWS..ST.....VPRCE--apcgghl
hFl_ENSPANP00000004497 ...YAMH.............GS...N........TLTCL.....SGdrr..VWD..KP.....LPSCI--aecggqi
hFl_ENSPANP00000007596 ...YELQ.............GE...E........RITCIqven.RY.....FWQ..PS.....PPVCI--apcggn.
hFl_ENSPANP00000012036 ...YELLqghlpl.......KS...F........AAVCQk....DG.....SWD..QP.....MPSCS--ivdcgpp
hFl_ENSPANP00000011736 ...FMLQ.............GA...A........QVECTt....QG.....QWT..QQ.....VPVCE--.......
hFl_ENSPANP00000004522 ...YALQ.............GH...A........HISCM.....PGtvr..RWN..YP.....PPLCI--aqcgg..
hFl_ENSPANP00000006258 ...YDRQ.............GT...P........SRVCQs....SR.....QWS..GS.....PPICTP-mk.....
hFl_ENSPANP00000010166 ...YELQ.............GS...Q........YVTCS.....NG.....EWS..-E.....PPRCR--lmkpcef
hFl_ENSPANP00000004497 ...FELV.............GE...R........VITCQq....NN.....QWS..GN.....KPSCV--fscffnf
hFl_ENSPANP00000006679 ...YYYMeng..........GN...G........QYHCAs....NG.....SWV..NEalspeLPKCV--pvcgvpr
hFl_ENSPANP00000012347 ...FTLR.............GS...A........NRTCQv....NG.....RWS..GQ.....TAIC---.......
hFl_ENSPANP00000004497 ...QSLI.............GN...D........TRVCQe....DS.....HWS..GA.....LPHC---t......
hFl_ENSPANP00000004522 ...YHLQtg...........AE...A........AAECLd....TG.....LWS..NHnv...PPQCIP-vtcpdvs
hFl_ENSPANP00000011736 ...FELH.............GS...T........QLECTs....QG.....QWT..EE.....VPSCQV-vkcssla
hFl_ENSPANP00000005863 ...FTLI.............GD...S........ILSCRp....SG.....QWT..AV.....TPTCRA-vkcpel.
hFl_ENSPANP00000004497 ...YTLV.............GS...H........VRECLa....NG.....LWS..GT.....ETRCL--aghcgsp
hFl_ENSPANP00000006883 ...FVMK.............GP...R........RVQCQa....LN.....KWE..PE.....LPSCSR-vcqpppe
hFl_ENSPANP00000006978 ...YQLE.............GN...K........RITCR.....NG.....QWS..-D.....PPKCL--lrpchfp
hFl_ENSPANP00000012346 ...FILR.............GS...P........VRQCRp....NG.....MWD..GE.....TAVC---.......
hFl_ENSPANP00000007596 ...YVLQ.............GY...S........TLTCImg...DDgrp..GWN..RV.....LPSCH--apcgsr.
hFl_ENSPANP00000018983 ...FFSVp............ED...T........VSSCTa....LG.....TWE..SP.....KLHCQE-incgnpp
hFl_ENSPANP00000018995 ...YVIQ.............GS...S........DLICTe....KG.....VWS..QP.....YPVCEP-lscgpp.
hFl_ENSPANP00000017959 ...FRLI.............GE...K........NTICIt....KDkvvg.IWD..KP.....APKCE--.......
hFl_ENSPANP00000004497 ...YKII.............DP...S........SITCViga..DGkp...SWD..QV.....LPSCN--apcggq.
hFl_ENSPANP00000006626 ...YVLS.............GN...E........KRTCQq....NG.....EWS..GK.....EPICI--kacrepk
hFl_ENSPANP00000011325 ...YILK.............GS...N........WSQCLe....DH.....TWA..PP.....FPICK--srdcdpp
hFl_ENSPANP00000001070 ...FKLD.............GS...A........FLECLh....NL.....IWS..SS.....PPRCL--a......
hFl_ENSPANP00000004497 ...YRMI.............GH...S........NATCRr....NPlgmy.QWD..SL.....MPLCQA-vscgipe
hFl_ENSPANP00000010118 ...YLLR.............GS...N........EITCN.....RG.....KWT..-L.....APEC---.......
hFl_ENSPANP00000004497 ...YTLS.............DD...E........PLVCEr....NH.....QWN..HA.....LPSCD--alcgg..
hFl_ENSPANP00000016499 ...YSLD.............GP...E........EIECTk....LG.....NWS..-A.....MPSCK--asckvp.
hFl_ENSPANP00000008669 ...YVLV.............GQ...A........TLSCS.....NS.....HWS..AP.....APRCKA-lclkpe.
hFl_ENSPANP00000007596 ...YILH.............GS...I........AIRCEtvp..NSla...QWN..DS.....LPTCI--vpcggfl
hFl_ENSPANP00000004522 ...YSLR.............GS...E........ELLCL.....SGerr..TWD..RP.....LPTCV--aecg...
hFl_ENSPANP00000004522 ...YEVE.............GA...S........TLSCIlgp..DGkp...VWN..NP.....RPVCT--apcggqy
hFl_ENSPANP00000004522 ...YRLV.............GH...S........MAICTr....HPqgyh.LWS..EA.....IPLCQA-lscglp.
hFl_ENSPANP00000014207 ...YELL.............GS...D........ILTCQw....DL.....SWS..AA.....PPACQ--k......
hFl_ENSPANP00000004497 ...YILI.............GH...P........VLTCQhgi..NR.....NWN..YP.....FPRCD--apcgynv
hFl_ENSPANP00000003595 ...YSLR.............GS...S........LIYCEa....NN.....EWY..PS.....VPSCV--.......
hFl_ENSPANP00000006883 ...FVMV.............GS...H........TVQCQt....NN.....RWG..PK.....LPHCSR-vcqpp..
hFl_ENSPANP00000004522 ...YTLS.............DG...E........PLECEp....NF.....QWS..RA.....LPSCEA-lcgg...
hFl_ENSPANP00000004497 ...YLLQ.............GS...T........ALHCQsv...PNala..QWN..DT.....IPSCV--vpcs...
hFl_ENSPANP00000004522 ...YALQ.............GS...A........EISCVkien.RF.....FWQ..PS.....PPTCI--apcgg..
hFl_ENSPANP00000005863 ...QLLN.............GS...A........QTACQe....NG.....HWS..TT.....MPTCQ--.......
hFl_ENSPANP00000006978 ...YQLE.............GN...K........RVTCR.....NG.....QWS..-E.....PPKCL--lrpchfp
hFl_ENSPANP00000014207 ...YSLE.............GA...A........MLTCYs....RDtgtp.KWS..DR.....VPKC---.......
hFl_ENSPANP00000017817 ...FAQH.............HV...A........TIRCRs....NG.....KWD..RP.....QIVCT--k......
hFl_ENSPANP00000010768 ...FAQH.............HV...A........TIRCRs....NG.....KWD..RP.....QIVCT--k......
hFl_ENSPANP00000017959 ...YMLE.............GS...S........QSQCQa....DH.....QWN..PP.....LAVC---r......
hFl_ENSPANP00000008669 ...FALT.............GS...S........VIRCGa....DS.....KWD..PS.....PPACE--pssc...
hFl_ENSPANP00000008216 ...FVLE.............GS...S........LLTCYs....REtgtp.IWT..SR.....LPHCV--.......
hFl_ENSPANP00000006883 ...YALE.............GS...P........WSQCQa....DD.....RWD..PP.....LAIC---t......
hFl_ENSPANP00000006883 ...FRLK.............GS...S........VSHCVlvgm.RS.....LWN..NS.....VPVCEH-ifcpnpp
hFl_ENSPANP00000006978 ...FWLS.............EE...N........EITCY.....MG.....KWS..-S.....PPQCE--.......
hFl_ENSPANP00000010166 ...YELQ.............GS...Q........YVTCS.....NG.....EWS..-E.....PPRCI--npc....
hFl_ENSPANP00000011736 ...WRLN.............GS...A........AMTCGa....TG.....HWS..GM.....LPTCE--a......
hFl_ENSPANP00000012347 ...LTLR.............GS...Q........RRTCQe....GG.....SWS..GT.....EPSCQ--d......
hFl_ENSPANP00000009779 .dpFSLI.............GE...S........MIYCGn....NS.....TWS..HA.....APECK--v......
hFl_ENSPANP00000008216 ...FELM.............GE...V........TIRCIlgq..PS.....HWN..GP.....LPVCK--.......
hFl_ENSPANP00000018995 ...HVLQ.............GP...S........VLKCLp....SQ.....QWN..DS.....FPVCKM-vlctppp
hFl_ENSPANP00000007596 ...YTLH.............GS...S........LLKCMtge..RR.....AWD..YP.....LPSCI--aecg...
hFl_ENSPANP00000008669 ...YGMV.............GP...K........SITCSe....NR.....TWY..PE.....VPRCE--we.....
hFl_ENSPANP00000010016 ...FIIK.............GP...K........KIQCV.....DG.....KWT..-T.....LPTCV--e......
hFl_ENSPANP00000000866 ...FIIK.............GP...K........KIQCV.....DG.....KWT..-T.....LPTCV--e......
hFl_ENSPANP00000016499 ...HAMF.............GN...D........TITCTt....HG.....NWT..-K.....LPECRE-vkcpfpl
hFl_ENSPANP00000006978 ...YQLE.............GN...K........RVTCR.....NG.....QWS..-E.....PPKCL--hacvi..
hFl_ENSPANP00000019885 ...FVLT.............GT...S........ILTCH.....DRqagspKWS..DR.....APKC---l......
hFl_ENSPANP00000007596 ...FFLAg............GT...E........HRVCRs....DN.....TWT..GK.....VPVCE--a......
hFl_ENSPANP00000019850 ...FKRKag...........TS...S........LTECVl....NKatniaHWT..TP.....SLKCI--r......
hFl_ENSPANP00000012346 ...LVLT.............GS...A........ERECQg....NG.....VWS..GT.....EPICR--q......
hFl_ENSPANP00000004522 ...FYVL.............GT...P........VLSCQg....DG.....TWD..RP.....RPQC---l......
hFl_ENSPANP00000004497 ...YTLQ.............GR...S........HISCM.....PGtvr..RWN..YP.....SPLCI--atcggtl
hFl_ENSPANP00000006978 ...FLLK.............GP...N........KIQCV.....DG.....AWT..-A.....LPVC---.......
hFl_ENSPANP00000018995 ...FKLL.............GL...S........EITCEa....NG.....QWS..SG.....FPHCE--htycgsl
hFl_ENSPANP00000006978 ...YEMF.............GD...E........EVMCV.....NG.....NWT..-E.....PPQC---k......
hFl_ENSPANP00000004522 ...FTLV.............GN...E........ILTCKlgt..YL.....QFE..GP.....PPICE--vhcpt..
hFl_ENSPANP00000006883 ...FRLK.............GR...S........ASHCVl....AGmka..LWN..SS.....VPVCEQ-ifcpnpp
hFl_ENSPANP00000010016 ...YELQ.............GS...A........TVTCR.....NK.....QWS..-E.....PPRCL--dpcv...
hFl_ENSPANP00000000866 ...YELQ.............GS...A........TVTCR.....NK.....QWS..-E.....PPRCL--dpcv...
hFl_ENSPANP00000018995 ...FQLV.............GN...P........VQYCLn....QG.....QWT..QP.....LPHCER-iscgvpp
hFl_ENSPANP00000007596 ...YHGL.............GP...A........SIECLp....NG.....TWSwrNE.....RPYCQI-iscgelp
hFl_ENSPANP00000003595 ...YGVI.............GP...K........SITCSe....TR.....TWY..PE.....VPRC---d......
hFl_ENSPANP00000009778 ...FTKIpg...........KH...D........SVMCLq....DS.....QWS..DI.....EEFC---nrscgap
hFl_ENSPANP00000004522 ...YALQ.............GS...P........EIECLpv...PGala..QWN..VS.....APTCV--vpcg...
hFl_ENSPANP00000010118 ...FVIH.............GS...E........EIRCE.....NG.....KWT..-E.....PPKC---.......
hFl_ENSPANP00000008129 ...TNLT.............GI...E........ETTCGp....FG.....NWS..SP.....EPTCQV-iqcepl.
hFl_ENSPANP00000018995 ...YSLA.............DN...S........QLLCNa....QG.....KWV..PPegqd.MPRCI--ahfcekp
hFl_ENSPANP00000006978 ...YQLL.............GEi..N........YRECD.....TD.....GWT..ND.....IPICEV-vkc....
hFl_ENSPANP00000010118 ...YYLS.............GS...D........LIQCY.....NF.....GWY..PE.....SPVCE--.......
hFl_ENSPANP00000004522 ...FLGTq............GS...E........TITCVlk...EGsv...VWN..SA.....VLRCE--apcgghl
hFl_ENSPANP00000006978 ...FGID.............GP...P........IAKCL.....GE.....KWS..-R.....PPSC---i......
hFl_ENSPANP00000006978 ...FTMI.............GH...R........SITCI.....HG.....VWT..-Q.....LPQC---.......
hFl_ENSPANP00000004497 ...YRLE.............GA...T........KLTCLg....GGrr...VWS..AP.....LPRCV--aecg...
hFl_ENSPANP00000014207 ...FELI.............GE...V........TITCVpgh..PS.....QWT..SQ.....PPLCK--.......
hFl_ENSPANP00000019885 ...YQLK.............GA...R........RLTCLnat..QP.....FWD..SK.....EPVCI--aacggvi
hFl_ENSPANP00000010118 ...YLLR.............GS...K........ISRCE.....QG.....KWS..-S.....PPVCL--e......
hFl_ENSPANP00000014934 ...YQLIegnqvl.......HS...F........TAVCQd....DG.....TWH..RA.....MPRCN--ikdcgqp
hFl_ENSPANP00000017959 ...FIMN.............GS...R........MIRCHt....DN.....TWV..PG.....VPTCI--k......
hFl_ENSPANP00000010186 ...YSLI.............GN...P........VARCGe....DL.....RWL..VG.....EMHCQK-iacvlpv
hFl_ENSPANP00000018995 ...YTMDt............DI...D........TFTCQk....DG.....RWF..PD.....RISCS--pkkcplp
hFl_ENSPANP00000014410 ...FVQR.............HV...P........TIRCQp....SG.....HWE..EP.....RITCT--d......
hFl_ENSPANP00000018995 ...FLLQ.............GQ...G........IITCNp....DE.....TWT..QT.....SAKCEK-iscgppa
hFl_ENSPANP00000004522 ...YRLE.............GT...A........RITCLggr..RR.....LWS..SP.....LPRCV--aecgns.
hFl_ENSPANP00000006978 ...YKMD.............GP...S........TVTCI.....NS.....RWT..G-.....RPTC---r......
hFl_ENSPANP00000012271 ...YSLSa............PS...R........IRVCQp....HG.....VWS..-E.....PPQCLE-idecrsq
hFl_ENSPANP00000010962 ...YSLSa............PS...R........IRVCQp....HG.....VWS..-E.....PPQCLE-idecrsq
hFl_ENSPANP00000004497 ...YTLV.............GT...D........TLTCKlss..QL.....QFE..GS.....LPTCEE-v......
hFl_ENSPANP00000004522 ...YYYT.............GQ...R........VIRCQa....NG.....KWSlgDS.....TPTCRI-iscgelp
hFl_ENSPANP00000019852 ...YRALhr...........GP...A........ESVCKmt...HGkt...RWT..QP.....QLIC---.......
hFl_ENSPANP00000019853 ...YRALhr...........GP...A........ESVCKmt...HGkt...RWT..QP.....QLIC---.......
hFl_ENSPANP00000017959 ...FSMN.............GN...K........SVWCQa....NN.....RWG..PTr....LPTCES-vc.....
hFl_ENSPANP00000009778 ...YRRD.............PSll.A........KLTCLq....NL.....EWS..TA.....AEFCK--kkscpnp
hFl_ENSPANP00000015805 ...YQLIegnqvl.......HS...F........TAVCQd....DG.....TWH..RA.....MPRCK--.......
hFl_ENSPANP00000003595 ...YGKI.............NS...S........RLICDa....KG.....SWN..YS.....-------ifcakkr
hFl_ENSPANP00000010118 ...HFLQ.............GS...R........EAYCL.....EG.....TWT..-T.....PPLC---.......
hFl_ENSPANP00000006679 ...FEVVegrvga.......TS...F........HSTCQs....NG.....KWS..NS.....KLKCQP-vdcgip.
hFl_ENSPANP00000019885 ...YVLK.............GQ...A........SIKCVpgh..PS.....HWS..DP.....PPICK--.......
hFl_ENSPANP00000008216 ...YELQ.............GA...K........MLTCInas..KP.....HWS..SQ.....EPICS--apcg...
hFl_ENSPANP00000017951 ...YYYMengg.........NG...R........QYHCAs....NG.....SWV..NEalspeLPKCV--pvcgvpr
hFl_ENSPANP00000007596 ...FTLV.............GN...A........ILTCRlge..RL.....QMD..GA.....PPVCQV-lcp....
hFl_ENSPANP00000004497 ...FFLAg............GS...E........HRTCKa....DM.....KWT..GK.....SPVCK--.......
hFl_ENSPANP00000016499 ...YVSRg............GM...R........RFICPl....TG.....MWP..IN.....TLKCT--prvcpfa
hFl_ENSPANP00000004686 ...FIQR.............HL...P........TIRCLg....NG.....RWA..IP.....KITC---.......
hFl_ENSPANP00000011618 ...FETV.............GY...Q........YFRCLp....DG.....TWR..QG.....DVECQ--rtecikp
hFl_ENSPANP00000010016 ...YTMI.............GN...N........EITCI.....DG.....LWT..-E.....LPMC---.......
hFl_ENSPANP00000000866 ...YTMI.............GN...N........EITCI.....DG.....LWT..-E.....LPMC---.......
hFl_ENSPANP00000017951 ...FESLqgrvga.......TS...F........HSTCQs....NG.....KWS..NS.....KLKCQP-vdcgip.
hFl_ENSPANP00000017959 ...YQLQ.............GP...S........SSRCVi....AGqgv..AWT..-K.....MPVCK--.......
hFl_ENSPANP00000011325 ...YHLV.............GK...K........TVFCNa....SK.....EWD..NT.....TTECR--lghcpdp
hFl_ENSPANP00000018983 ...FESPg............GK...I........TSVCTe....KG.....TWR..ES.....TLTCTE-i......
hFl_ENSPANP00000002642 ...FIQR.............HL...P........TIRCLg....NG.....RWA..IP.....KITC---.......
hFl_ENSPANP00000010016 ...YLLP.............EA...K........EIVCK.....NG.....RWQ..-S.....LPHC---.......
hFl_ENSPANP00000000866 ...YLLP.............EA...K........EIVCK.....NG.....RWQ..-S.....LPHC---.......
hFl_ENSPANP00000018995 ...YTFE.............GV...N........ISVCQl....DG.....TWE..PP.....-------fsdescs
hFl_ENSPANP00000019418 ...HQMV.............GS...G........LLTCTw....KGsia..EWS..SG.....SPVCK--l......
hFl_ENSPANP00000017169 ...YMLK.............GDy..K........YLTCK.....NG.....EWK..PA.....-------meisc..
hFl_ENSPANP00000010953 ...LTQR.............NL...P........LIRCQe....NG.....RWE..TP.....QISC---v......
hFl_ENSPANP00000018943 ...DASQgr...........GS...N........IIHCRk....DG.....TWS..GS.....FHVCQ--e......
hFl_ENSPANP00000019885 ...YTLEq............GS...I........IIECVdph..DP.....QWN..ET.....EPACRA-vcsge..
hFl_ENSPANP00000003595 ...YYPVs............VD...G........ESSCHt....DG.....TWK..PK.....MPACE--palclkp
hFl_ENSPANP00000008669 ...YARSh............SD...Q........MLTCNs....DG.....QWT..-Y.....TTFC---thrrcsn
hFl_ENSPANP00000001070 ...YSLTs............DY...K........YITCQ.....YG.....EWF..PS.....-------yqvyc..
hFl_ENSPANP00000018995 ...FVLN.............TS...A........KIECMr....GG.....QWN..PS.....P------msiqcip
hFl_ENSPANP00000004354 ...YRLRte...........GD...G........VYTLNn....EK.....QWT..NKavgdkLPEC---eavcgkp
hFl_ENSPANP00000006883 ...YYGR.............-P...F........SIICLk....NS.....VWT..SA.....KDKCI--rkscrnp
hFl_ENSPANP00000012790 ...YELQ.............GH...E........QLTCT.....QE.....GWD..FQ.....PPLCKD-v......
hFl_ENSPANP00000006978 ...YLIK.............EG...E........EITCQ.....DG.....RWQ..-S.....IPHC---.......
hFl_ENSPANP00000008216 ...HSLEq............GP...A........IIECInvr..DP.....YWN..DT.....EPLCRA-mcgge..
hFl_ENSPANP00000001032 ...YELH.............GS...S........LLICQs....NK.....RWS..DK.....-VIC---kqkrcpt
hFl_ENSPANP00000010166 ...YATAdgn..........SS...G........SITCL.....QN.....GWS..-A.....QPICI--kfcdtp.
hFl_ENSPANP00000010166 ...YATAdgn..........SS...G........SITCL.....QN.....GWS..-A.....QPICIK-lcdtp..
hFl_ENSPANP00000006978 ...YESNtgs..........TT...S........SIVCG.....DN.....GWS..-D.....LPVCY--erecelp
hFl_ENSPANP00000010016 ...LKRV.............GP...D........SVQCY.....QF.....GWS..PN.....FPTCK--.......
hFl_ENSPANP00000000866 ...LKRV.............GP...D........SVQCY.....QF.....GWS..PN.....FPTCK--.......
hFl_ENSPANP00000004497 ...YYLE.............GR...R........LAQCQa....NG.....TWNigDE.....RPGC---rviscgs
hFl_ENSPANP00000013892 ...FHLV.............GS...S........RSICS.....QG.....QWS..TP.....KPHCQ--.......
hFl_ENSPANP00000008669 ...YKPTtd...........AP...M........TLICQk....NL.....RWT..P-.....YQGC---ealccpe
hFl_ENSPANP00000003595 ...YRPVld...........EP...L........TVTCQe....NL.....TWT..SS.....-NEC---ervccpt
hFl_ENSPANP00000006978 ...FYPAt............RG...N........TAKCT.....SS.....GWI..-P.....APRCA--lrpc...
hFl_ENSPANP00000019852 ...FRRIks...........GS...P........YMLCTg....NSshs..SWD..N-.....--QC---qc.....
hFl_ENSPANP00000019853 ...FRRIks...........GS...P........YMLCTg....NSshs..SWD..N-.....--QC---qc.....
hFl_ENSPANP00000018943 ...YHVP.............GS...SrkskkrafKTQCTq....DG.....SWQ..E-.....-------gacvpvt
hFl_ENSPANP00000001070 ...FKLK.............GA...T........KRLCMkyf..NG.....---..--.....-------tlgwips
hFl_ENSPANP00000006978 ...YSLPk............EQ...T........TVTCT.....EN.....GWS..-P.....TPKCIR-vktcsk.
hFl_ENSPANP00000006978 ...FTRV.............GP...N........SVQCY.....HF.....GLS..PD.....IPTCK--.......
hFl_ENSPANP00000006883 ...YFG-.............RM...F........SISCLe....NL.....VWS..SV.....EDNCR--rkscgtp
hFl_ENSPANP00000009779 ...YFYI.............PPla.T........HSICDr....NH.....TWL..--.....-------p......
hFl_ENSPANP00000018943 ...AQLKg............NN...S........LLTCMe....DG.....LWS..FP.....EALCE--lmclapp
hFl_ENSPANP00000010186 ...MSLE.............GP...S........TFLCGs....SL.....KWS..P-.....-------e......
hFl_ENSPANP00000006978 ...YEYS.............ER...G........DSVCT.....ES.....GWH..-P.....LPSCE--ektcnvp
hFl_ENSPANP00000001070 ...FKIRypdl.........YN...M........FSLCRd....DG.....TWN..-N.....LPVCQ--.......
hFl_ENSPANP00000006978 ...YGLPk............EQ...T........TVTCT.....EN.....GWS..-P.....TPRCIH-v......
hFl_ENSPANP00000006258 ...FRLI.............GR...R........SVQCLp....SR.....RWS..GT.....-AYC---rqmrcha
hFl_ENSPANP00000006978 ...YITAdge..........TS...G........SITCR.....KN.....GWS..-A.....QPTCI--kscdmp.
hFl_ENSPANP00000010016 ...YSLQn............KE...K........SISCV.....ER.....GWS..-A.....PPKC---sf.....
hFl_ENSPANP00000000866 ...YSLQn............KE...K........SISCV.....ER.....GWS..-A.....PPKC---sf.....
hFl_ENSPANP00000010118 ...YKTTggk..........DE...E........VVQCL.....SD.....GWS..-S.....QPTC---sf.....
hFl_ENSPANP00000017959 ...YWLT.............GH...T........YHKCQdde..NG.....IWF..KK.....IPLCKV-ihchppp
hFl_ENSPANP00000014207 ...YALEppg..........PP...N........AIECVdpt..EP.....HWN..DT.....EPACKA-mcgg...
hFl_ENSPANP00000011618 ...FVVA.............GP...S........RYTCQ.....GN.....SWT..PP.....-------i......
hFl_ENSPANP00000006978 ...YGLRn............EQ...T........AVNCT.....EN.....GWS..-P.....TPRCIH-v......
hFl_ENSPANP00000002841 ...HITGhre..........TA...F........TLLCNs....CG.....EWY..GL.....VQAC---.......
hFl_ENSPANP00000006978 ...YRSL.............GN...I........VMVCR.....KG.....EWV..AL.....N------plkkcqk
hFl_ENSPANP00000017959 ...YKLS.............GS...V........YQECQg....TT.....PWF..ME.....IRLCKE-itcpppp
hFl_ENSPANP00000010166 ...YESRygn..........TT...G........SIVCG.....ED.....GWS..-H.....LPTC---y......
hFl_ENSPANP00000010166 ...YESRygn..........TT...G........SIVCG.....ED.....GWS..-H.....LPTC---y......
hFl_ENSPANP00000018943 ...YVLQirrddeliksqmgPS...V........TVTCT.....EG.....KWN..K-.....QVACE--pvdcsip
hFl_ENSPANP00000008669 ...----.............-R...R........SATCQa....DG.....TWS..PR.....TPSC---gdnchfp
hFl_ENSPANP00000012347 ...FYPY.............PV...Q........TRTCRs....TG.....SWS..--.....-------t......
hFl_ENSPANP00000013892 ...REVV.............GP...K........VRKCLa....NG.....SWT..DM.....-------dtpsrcv
hFl_ENSPANP00000010016 ...FVSP.............SKsfwT........RITCT.....EE.....GWS..-P.....TPKCL--rmcsfp.
hFl_ENSPANP00000000866 ...FVSP.............SKsfwT........RITCT.....EE.....GWS..-P.....TPKCL--rmcsfp.
hFl_ENSPANP00000012346 ...LYP-.............SP...A........SRLCKs....SG.....QWQ..TP.....-------gatrslt
hFl_ENSPANP00000017959 ...FILI.............GE...N........TLRCTvdsqkTG.....TWS..GP.....APRCE--.......
hFl_ENSPANP00000010166 ...FVTPs............GSyw.D........YIHCT.....QD.....GWS..PT.....VP-----clrtc..

d1ss2a_                ..............................
hFl_ENSPANP00000010118 ilrmqcdrgqlkyprciprqrtlsyqeplr
hFl_ENSPANP00000007596 qisng.........................
hFl_ENSPANP00000016499 kehsslafwktdasdvkpc...........
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000004497 npahg.........................
hFl_ENSPANP00000006883 tisng.........................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000018995 kieng.........................
hFl_ENSPANP00000007596 spiyg.........................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000004497 fvena.........................
hFl_ENSPANP00000007596 ipan..........................
hFl_ENSPANP00000004522 npvng.........................
hFl_ENSPANP00000007596 vppna.........................
hFl_ENSPANP00000018995 qlang.........................
hFl_ENSPANP00000010166 ..............................
hFl_ENSPANP00000018995 leflng........................
hFl_ENSPANP00000007596 ipang.........................
hFl_ENSPANP00000018995 nvdh..........................
hFl_ENSPANP00000009778 qidng.........................
hFl_ENSPANP00000007596 ttang.........................
hFl_ENSPANP00000004497 tptng.........................
hFl_ENSPANP00000018995 vlang.........................
hFl_ENSPANP00000018995 ipeng.........................
hFl_ENSPANP00000018995 eiang.........................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000006883 tidng.........................
hFl_ENSPANP00000007596 gipaqg........................
hFl_ENSPANP00000018995 ninng.........................
hFl_ENSPANP00000004497 ipaeg.........................
hFl_ENSPANP00000004522 hqe...........................
hFl_ENSPANP00000004522 epivng........................
hFl_ENSPANP00000016445 ..............................
hFl_ENSPANP00000016446 ..............................
hFl_ENSPANP00000007596 elivng........................
hFl_ENSPANP00000009779 kikng.........................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000011325 ..............................
hFl_ENSPANP00000016499 vpm...........................
hFl_ENSPANP00000018995 dlahg.........................
hFl_ENSPANP00000018995 pl............................
hFl_ENSPANP00000018995 apeng.........................
hFl_ENSPANP00000018995 hidf..........................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000014866 pcqng.........................
hFl_ENSPANP00000009778 ..............................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000004497 tlang.........................
hFl_ENSPANP00000009779 ..............................
hFl_ENSPANP00000008669 dirng.........................
hFl_ENSPANP00000004497 v.............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000018995 eilng.........................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000017959 grfpng........................
hFl_ENSPANP00000003595 ip............................
hFl_ENSPANP00000008669 ..............................
hFl_ENSPANP00000007596 amng..........................
hFl_ENSPANP00000017959 nilng.........................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000007596 etpah.........................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000019885 g.............................
hFl_ENSPANP00000011736 ..............................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000004497 etpah.........................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000005863 ki............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000018995 fvip..........................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000008129 ..............................
hFl_ENSPANP00000006258 ..............................
hFl_ENSPANP00000012036 ..............................
hFl_ENSPANP00000008216 g.............................
hFl_ENSPANP00000003595 pdirng........................
hFl_ENSPANP00000004522 tssng.........................
hFl_ENSPANP00000014207 ..............................
hFl_ENSPANP00000011736 qpqrg.........................
hFl_ENSPANP00000018995 cgkpppiqng....................
hFl_ENSPANP00000007596 aptng.........................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000006978 vih...........................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000008857 ..............................
hFl_ENSPANP00000011736 ..............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000001032 ..............................
hFl_ENSPANP00000001032 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000004497 tas...........................
hFl_ENSPANP00000004497 haat..........................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000012036 ..............................
hFl_ENSPANP00000011736 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000006258 ..............................
hFl_ENSPANP00000010166 pe............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000006679 ..............................
hFl_ENSPANP00000012347 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000011736 ..............................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000012346 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000018983 emrh..........................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000006626 ..............................
hFl_ENSPANP00000011325 ..............................
hFl_ENSPANP00000001070 ..............................
hFl_ENSPANP00000004497 spgng.........................
hFl_ENSPANP00000010118 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000016499 ..............................
hFl_ENSPANP00000008669 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000004522 v.............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000014207 ..............................
hFl_ENSPANP00000004497 tsqng.........................
hFl_ENSPANP00000003595 ..............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000005863 ..............................
hFl_ENSPANP00000006978 d.............................
hFl_ENSPANP00000014207 ..............................
hFl_ENSPANP00000017817 ..............................
hFl_ENSPANP00000010768 ..............................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000008669 ..............................
hFl_ENSPANP00000008216 ..............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000006883 ailng.........................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000010166 ..............................
hFl_ENSPANP00000011736 ..............................
hFl_ENSPANP00000012347 ..............................
hFl_ENSPANP00000009779 ..............................
hFl_ENSPANP00000008216 ..............................
hFl_ENSPANP00000018995 lisfg.........................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000008669 ..............................
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000016499 rpdng.........................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000019885 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000019850 ..............................
hFl_ENSPANP00000012346 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000018995 plipna........................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000006883 ailng.........................
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000018995 p.............................
hFl_ENSPANP00000007596 t.............................
hFl_ENSPANP00000003595 ..............................
hFl_ENSPANP00000009778 t.............................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000010118 ..............................
hFl_ENSPANP00000008129 ..............................
hFl_ENSPANP00000018995 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000010118 ..............................
hFl_ENSPANP00000004522 tsp...........................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000014207 ..............................
hFl_ENSPANP00000019885 r.............................
hFl_ENSPANP00000010118 ..............................
hFl_ENSPANP00000014934 ..............................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000010186 l.............................
hFl_ENSPANP00000018995 enit..........................
hFl_ENSPANP00000014410 ..............................
hFl_ENSPANP00000018995 hvena.........................
hFl_ENSPANP00000004522 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000012271 pclhg.........................
hFl_ENSPANP00000010962 pclhg.........................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000004522 vppng.........................
hFl_ENSPANP00000019852 ..............................
hFl_ENSPANP00000019853 ..............................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000009778 geipng........................
hFl_ENSPANP00000015805 ..............................
hFl_ENSPANP00000003595 crnpel........................
hFl_ENSPANP00000010118 ..............................
hFl_ENSPANP00000006679 ..............................
hFl_ENSPANP00000019885 ..............................
hFl_ENSPANP00000008216 ..............................
hFl_ENSPANP00000017951 ..............................
hFl_ENSPANP00000007596 ..............................
hFl_ENSPANP00000004497 ..............................
hFl_ENSPANP00000016499 gileng........................
hFl_ENSPANP00000004686 ..............................
hFl_ENSPANP00000011618 ..............................
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000017951 ..............................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000011325 vlv...........................
hFl_ENSPANP00000018983 ..............................
hFl_ENSPANP00000002642 ..............................
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000018995 pvscgkp.......................
hFl_ENSPANP00000019418 ..............................
hFl_ENSPANP00000017169 ..............................
hFl_ENSPANP00000010953 ..............................
hFl_ENSPANP00000018943 ..............................
hFl_ENSPANP00000019885 ..............................
hFl_ENSPANP00000003595 ei............................
hFl_ENSPANP00000008669 p.............................
hFl_ENSPANP00000001070 ..............................
hFl_ENSPANP00000018995 vrcgepp.......................
hFl_ENSPANP00000004354 kn............................
hFl_ENSPANP00000006883 ..............................
hFl_ENSPANP00000012790 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000008216 ..............................
hFl_ENSPANP00000001032 lampang.......................
hFl_ENSPANP00000010166 ..............................
hFl_ENSPANP00000010166 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000004497 lsfppng.......................
hFl_ENSPANP00000013892 ..............................
hFl_ENSPANP00000008669 p.............................
hFl_ENSPANP00000003595 pd............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000019852 ..............................
hFl_ENSPANP00000019853 ..............................
hFl_ENSPANP00000018943 cdpp..........................
hFl_ENSPANP00000001070 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000006883 pe............................
hFl_ENSPANP00000009779 ..............................
hFl_ENSPANP00000018943 ..............................
hFl_ENSPANP00000010186 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000001070 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000006258 lp............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000010118 ..............................
hFl_ENSPANP00000017959 vivng.........................
hFl_ENSPANP00000014207 ..............................
hFl_ENSPANP00000011618 ..............................
hFl_ENSPANP00000006978 ..............................
hFl_ENSPANP00000002841 ..............................
hFl_ENSPANP00000006978 rpcghp........................
hFl_ENSPANP00000017959 viyng.........................
hFl_ENSPANP00000010166 ..............................
hFl_ENSPANP00000010166 ..............................
hFl_ENSPANP00000018943 ..............................
hFl_ENSPANP00000008669 ..............................
hFl_ENSPANP00000012347 ..............................
hFl_ENSPANP00000013892 ricsk.........................
hFl_ENSPANP00000010016 ..............................
hFl_ENSPANP00000000866 ..............................
hFl_ENSPANP00000012346 kavckpvrcpap..................
hFl_ENSPANP00000017959 ..............................
hFl_ENSPANP00000010166 ..............................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0049458 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Thecamonas trahens ATCC 50062
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora infestans T30-4
NoYes   Perkinsus marinus ATCC 50983
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]