SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Complement control module/SCR domain alignments in Tursiops truncatus 76_1

These alignments are sequences aligned to the 0054764 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                          10                   20        30         
                                                           |                    |         |         
d2z3qb1               ...........................ITCPPPM.SVEHADIWV.......KS....YSLYSRERYICNSG......F
ENSTTRP00000002416  pctlsfdtmesnnlllkwsfdnrpyil-------.---------.......--....--HGEYIEFLCKRD......T
ENSTTRP00000008853  ...cklsvkkatviyegervniqdkfk-------.---------.......NG....MLHGQKISFFCKNK......E
ENSTTRP00000012358  ...........................-HCGSPD.PIVNGHISG.......DG....FSYRDTVVYQCNPG......F
ENSTTRP00000000827  .cviseemmekhnielkwrsdkklysk-------.---------.......--....--TDDIVEFKCKSG......Y
ENSTTRP00000012358  ...........................ISCGDPG.TPANGLQFG.......TD....FTFNSTVSYQCNPG......Y
ENSTTRP00000003462  ...........................-HCGIPE.LIVNGQVVG.......EN....YGYRDTVVYQCNPG......F
ENSTTRP00000008259  ...........................VRCGEPP.RIMNGYAIG.......SN....YSFGAVVAYSCNRG......F
ENSTTRP00000012358  ...........................ITCGHPG.NPAHGFTNG.......SE....FNLNDVVNFTCNTG......Y
ENSTTRP00000002120  ...........................-HCGTPE.PIVNGQING.......EN....YNYRGSVVYQCNAG......F
ENSTTRP00000012358  ...........................-FCGDPG.TPAHGSRLG.......DE....FKAKSLLRFSCEMG......Y
ENSTTRP00000002120  ...........................INCGDPG.IPANGLRLG.......SD....FRYNKTVTYQCIPG......Y
ENSTTRP00000003462  ...........................VSCGHPG.SPIYGRTSG.......NG....FNFNDVVTFSCNIG......Y
ENSTTRP00000008259  ...........................VSCGEPP.AIKDAVTTG.......SN....FTFGNTVTYTCKEG......Y
ENSTTRP00000008259  ...........................IKCKAPG.NPENGRSSG.......EI....YTVGSEVTFSCDEG......H
ENSTTRP00000008259  ...........................VSCGKPE.SPEHGFVFG.......SE....YSFESMIIYHCETG......Y
ENSTTRP00000002120  ...........................IMCKPPQ.LIPNGKVVG.......SD....FMWGSSVTYACLEG......Y
ENSTTRP00000002120  ...........................-ICGDPG.IPAHGIRLG.......DS....FAPGSLMRFSCEAG......H
ENSTTRP00000004075  ...........................ITCPPPP.VIYNGVHTGgs.....SD....VLYGTTVTYTCNPGpergvkF
ENSTTRP00000004075  ...........................ILCPPPP.PILNGRHTGsss....MN....VRYGSTVTYTCDRGpeqgvnF
ENSTTRP00000014813  ...........................-RCGNPG.ELLNGQVTAk......TD....YSFGSQIKFSCSEG......Y
ENSTTRP00000008259  ...........................VSCGAPA.IPENGGIDG.......SA....FTYGSKVIYRCNKG......Y
ENSTTRP00000003462  ...........................VQCGNPG.TTANGKVFRi......DG....TTFSSSVIYSCVEG......Y
ENSTTRP00000003462  ...........................-TCGDPG.TPGHGSRQE.......SN....FRTKSSVRFACDIG......Y
ENSTTRP00000004075  ..........................e--CPSLP.TIANGYHTGesv....DS....FAPGLSVTYSCEPG......Y
ENSTTRP00000008259  ...........................VRCSPPL.QVANGVMDG.......LD....YGFGKKVVFHCQDG......Y
ENSTTRP00000008853  ...........................-VCPFAG.ILENGTVRY.......TT....FEYPNTINFSCNTG......F
ENSTTRP00000002120  ...........................ITCGHPG.NPMNGLTQG.......NQ....FNLNDVVKFVCNPG......Y
ENSTTRP00000003462  ...........................ISCGDPG.IPASGLRYG.......DD....YVVGQNVSYMCQPG......Y
ENSTTRP00000001935  ...........................VSCGWLP.PPSNGHKEG.......MR....YLVGSTVHFHCDSG......Y
ENSTTRP00000003462  ...........................ISCGELP.TPPNGNKIG.......TQ....TSYGSTAIFTCDSG......F
ENSTTRP00000003462  ...........................VTCPTPP.QISNGRLEG.......TN....FDWGFSISYICSPG......Y
ENSTTRP00000008259  .....................lplcerISCGVPP.PLENGFYSA.......ED....FHAGSTVTYQCNNG......Y
ENSTTRP00000008259  ...........................VLCLPPP.LIPFGVPAPs......SA....LHFGSAVKYSCVDG......F
ENSTTRP00000014813  ...........................VKCEPPP.AISNGKHNGgde....DF....YTYGSSVTYSCDPD......F
ENSTTRP00000014802  ....................fpvcksr-DCGPPE.NPTHGYFEG.......TD....FNSGSTITYYCEAR......Y
ENSTTRP00000003835  ..........................k--CDALR.SPVNGVVKCfqsh...GS....FLWNTTCEFECNEG......Y
ENSTTRP00000012358  ...........................VNCSDPG.FVENAVRHEqqnfp..ES....FEYGMSVVYHCKKG......F
ENSTTRP00000008259  ...........................IHCDPPH.PIENGFVEG.......AD....YSYGAMIIYSCFPG......F
ENSTTRP00000012479  ...........................VSCPALS.TPPDGRKFG.......SK....YLVDHEVHFTCNAG......F
ENSTTRP00000008259  ...........................VECDLPV.APENGFLHF.......TE....TTMGSAIQYSCKPG......H
ENSTTRP00000012358  ...........................VSCGNPG.TPTHGMIVSs......DG....VLFSSSVVYACWDG......Y
ENSTTRP00000003462  ......................pmckvVNCSDPG.IPANSKRESkieh...GN....FTYGTVVFYDCNPG......Y
ENSTTRP00000008259  ...........................IECPKPK.EISNGKFSY.......TN....LHYGQTITYSCDRG......F
ENSTTRP00000008259  ...........................VKCSSPE.DINNGKYIL.......SG....LTYLSTASYSCDNG......Y
ENSTTRP00000003824  ...........................--CSEFD.LPQHMLMNCshpl...GN....FPFNTQCSFHCAEG......Y
ENSTTRP00000003824  ......................pqcvaVQCPPLK.SPEQGSMTClhsa...KA....FQHRSSCSFSCEEG......F
ENSTTRP00000002120  ...........................-MCPDPG.IPERGKRLG.......SD....FRLGSSVQFTCNEG......Y
ENSTTRP00000002120  ...........................ISCGNPG.TPSNARVMFs......DG....LVFSSSIVYECREG......Y
ENSTTRP00000012358  ...........................VSCGIPE.SPGNGSFTG.......NE....FTLDSKVTYECNEG......F
ENSTTRP00000003462  ..........................l--CPDPG.EPENGKRVG.......SD....FSLGSTVQFSCDED......Y
ENSTTRP00000012358  ...........................VFCGDPG.TPAEGRLSG.......KS....FTYRSEVFFQCRSP......F
ENSTTRP00000008259  ..........................n--CGKPP.PIQNGYRKG.......EN....FEVGSKVQFFCNEG......Y
ENSTTRP00000003462  ...........................-SCPDPR.PFRNGFVIG.......ND....FTVGQTISFECFPG......Y
ENSTTRP00000003824  ......................ptcdaIKCPELS.APERGSLDCpdsh...GE....FTAGSTCHFSCNEG......F
ENSTTRP00000008259  ...........................--CGPPT.HVENAIARG.......VH....YQYGDMITYSCYSG......Y
ENSTTRP00000008259  ...........................-SCGSPP.TIPNAFTSE.......SG....SLEENVITYNCRSG......Y
ENSTTRP00000003462  ...........................-SCENPG.VPRHGSQNSt......FG....FQVGSVVQFHCKKG......H
ENSTTRP00000003462  ...........................-FCGDPG.IPAQGKREG.......KS....FIYQSEVSFSCNSP......F
ENSTTRP00000003824  .....................pvcqal-QCQYLP.ASNKAQVNCshpf...GA....FRYQSTCSFTCDEG......F
ENSTTRP00000008259  ...........................ISCPKPN.LVMNGSIKG.......SN....YTYLSILYYECNPG......Y
ENSTTRP00000012358  ...........................-TCPDPG.TPQFGIQNSs......RG....YEVGSMVFFRCRKG......Y
ENSTTRP00000008259  ..........................a-------.---------.......-K....FRYNTLVSYTCNPG......Y
ENSTTRP00000003824  .....................fpecqaVTCAPLP.NPQNGTKTCvqpl...GD....SSYKTTCQFTCDEG......F
ENSTTRP00000012358  ...........................VMCGQPP.PVQDGKVEG.......SD....LRWGASVSYSCAQG......F
ENSTTRP00000010558  ......................ycrqm-RCHALP.FITSGTYTCt......NG....VLLDSRCDYSCSSG......Y
ENSTTRP00000003835  ......................ptckaVTCDAIS.HPQNGAVSCshspa..GE....FTYKSSCHFTCAEG......F
ENSTTRP00000004075  ..........................d--CQAPP.KILHGQKEDrhm....IR....FDPGTSIKYSCDPG......Y
ENSTTRP00000003873  ...........................--CPELP.EIPNGWKSPsq.....PE....LVHGTVVTYQCYPG......Y
ENSTTRP00000008259  ..........................k--CEAPL.GFLNGKAEV.......EN....STAGPSVVYSCNRG......Y
ENSTTRP00000002120  ...........................--CPDPE.PFANGIVRG.......AG....YNVGQSVTFECLPG......Y
ENSTTRP00000008259  ...........................VSCGPPE.DLAHGFPNG.......FS....FYHGGHIQYQCFPG......Y
ENSTTRP00000002120  .....................mptcqiISCGELP.IPPNGHRIG.......TL....SVYGATAIFSCNSG......Y
ENSTTRP00000003132  ...........................-TCGNPG.EILKGVLHG.......TR....FNIGDKIRYSCLSG......Y
ENSTTRP00000008259  ...........................VECPQPE.EILHGIIDV.......QG....LAYLSTALYTCKPG......F
ENSTTRP00000015569  ...........................--CSDLP.EIQNGWKTTsh.....TE....LVRGARITYQCDPG......Y
ENSTTRP00000012358  ...........................ISCGSLS.FPPNGNKIG.......TM....TVYGATAIFTCNTG......Y
ENSTTRP00000014802  ...........................-HCPDPL.LVNGEFSSL.......EP....VNVNDTVTFKCNEH......Y
ENSTTRP00000004075  ..........................e--CKPPG.PFLNGQLKRp......TS....LRVGATVNFFCSEG......Y
ENSTTRP00000006831  ......................plckvVKCERP-.VLEHGIIVSgsr....KK....FSYQAVVIFECLQG......F
ENSTTRP00000012358  ...........................--CGDPG.IPAYGKRTG.......SS....FLHGDSLTFECQAA......F
ENSTTRP00000002120  ...........................-TCGNPG.RLPNGVQQG.......ST....FNLGDKVRYSCNPG......F
ENSTTRP00000004634  ...........................-RCGKLN.APENGYMKCss.....DG....DNYGATCEFSCIGG......Y
ENSTTRP00000008259  .........................xe-------.---------.......-E....YTFQKEVEYTCDEG......F
ENSTTRP00000003829  ......................ptcrvIQCEPLT.APDFGTMDCshpl...VD....FGFTSTCTFSCSEG......A
ENSTTRP00000008259  ........................csd--CPPLEgSVPHLRTAS.......GD....VKPGSRVSLFCDPG......F
ENSTTRP00000002120  ...........................-SCPEPA.VPSNGVKTG.......ER....YLVNDVVSFQCEPG......Y
ENSTTRP00000001234  ...........................--CGPPD.DLPSGQVDYitga...EV....TIYKAVVKYRCNEF......Y
ENSTTRP00000003824  ...........................--CEPLE.SPVHGSMDCslss...RA....FQYNSNCSFHCAKG......F
ENSTTRP00000005169  ...........................-SCGFPP.RPAHGDVSV.......TD....LHPGGTATFHCDSG......Y
ENSTTRP00000003462  ...........................-SCLDPG.IPVHGHRYG.......HD....FSIGSTVSFSCDPG......Y
ENSTTRP00000002416  .....................prcakl-ICSSLR.SIENGYFHPvk.....QT....YEEGDVVQFFCHKN......Y
ENSTTRP00000000827  .....................ipicevVKCLPVT.EPENGKFFSsaldpd.QV....YVFGQAIQFECNSG......Y
ENSTTRP00000003824  ......................pacraVKCSKLH.VTEPIVMNCsnpw...GN....FSYGSTCSFHCPEG......R
ENSTTRP00000002120  ...........................--CTDPG.HQENSVRQIhasgp..HT....FSYGTTVSYQCNHG......F
ENSTTRP00000000827  ...........................--CGPPP.PIDNGDITSfpa....PV....YPPGSTVEYQCQSY......Y
ENSTTRP00000008259  ...........................-TCPRLR.QPKHGRLSCst.....GE....LSYRTVCLVTCDEG......Y
ENSTTRP00000004075  ...........................VRCPPPQ.ILRGQISSGqk.....DQ....YSYNDTVVFACVFG......F
ENSTTRP00000008531  ..........................e--CPKLQ.PPVHGNIEPlq.....AK....YFFKDQVLISCDTG......H
ENSTTRP00000003462  ...........................-SCPEPQ.TPSSGNKIG.......DR....YMVGDVVSFQCDQG......Y
ENSTTRP00000012358  ..........................n--CPDPP.PFQNGYMIN.......SD....YSVGQSVSFECYPG......Y
ENSTTRP00000012358  ...........................-SCLDPG.IPVNGHRHG.......SH....FGIQSTVTFSCNPG......Y
ENSTTRP00000001234  ...........................--CPDPT.APPNGHISPvq.....AT....YIMKDRFFVFCESG......Y
ENSTTRP00000014107  ...........................--CLRPL.ASSNGYVNIsefq...TS....FPVGTVISYHCFPG......F
ENSTTRP00000014813  ......................pickkITCSQPG.VKGGKIISGfg.....PI....YTYKQTIVFDCNKG......Y
ENSTTRP00000012358  .....................lpkclvISCGHPG.VPANAILTG.......DL....FTSGAVVHYSCQGR......R
ENSTTRP00000003824  ...........................--CPSLV.TPKQGTMSCqhrl...GN....FGLNTTCHFACKAG......F
ENSTTRP00000008650  ...........................--CSDPG.GPVNGYKKItggpeliNGry..AKIGTVLTFFCNNS......Y
ENSTTRP00000002120  ...........................-TCADPG.VPQFGIQNNs......QG....YQVGSTVLFRCQKG......Y
ENSTTRP00000004075  ...........................--CQRPF.KIPHGNHTGgdi....AR....FSPGMSILYSCNRG......Y
ENSTTRP00000004075  ...........................VQCSHVH.-IANGYKISske....AP....YFYNDSVIFKCNNG......F
ENSTTRP00000003462  ...........................-SCGDPG.TPLYGIREG.......DG....FSNRDVLRFECQFG......F
ENSTTRP00000002120  ......................pqcllVSCGHPG.SPPHSQMSG.......DN....YTAGAVVRYSCTSK......R
ENSTTRP00000012358  ...........................--CFDPG.NIMNGTRIG.......TD....FKLGSTVTYQCDSG......Y
ENSTTRP00000005169  ..........................m-TCADPG.EITNGHRTTsd.....AG....FPVGSHVQYRCLPG......Y
ENSTTRP00000012358  ...........................VKCEDPG.IPNYGYRIRd......EG....HFTDTVVLYSCNPG......Y
ENSTTRP00000005169  ...........................-TCPELP.PPEWGWRTAsh.....GD....LIRGTVLTYQCEPG......Y
ENSTTRP00000006831  ...........................IFCGRPP.EIKHGKHTNsyr....NI....FEYNELVTYSCNPSngsde.Y
ENSTTRP00000003462  ...........................-QCSSVP.EPRFGRRIG.......NE....FAVGSLVLFECNPG......Y
ENSTTRP00000008259  ..........................c----SPP.VIQNGAVNR.......TD....FGCGQAARIQCFKG......F
ENSTTRP00000002120  ...........................-HCLDPG.IPVNGQRHG.......ND....FYVGALVTFSCDSG......Y
ENSTTRP00000002120  ...........................-SCNDPG.VPQNGSRSG.......DS....WEAGDSTVFQCDPG......Y
ENSTTRP00000002120  .....................lpqcfpVFCGDPG.VPARGRRED.......RG....FSYRSSVFFSCQPP......L
ENSTTRP00000003462  ..........................a--CRDPG.VPMNGTRNG.......DG....REPGDTVVFQCDPG......Y
ENSTTRP00000005589  ........................ckaIRCPRPQ.DFENGEYWPra.....PY....YNLSDEISFHCYDG......Y
ENSTTRP00000008853  ...........................ITCPPPP.IPKFAKLSVyqplsg.NN....SLYGGKAVFECLPQ......H
ENSTTRP00000001261  ...........................ITCPTPT.SVKHADIWV.......KS....YNLNSRERYVCNSG......F
ENSTTRP00000004541  ...........................--CGAPE.PIRHGRVEDp......EN....TLFGSVTRYTCEQP......Y
ENSTTRP00000003873  ..........................t-SCHDPG.DVEHSRRLIss.....PK....FPVGATVQYICDQG......F
ENSTTRP00000004075  ..........................i--CSEPI.VPGGYRNKMsr.....PP....YRHGDSVTFTCNAN......F
ENSTTRP00000000827  ..........................p--CSQPP.QIDHGTINSsssak..ES....YAHGTKLSYTCEDG......F
ENSTTRP00000014813  ...........................--CHSPP.VIAHGHHKS.......LS....ITSTEEATYRCDEG......Y
ENSTTRP00000005562  ........................ckpVRCPAPV.TFENGVYTPrl.....GS....HPVGGNLSFECEDG......F
ENSTTRP00000006831  ..........................s--CPNP-.EIKHGEVYA.......PN....KTFEFQKHISCNEG......Y
ENSTTRP00000002120  ...........................-SCFDPG.PIKNGTRVG.......SD....LKLGSSITYYCQGG......Y
ENSTTRP00000000827  .........................vk-SCAPPP.QLPSGKVKDtqr....EE....YRHSEVVEYVCNPG......F
ENSTTRP00000003462  ...........................-SCKQPE.TPAHANVVGm......DL....PSHGYTLIYTCQPG......F
ENSTTRP00000012358  ...........................-QCSSVP.EPRYGRRIG.......LE....FSAGSIVRFECNPG......Y
ENSTTRP00000003462  ...........................-HCEDPG.IPQFGYKISd......QG....HFAGSTIIYGCNPG......Y
ENSTTRP00000004075  ...........................IFCDPPP.RIKNGRNSYhp.....SP....IAINAVVRYSCSSA......F
ENSTTRP00000002120  ...........................IKCEDPG.TPQFGYKVRd......GG....HFAGSSVSFGCDPG......Y
ENSTTRP00000003462  ...........................-SCGNPG.IPPKGVLYG.......TR....FDVGDKIRYSCVTG......Y
ENSTTRP00000005441  ...........................VACGEPP.VVEHARIFGqkk....DR....YEINSLVRYQCTEG......F
ENSTTRP00000015569  ..........................m-YCTDPG.EVDHSTRLI.......SDpv..LLVGTTIQYTCNTG......F
ENSTTRP00000008259  ...........................--CPVPF.VIPENAVLSe......KE....FYVDQNVSIKCREG......F
ENSTTRP00000007268  ...........................VLCGPPP.AVENALPIGark....AK....YNVHATVRYQCDEG......F
ENSTTRP00000000827  ..........................s-TCGDIP.ELDHGYVNHsa.....PL....YHHGDLVEFSCREA......F
ENSTTRP00000002120  ...........................-QCSSVP.EPRYGRRLG.......SD....FSVGATVRFECNSG......Y
ENSTTRP00000012358  ...........................-YCSLTH.TLKNGGVLNr......TT....GEVGSKVHYFCKPG......Y
ENSTTRP00000003835  ...........................VTCQAQE.APEHGSLVCndpl...GK....FSYNSSCYVSCGEG......Y
ENSTTRP00000005589  ...........................-YCLNPG.IPIGTRKVG.......SQ....YRLEDTVTYYCSRG......L
ENSTTRP00000008259  .......................tchpVSCNEPP.KVENGFLEHt......AG....RTFESEVRYRCNPG......Y
ENSTTRP00000002120  ...........................-SCGDPG.IPAYGWREG.......SW....FRHGDTLQFECQPA......F
ENSTTRP00000008853  ...........................--CPFPS.RPDNGFVNYpak....QV....LYYKDKATYGCHDT......Y
ENSTTRP00000013493  ..........................e--CDVPP.VIPNANLLLphclq..GN....HDVGSICRYKCKPG......Y
ENSTTRP00000008259  ..........................aVSCDEPP.SVEHASPET.......AH....RLFGDIAFYYCSDG......Y
ENSTTRP00000000827  .....................phcvgl-PCGLPP.LIQNGVVPNek.....GS....YQDGEEVTYDCDEG......F
ENSTTRP00000002120  ...........................-KCPPPT.ILPNAEVVTen.....EE....FNIGDIVRYRCLPG......F
ENSTTRP00000008259  ...........................VRCPALK.PPENGYFIQnt.....CN....SHFNAACGVRCHPG......F
ENSTTRP00000005169  ...........................--CLNPG.VPENGYQTLyk.....HH....YQAGESLRFFCYEG......F
ENSTTRP00000003462  ..........................d-----PG.NIMNGTRLG.......MD....YKLGSTVTYYCDAG......Y
ENSTTRP00000002120  ...........................--CPDPG.VPVNGKRFG.......DS....LQLGSSISFLCDEG......F
ENSTTRP00000003829  ...........................--CEPLE.APELGTMACihpl...GN....FSFTSQCAFNCFEG......T
ENSTTRP00000003462  ...................cpsinsft-------.-LEHGRWRIvng....SH....YEYKTKVVFSCDPG......Y
ENSTTRP00000005562  ...........................-HCPNPG.IAAGAVRTG.......SR....FGLGDKVSYRCSSN......L
ENSTTRP00000002416  ..........................n--CNSPP.DIINGAVIGgll....AS....YPTGSSVEYRCNEY......Y
ENSTTRP00000010373  ...........................--CPSPP.ALKDGYVQD.......EGam..FPVGKNIVYTCNEG......Y
ENSTTRP00000012358  ..........................a--CQEPA.LPSNSIKTG.......DR....YMVNDVLSFQCEPG......Y
ENSTTRP00000003462  ...........................--CPDPG.IPINARRFG.......DN....FQLGSSISVICEEG......F
ENSTTRP00000003462  ...........................--CEDPG.IPQYGNRIG.......FS....FGVGDTLAFSCSSG......Y
ENSTTRP00000014813  .......................lclk------P.EIEHGRLSVdk.....DG....YVEPETVTVQCDSR......Y
ENSTTRP00000002120  ...........................--CEEPE.VPAYSIRKG.......LQ....FGVGDTLTFSCFPG......Y
ENSTTRP00000008259  ...........................-SCGPPP.PVSSAVATG.......EV....HTYGSKVKLRCLEG......Y
ENSTTRP00000002416  ...........................-TCASPP.FIKNGVIKSstv....RT....YENGSSVEYRCFEH......H
ENSTTRP00000004541  .................tansfwepdr-------.---------.......AK....YVFKDVVKITCVDG......F
ENSTTRP00000015569  ...........................-SCNFPR.RPDYGDVMV.......MD....LHSGGVAHFHCHLG......Y
ENSTTRP00000012400  ...........................IDCGTPP.EVPDGYIIGn......YT....SRLGSQIRYACKEG......F
ENSTTRP00000003873  ..........................k-PCHGLS.APENGARSPek.....QL....HPAGATIHFSCAPG......Y
ENSTTRP00000012358  ..........................k--CQPPP.AVPQAEMLTed.....ED....FEIGDSVKYQCHPG......Y
ENSTTRP00000003835  ........................cepVKCDAIP.QPRSGSVNCthsp...TG....EFTKSSCAILCEEG......F
ENSTTRP00000000295  ...........................--CVQVQ.PPLQGTFQVlrg....NG....TSVGTVIVFHCPSG......H
ENSTTRP00000003873  ...........................-SCRFPR.RPAYGAVTV.......TS....LHPGGSARFHCATG......Y
ENSTTRP00000008259  ...........................-KCPEPP.LLENQLVLK.......EL....PTEVGVVTFSCKEG......N
ENSTTRP00000012358  ..........................a--CRQPE.TPAHADVRAi......DL....PTFGYTLVYTCHPG......F
ENSTTRP00000002120  ...........................-YCSLPR.APLHGFLLGq......TT....TQPGGSIHFGCNTG......Y
ENSTTRP00000003462  ...........................-VCQPPP.PVPNAEILTed.....DE....FEIGDIIRYQCLPG......F
ENSTTRP00000004065  ..........................s--CDVPT.RLLFASLKKsytkq..NY....FPEGSTVEYDCRLG......Y
ENSTTRP00000003462  ...........................-YCSTPE.SPPHGYIISq......TG....GQLNSVVRWACDRG......F
ENSTTRP00000004065  ...........................--CSLPP.DVPNAQPALgal....TS....FPKQSTVTYKCNEG......F
ENSTTRP00000006831  ...........................--CIDPP.VMESMKLKGvik....RH....YYSGDRINYECRIG......Y
ENSTTRP00000008853  ...........................-ICPKPD.DLPFARFVPlk.....TS....YAPGEEIVFSCQPG......Y
ENSTTRP00000005871  ...........................VACGQPP.VVENAKTFGkmk....PR....YEINSLIRYHCKDG......F
ENSTTRP00000014802  ..........................i--CPELP.PVDNSIFVA.......KE....GEGQILGTYLCNNG......Y
ENSTTRP00000002255  ...........................--CDPPP.PKFHGLYQCt......NG....FQFNSECRVKCEDS......D
ENSTTRP00000003873  .........................cy----EP-.FVKYGNFSSsa.....PS....YPVGTTVEFSCDPG......Y
ENSTTRP00000008259  ...........................--CEKPP.AVSYSILESvsk....AK....FAAGSVVSFKCTEG......F
ENSTTRP00000000827  ....................pacyere--CSIPQ.MENNLDANPkk.....DR....YRCGDVLKFSCIQG......L
ENSTTRP00000008650  .......................pgyq-------.---------.......--....-YLHTQIQYECISP......F
ENSTTRP00000000827  ........................ckeITCDPP-.YIPNGIYTPql.....AK....YRGEYKITYECKSG......F
ENSTTRP00000014107  ..........................q-VCPLPP.MVSHGDFIChprpc..ER....YNHGTVVEFYCDPG......Y
ENSTTRP00000013753  ...........................VSCGPPP.ELPLARVFGrpr....LR....YEVDTVLRYRCLEG......L
ENSTTRP00000008259  ...........................--CPLPA.SITHILVHG.......DD....FSVNKQVSVSCAKG......Y
ENSTTRP00000012400  ...........................INCGRPP.EVQHAVLVGn......HS....SRLGGMAHYVCQEG......F
ENSTTRP00000014107  ...........................-VCADPG.VPENGFRTPsg.....GV....FFESSVTRFHCQDG......F
ENSTTRP00000012358  .....................wrlvsg-------.---------.......SL....NEYGAQVVLSCSPG......Y
ENSTTRP00000015569  ..........................h--CYEP-.YIQNGNFTTsd.....PT....YNIGTIVEFTCDPG......H
ENSTTRP00000000827  .........................iq-SCPPPP.QIPNSRNMTtt.....VT....YQDGEKISILCQEN......Y
ENSTTRP00000011205  ...........................-VCSLPP.EPENGGYIChprpcr.DP....LNSGSVIEYLCAEG......Y
ENSTTRP00000014813  .....................phatwv-------.--RYGYQKLtee....EV....YDIGTELRYSCFPG......Y
ENSTTRP00000015569  ..........................a--CDNPG.LPENGYQILyk.....RL....YLPGESLTFMCYEG......F
ENSTTRP00000000827  ..........................s--CKQP-.TILNGYPISqk.....EI....YKVNERVQYKCARG......F
ENSTTRP00000003514  ...........................--CPQPV.PPENAFIRNer.....KL....YSVGEEVEIICLTG......F
ENSTTRP00000008090  ......................ksylt-------.-LENGKVFL.......TGgdlpALDGARVDFRCDSD......F
ENSTTRP00000010373  ......................cqkia--CVLPA.LMDGIQSHPhk.....PF....YTVGEKVTFSCSGG......R
ENSTTRP00000002255  ...........................--CLAPP.PVPNADLQTarcre..NK....HKVGSFCKYKCRPG......Y
ENSTTRP00000002416  ..........................n-RCPPPP.VPLTSRIQRys.....TT....YRHGETVRIECGLN......F
ENSTTRP00000014431  ........................lrf-------.---------.......NG....TRLGSVALYSCDRG......Y
ENSTTRP00000000827  ........................ylh-------.---NGHYPNyg.....TK....VLQGKTVRVHCYDG......Y
ENSTTRP00000000827  .........................kd--CQEPP.PRRETEILSgswte..QT....YPEGTRATYKCRPG......Y
ENSTTRP00000001262  ...........................-HCKEPP.PWEYEHEPLkri....YH....FMAGQTVYYQCIQG......F
ENSTTRP00000013836  ...........................--CGFPD.KVEDGDFLL.......CE....ESGRRVLVFSCRHG......F
ENSTTRP00000002255  .....................cgvpdq------H.HVYAASFSCl......KG....TTFGSTCSFQCRHP......A
ENSTTRP00000005562  ...........................-SCPQNV.NISRGTFTLs......NG....WAPGSILTYSCPLG......F
ENSTTRP00000014813  .........elnngritrlrksdidns-------.---------.......CT....YFYRDQVSYTCHEK......Y
ENSTTRP00000010558  .......................nyhs-------.---------.......--....-SLGTRCELSCDRG......F
ENSTTRP00000014107  .....................cvqedc---RIP-.QIEDAEIHN.......KT....YRHGDKLIITCHEG......F
ENSTTRP00000000827  ..........................i--CFNVP.SFDDAILIDrkk....KS....YRSGEQVVFKCLPS......Y
ENSTTRP00000005169  ........................cfa------P.FLAHGNVTTtd.....PE....YRPGALATFSCLPG......Y
ENSTTRP00000000827  .........................ik-------.---NGLFSEta.....FT....YPLNKQTKYKCKPG......Y
ENSTTRP00000004634  .......................gyyk-------.---------.......--....TALGTRCDIRCQKG......Y
ENSTTRP00000000827  ..........................s--CDMP-.VFENARARSdg.....TW....FKLNDSLDYECLDG......L
ENSTTRP00000015914  ..........................p--CGDPP.SFPHTILQGh......TG....LEMGDELLYLCAPG......H
ENSTTRP00000003462  ..........................x-------.---------.......-K....YTFGSTVRYSCTGK......H
ENSTTRP00000001793  ...........................--CLKPP.EIANGY---.......--....--LEHLVRYRCKTY......Y
ENSTTRP00000001262  .......................acle----DPP.SLRNAMFKV.......LR....YEVGTMINCDCKKG......F
ENSTTRP00000002416  ..........................t-KCPKP-.DLRNGYIFD.......TKlf..YKIQENMRYRCASG......Y
ENSTTRP00000003514  ......................cqrte--CLKPV.VQEVLTLSPfq.....TL....YKIGESIELTCPRG......F
ENSTTRP00000002416  ..........................t--CLAPE.-LHHGNYSTtq.....KM....FKVKDKIRYECASG......Y
ENSTTRP00000012358  ........................gds-------.---------.......--....-RERDTITFQCDPG......Y
ENSTTRP00000012358  ...........................--CDDPG.VPAFSRRIG.......FH....FGVGDSLTFSCFPG......Y
ENSTTRP00000008259  ..........................r-HCSTFQ.KPRGVIVSPptcgk..HP....AKPGTICQLSCHQG......F
ENSTTRP00000002255  ..........................d--CPKL-.AVENASLNCss.....SD....RYHGAQCTVSCRTG......Y
ENSTTRP00000002416  ...............qyyytfesyyfp-------.---------.......--....MSINQNLSFSCLAG......Y
ENSTTRP00000008090  .......................nflp-------.---------.......--....--VDYEIEYVCRGE......R
ENSTTRP00000000827  ....................prcsfkp--CDFP-.VIKHGSIYGhrgy...FP....VSLGYWIRFDCDQY......F
ENSTTRP00000005589  ..................ikggsfrll-------.---------.......--....-KAGQSLEYLCPSG......F
ENSTTRP00000013493  ........................cvpVVCEPPS.PVFEGMYECt......NG....FELNSQCVLNCNEE......S
ENSTTRP00000004075  .........................ns-------.---------.......--....---------SCDEG......Y
ENSTTRP00000013493  .......................segt-------.---------.......--....-NFLKRCSISCVPP......A


                            40                   50                   60          70                
                             |                    |                    |           |                
d2z3qb1               KRK.AGTSS...........LTECVLNKATNVAHWT......TP.....SLKCIRD..P-----------alvhqrpa
ENSTTRP00000002416  YI-.-----...........----------------......--.....-------..------------efpiigse
ENSTTRP00000008853  K--.-----...........----------------......--.....-------..------------kcsyteda
ENSTTRP00000012358  RLV.--GTS...........VRICLQDH-----KWS......GH.....TPVCVPI..TCGHPGNPAHG-........
ENSTTRP00000000827  CIK.ASSSAl..........RTTCREGK--------......--.....-------..------------layptc..
ENSTTRP00000012358  TME.PATSS...........TIRCTKDS-----AWD......HS.....KPTCKAV..MCGQPPPVQDG-........
ENSTTRP00000003462  RLI.--GSS...........VRICQQDH-----NWS......GQ.....LPSCVPV..SCGHPGSPIYG-........
ENSTTRP00000008259  YIK.--GEK...........KSACEATG-----QWS......SP.....IPTCHPV..SCNEPPKVENG-........
ENSTTRP00000012358  LLQ.--GAS...........RAQCRSNG-----QWS......SP.....LPTCRVV..NCSDPGFVEN--a.......
ENSTTRP00000002120  RLI.--GMS...........VRICQQDH-----HWS......GK.....TPFCVPI..TCGHPGNPMNG-........
ENSTTRP00000012358  QLR.--GSA...........ERTCLLNG-----SWS......GL.....QPVCEAV..SCGNPGTPTHG-........
ENSTTRP00000002120  MME.SHRVS...........VLSCTKDR-----TWN......GT.....KPVCKAI..MCKPPQLIPNG-........
ENSTTRP00000003462  LMQ.--GPT...........KAQCQANR-----QWS......HP.....PPMCKVV..NCSDPGIPAN--........
ENSTTRP00000008259  TLA.--GPD...........TIECLANG-----KWS......RS.....DQQCLAV..SCDEPPSVE---h.......
ENSTTRP00000008259  QLM.--GVA...........KITCLESG-----EWS......HL.....IPYCEPV..SCGAPAIPENG-........
ENSTTRP00000008259  ELE.--GNR...........ERVCQENG-----QWS......GE.....VATCKKT..KCEAPLGFLNG-........
ENSTTRP00000002120  QLS.--LPA...........VLTCEGNG-----SWT......GE.....LPQCFPV..FCGDPGVPARG-........
ENSTTRP00000002120  MLR.--GSS...........ERTCQANG-----SWS......GT.....QPECGVI..SCGNPGTPSN--a.......
ENSTTRP00000004075  NLI.--GES...........TIRCTSND-QETGIWS......GP.....APVCK--..------------........
ENSTTRP00000004075  ILT.--GER...........TIRCTTDS-QKTGTWS......GP.....APRCE--..------------........
ENSTTRP00000014813  ILI.--GSA...........TSFCEIQD--KGVGWS......DP.....LPRCEIV..KCEPPPAISNG-........
ENSTTRP00000008259  TLE.--GEK...........ESSCLASS-----SWS......HS.....PPLCELV..KCSSPEDINNG-........
ENSTTRP00000003462  ILS.--GPS...........VRQCTANG-----TWS......GT.....LPNCTII..SCGDPGIPASG-........
ENSTTRP00000003462  ILH.--GSE...........ERTCLPNG-----SWT......GR.....QPECKAV..QCGNPGTTANG-........
ENSTTRP00000004075  LLL.--GEK...........TIRCLSSG-----DWS......AV.....APTCKEA..ECKPPGPFLNG-........
ENSTTRP00000008259  VLH.--GAP...........KLICQSDG-----NWD......AQ.....VPLCKPV..SCGPPEDLAHG-........
ENSTTRP00000008853  YLK.--GAN...........SVQCTKEG-----EWS......QK.....LPVCAPI..TCPPPPI-----p.......
ENSTTRP00000002120  VAE.--GAA...........RSQCLASG-----QWS......DV.....LPTCRII..NCTDPG------hqe.....
ENSTTRP00000003462  TME.LNGSR...........IRTCTTNG-----TWS......GV.....MPACRAV..TC----------........
ENSTTRP00000001935  SLA.--GAE...........ASTCQTDG-----TWS......QP.....TPTCQR-..------------........
ENSTTRP00000003462  MLV.--GSA...........VRECFSSG-----LWS......GS.....ETRCLAG..HCGIPELIVNG-........
ENSTTRP00000003462  ELS.--FPA...........VLTCVGNG-----TWS......GE.....VPQCLPK..FCGDPGIPAQG-........
ENSTTRP00000008259  YLL.--GDS...........RMFCTDNG-----SWN......GI.....SPSCL--..------------d.......
ENSTTRP00000008259  FLR.--GDA...........TTFCQADG-----TWS......SP.....LPECAPV..ECPQPEEILHG-........
ENSTTRP00000014813  SML.--GTA...........SISCRLEN-KTIGVWN......PS.....PPICK--..------------........
ENSTTRP00000014802  YLV.--GTQ...........QQQCI-DG-----EWS......ST.....LPVCE--..------------l.......
ENSTTRP00000003835  KLT.--GPQ...........HLQCISSG-----IWD......NK.....KPTCKAV..TCDAISHPQNG-........
ENSTTRP00000012358  YLL.--GSS...........ALTCMANG-----LWD......RS.....LPKCLVI..SCGHPGVPAN--........
ENSTTRP00000008259  QVA.--GHA...........MQTCEESG------WS......SS.....IPTCVLI..DCGLPPHI----df......
ENSTTRP00000012479  RLV.--GPS...........SVVCLPNG-----TWT......GE.....QPRCRDI..SECSSQPCQN--g.......
ENSTTRP00000008259  TLV.--GSD...........VRLCLQNR-----EWS......GT.....SPLCEAI..SCPKP-------........
ENSTTRP00000012358  RTS.--GLT...........TRHCTANG-----TWT......GT.....APDCTLI..SCGDPGTPANG-........
ENSTTRP00000003462  FLF.--GSS...........VLICQPNG-----QWD......KP.....LPECI--..------------........
ENSTTRP00000008259  RLK.--GPK...........ALTCLETG-----DWD......VD.....VPSCSAI..HCDPP-------h.......
ENSTTRP00000008259  SLQ.--GPL...........VIECSASG-----SWD......RA.....PPTCHLV..SCGEPPAI----k.......
ENSTTRP00000003824  TLN.--GPS...........ELECLASG-----IWT......NT.....PPQCVAV..QCP---------p.......
ENSTTRP00000003824  ALV.--GPE...........VVQCTASG-----VWT......AP.....APVCQ--..------------........
ENSTTRP00000002120  DLQ.--GSK...........RITCMKVS-DMFAAWS......DH.....RPVCRAR..MCDAHLRGPS--g.......
ENSTTRP00000002120  YAT.--GLL...........SRHCSVNG-----TWT......GS.....DPECIVI..NCGDPGIPANG-........
ENSTTRP00000012358  KLD.AGQQA...........TAVCQEDG-----LWS......NRgk...PPTCKAV..TCP---------gi......
ENSTTRP00000003462  VLQ.--GAK...........SITCQRIA-EVFAAWS......DH.....RPVCKVK..TCGSN-------lqgps...
ENSTTRP00000012358  ILV.--GSS...........RRICQADG-----TWS......GT.....QPTCI--..------------d.......
ENSTTRP00000008259  ELI.--GDH...........SWTCLKSG-----KWNk.....KP.....NQKCVPA..KCPEPPLLE---n.......
ENSTTRP00000003462  TLI.--GNS...........ALTCL---HGVSRNWN......HP.....LPRCEA-..LCGGNITAMN--g.......
ENSTTRP00000003824  KLE.--GSS...........HVECTASG-----RWT......AP.....RPTC---..------------d.......
ENSTTRP00000008259  VLE.--GSL...........RSVCLENG-----TWT......-S.....PPVCRAV..C-----------rfp.....
ENSTTRP00000008259  VIR.--GSS...........DLICTEKG-----TWS......QP.....YPVCEPL..SCGPPPPV----ss......
ENSTTRP00000003462  LLQ.--GST...........TRTCLPDL-----TWS......GI.....QPECIPH..SCKQPETPA---h.......
ENSTTRP00000003462  ILV.--GSS...........TRICQADG-----TWS......GS.....SPHCIE-..------------........
ENSTTRP00000003824  LLV.--GAS...........VLQCLDTG-----NWN......AP.....FPECQA-..------------........
ENSTTRP00000008259  VLN.--GTD...........RRTCQENK-----NWD......RN.....EPICIP-..------------v.......
ENSTTRP00000012358  HVQ.--GST...........TRTCLANL-----TWS......GI.....QTECIPH..ACRQPETPA---h.......
ENSTTRP00000008259  ELL.--GNP...........VLICQEDG-----TWN......GS.....APSCISV..ECDLPVAPENG-........
ENSTTRP00000003824  SLS.--GPE...........RLDCTPSG-----RWT......DS.....PPTCD--..------------a.......
ENSTTRP00000012358  QLS.--HPA...........ILSCEGRG-----VWK......GE.....VPQCLPV..FCGDPGTPAEG-........
ENSTTRP00000010558  HLE.--GDR...........SRICMEDG-----RWS......GG.....EPVCV--..------------d.......
ENSTTRP00000003835  VLQ.--GPA...........QVECTTQG-----QWT......QQ.....VPVCEA-..------------........
ENSTTRP00000004075  VLV.--GEE...........SIHCTSEG-----VWI......PT.....APTCKVA..EC----------e.......
ENSTTRP00000003873  QVV.--GSS...........VLMCQWDL-----TWS......ED.....LPSCQRV..TS----------chd.....
ENSTTRP00000008259  SLE.--GAP...........EASCTENG-----TWS......HP.....VPLCKPN..PCPVPFV-----i.......
ENSTTRP00000002120  QLM.--GHP...........VLTCQ---HGTNRNWD......HP.....LPRCEV-..PCGGNVTSFN--g.......
ENSTTRP00000008259  KLH.--GSP...........SRKCLSNS-----SWS......GS.....PPSCLPC..TCSPP-------v.......
ENSTTRP00000002120  TLV.--GSR...........VRECMANG-----LWS......GS.....EVRCL--..------------........
ENSTTRP00000003132  ILE.--GHA...........ILTCIVSP-GNGASWD......FP.....APFCRA-..------------e.......
ENSTTRP00000008259  ELV.--GNS...........TTLCGENG-----HWL......GR.....KPTCKPI..ECPKP-------........
ENSTTRP00000015569  DIV.--GSD...........TLTCQWDL-----SWS......SD.....PPFCEKIm.YCT---------dpg.....
ENSTTRP00000012358  TLV.--GSH...........VRECLANG-----LWS......GP.....ETRCLAG..HCG---------........
ENSTTRP00000014802  VLK.--GSN...........WSRCLENH-----TWV......PP.....FPVCKSR..DCGPP-------........
ENSTTRP00000004075  RLQ.--GPP...........SSQCVIVG--QRAFWT......-K.....FPVCEEI..LCPPPPPILNG-........
ENSTTRP00000006831  YLN.--GSN...........LVFCGGNN-----TWE......PE.....MPKCIK-..------------........
ENSTTRP00000012358  ELV.--GER...........VITCQQNN-----QWS......GN.....KPSCVF-..------------scffnf..
ENSTTRP00000002120  FLE.--GHA...........VLTCHAGS-ENSATWD......FP.....LPSCRA-..------------d.......
ENSTTRP00000004634  ELQ.--GSP...........ARVCQSNL-----AWS......GT.....EPTCAA-..------------........
ENSTTRP00000008259  LLE.--GAS...........SRVCLADG-----SWS......GT.....TPICVPV..RCSPPLQVANG-........
ENSTTRP00000003829  ELI.--GAK...........KTICGSSG-----NWS......SP.....SPICQK-..------------........
ENSTTRP00000008259  QMV.--GNA...........VQYCLNQG-----QWT......QP.....LPLCERI..SCGVPPPLENG-........
ENSTTRP00000002120  ALQ.--GHA...........HISCM---PGTVRRWN......YP.....PPLCIA-..QC----------gg......
ENSTTRP00000001234  TMR.-TDDG...........KYVCEADG-----FWT......SSkgeksPPVCEPV..C-----------gi......
ENSTTRP00000003824  TLR.--GAD...........TVRCADLG-----QWT......AP.....APVCQAL..QCQY--------l.......
ENSTTRP00000005169  QLQ.--GEE...........TLICL---NGTRPAWS......SE.....PPSCM--..------------x.......
ENSTTRP00000003462  RLS.--HEE...........PLLCEKNH-----WWS......HP.....LPTCDAL..------------cgg.....
ENSTTRP00000002416  YLS.--GSD...........LIQCYNFG------WY......PE.....SPVCE--..------------........
ENSTTRP00000000827  ILD.--GPK...........QIHCSTDG-----IWS......EE.....KPKCV--..------------........
ENSTTRP00000003824  LLS.--GSA...........RTVCQENG-----QWS......AI.....VPACQ--..------------........
ENSTTRP00000002120  YLL.--GTP...........VLSCQGDG-----TWD......RP.....RPQCLLV..SCGHP-------g.......
ENSTTRP00000000827  ELQ.--GKR...........HIVCQ-NG-----EWS......-E.....PPKCLD-..------------acv.....
ENSTTRP00000008259  RLE.--GSA...........RLTCQVNA-----QWD......GL.....EPRCVER..HCSTF-------qk......
ENSTTRP00000004075  TMK.--GSK...........GIRCNAQG-----SWE......PS.....VPVCEK-..DCQAPPKILHG-........
ENSTTRP00000008531  KVL.KDNVEmdtf.......QIECLKDG-----TWS......NK.....IPTCKIV..DCGAP-------........
ENSTTRP00000003462  SLQ.--GHS...........HITCM---PGPVRRWN......YP.....IPICLA-..------------qcg.....
ENSTTRP00000012358  ILI.--GHR...........VLTCQ---HGINRNWN......YP.....FPRCDA-..PCGYNVTSQNG-........
ENSTTRP00000012358  TLS.--DDE...........PLVCERNH-----QWS......HA.....LPSCDAL..------------cgg.....
ENSTTRP00000001234  ELL.QGY-Wplksf......VAVCQTDG-----SWD......QP.....MPECSIV..DCGPP-------........
ENSTTRP00000014107  KLE.--GSE...........YLECLHNL-----IWS......SS.....PPRCLA-..------------........
ENSTTRP00000014813  RLK.--GNK...........LIHCGVDN-----SWH......PP.....PPICE--..------------........
ENSTTRP00000012358  SLV.--GNS...........SRTCQEDS-----HWS......GA.....LPHCT--..------------........
ENSTTRP00000003824  TLM.--GDS...........ALRCRPSG-----QWT......AG.....APACRAV..KCSK--------lh......
ENSTTRP00000008650  VLS.--GNE...........MRTCQQNG-----EWS......GK.....QPICIK-..AC----------repk....
ENSTTRP00000002120  LLQ.--GST...........TRTCLPNL-----TWS......GT.....PPDCV--..------------x.......
ENSTTRP00000004075  LLV.--GEA...........VLLCTHEG-----TWN......GP.....VPYCK--..------------........
ENSTTRP00000004075  TLK.--GSS...........QVRCKANN-----TWD......PE.....TPVCE--..------------........
ENSTTRP00000003462  ELI.--GEK...........SIVCQENN-----QWS......AN.....IPICIF-..------------pcl.....
ENSTTRP00000002120  TLV.--GNA...........TRMCGLDG-----HWT......GS.....LPHC---..------------........
ENSTTRP00000012358  KIA.--DPS...........SITCVIGA-DGKPAWN......RV.....LPSCNA-..PC----------ggq.....
ENSTTRP00000005169  SLE.--GAA...........VLTCYSRD-TGTPKWS......DR.....VPKC---..------------........
ENSTTRP00000012358  AMH.--GGN...........TLTCL---SGDRRVWD......RP.....LPSCVAE..CGG---------qihaat..
ENSTTRP00000005169  ELL.--GSD...........ILTCQWDL-----SWS......AA.....PPACRK-..------------........
ENSTTRP00000006831  SLV.--GER...........QLICSGPG-----KWS......SA.....APLCK--..------------........
ENSTTRP00000003462  ILH.--GSF...........AIRCDSVP-NSLAQWN......DS.....LPTCIV-..PC----------ggi.....
ENSTTRP00000008259  QLL.--GVS...........EITCEANG-----QWS......SG.....FPRCEHT..SCGSPPTIPN--a.......
ENSTTRP00000002120  TLS.--DGE...........PLECEPNF-----QWS......RA.....LPSCEAL..------------cgg.....
ENSTTRP00000002120  ALQ.--GSA...........EISCVK--IENRFFWQ......PS.....PPTCIA-..PC----------gg......
ENSTTRP00000002120  VLV.--GSP...........RRFCQSDG-----TWS......GT.....QPSCI--..------------........
ENSTTRP00000003462  ELQ.--GEE...........RITCIQ--VENRYFWQ......PS.....PPVCIX-..------------........
ENSTTRP00000005589  NLR.--GSA...........NRTCQATG-----RWD......GE.....TAIC---..------------d.......
ENSTTRP00000008853  AMF.--GND...........TVTCTEHG-----NWT......-E.....LPECKEV..KCPFPSRPDNG-........
ENSTTRP00000001261  KRK.AGTSS...........LTECVFNKTVNIAHWT......TP.....NLKCIR-..------------dp......
ENSTTRP00000004541  YYMeNERSE...........EYRCAGNG-----SWV......NEllgaeLPKCIP-..VCGVP-------ge......
ENSTTRP00000003873  VLT.--GSA...........ILTCHDR-QASSPKWS......DR.....PPKCL--..------------........
ENSTTRP00000004075  TMK.--GNK...........TVWCQANK-----TWG......PTp....LPTCE--..------------........
ENSTTRP00000000827  SIS.--EEN...........VITCHMG------KWS......-S.....PPHCVGL..PCGLPPLIQNG-........
ENSTTRP00000014813  TLV.--GKN...........KLSCSSSG------WS......SE.....APQCKAL..C-----------lkpe....
ENSTTRP00000005562  TLR.--GSP...........VRHCRPNG-----MWD......GE.....TAVC---..------------........
ENSTTRP00000006831  YLR.--GKS...........ILTCNR--IGGNVHWS......DK.....IPHCEKI..FCGRPPEIKHG-........
ENSTTRP00000002120  EVE.--GFS...........TLSCILGP-DGKPVWN......HP.....QPVCTA-..PCG---------gqyv....
ENSTTRP00000000827  LMK.--GSH...........KIQCV-DG-----QWT......-A.....LPMC---..------------........
ENSTTRP00000003462  FLA.-GGTE...........HRVCRSDN-----TWS......GK.....VPVCEA-..------------........
ENSTTRP00000012358  LLQ.--GSM...........AIRCQSVP-NALAQWN......DT.....IPSCVV-..------------pcs.....
ENSTTRP00000003462  TLH.--GSS...........LLKCM---TGERRAWD......YP.....LPSCIA-..------------ecg.....
ENSTTRP00000004075  RLI.--GES...........ILFCITKD-NVNGIWD......KA.....APICE--..------------........
ENSTTRP00000002120  SLR.--GSE...........ALLCL---SGERRTWD......RP.....LPTCVA-..------------ecg.....
ENSTTRP00000003462  ILD.--GHP...........QLTCIASS-VNTASWD......FP.....VPICRA-..------------e.......
ENSTTRP00000005441  VQR.--HVP...........TIRCQPSG-----HWE......DP.....RITCT--..------------d.......
ENSTTRP00000015569  VLE.--GSS...........LLTCYSRE-TGTPIWT......SR.....LPHCV--..------------........
ENSTTRP00000008259  LLQ.--GQS...........IITCNPDE-----TWT......QT.....SARCEKI..SCGPPTHVEN--a.......
ENSTTRP00000007268  AQH.--HVA...........IIRCRSNG-----KWD......RP.....QIVCTK-..------------........
ENSTTRP00000000827  TMI.--GPR...........SVTCI-SG-----KWT......-Q.....PPQC---..------------........
ENSTTRP00000002120  ALQ.--GSP...........EIECLPVP-GALAQWN......VS.....APTCVV-..------------pcg.....
ENSTTRP00000012358  RMI.--GHS...........NATCRRNP-VGMYQWD......SL.....APLCQAV..SCGIP-------........
ENSTTRP00000003835  LPS.--SPE...........ATQCTSSG-----EWS......VP.....LPACNMA..KCDALRSPVNG-........
ENSTTRP00000005589  TLR.--GSK...........QRTCQEGG-----SWS......GT.....EPSCH--..------------d.......
ENSTTRP00000008259  KSV.--GSP...........VFVCQANR-----HWH......SE.....SP-----..------------........
ENSTTRP00000002120  ELV.--GQK...........AITCQKNN-----QWS......AK.....KPGCVF-..------------scffnf..
ENSTTRP00000008853  ALD.--GPE...........EVECGKFG-----KWS......-A.....QPSCKA-..------------sck.....
ENSTTRP00000013493  YVM.--GSAenkvrnkfl..KIQCLEDG-----IWE......--.....QGSCVPV..VCEPP-------........
ENSTTRP00000008259  SLA.--DNS...........QLLCNAQG-----KWV......PPegqa.VPRCIAH..FCEK--------p.......
ENSTTRP00000000827  GID.--GPA...........SIRCL-GG-----KWS......-L.....PPECI--..------------........
ENSTTRP00000002120  TLV.--GNE...........ILTCK---LGTYLQFE......GP.....PPICEV-..HC----------pt......
ENSTTRP00000008259  DLV.--GSS...........IFLCLPDG-----LWS......GS.....ESSCRAR..TCPRLRQPKHG-........
ENSTTRP00000005169  ELI.--GEV...........TITCV---PGHPSQWT......SQ.....PPLCKV-..------------sqttdp..
ENSTTRP00000003462  VLQ.--GYS...........TLTCIIGD-DGRPGWN......RA.....LPSCHA-..PC----------gsr.....
ENSTTRP00000002120  LGT.-QGSE...........TITCILKE--GSVVWN......SA.....VLRCEAP..CGGH--------ltsp....
ENSTTRP00000003829  DIV.--GIE...........ETTCGPFG-----NWS......SP.....KPTCRVI..QCEP--------l.......
ENSTTRP00000003462  HGL.--GPA...........SIECLPNG---TWSWR......NE.....RPYCQII..SCGELPTPPNG-........
ENSTTRP00000005562  VLT.--GSV...........ERECQDDG-----VWS......GM.....EPICR--..------------q.......
ENSTTRP00000002416  LLR.--GAK...........ISHCE-QG-----KWS......-S.....PPVCL--..------------x.......
ENSTTRP00000010373  SLV.--GDP...........VARCGENL-----QWL......VG.....KMHCQKI..ACVL--------p.......
ENSTTRP00000012358  TLQ.--GRS...........HISCM---PGTVRRWN......YP.....SPLCIA-..------------........
ENSTTRP00000003462  IKT.-QGTE...........TITCIL--MDGKVMWS......GP.....IPKCGA-..------------pcgg....
ENSTTRP00000003462  RLE.--GTP...........EIICLGG---GRRVWS......AP.....LPRCVA-..------------........
ENSTTRP00000014813  GLV.--GSQ...........NTTCSENR-----TWY......PE.....VPKCEW-..------------e.......
ENSTTRP00000002120  RLE.--GTA...........RITCL---GGRRRLWS......SP.....LPRCVA-..EC----------gns.....
ENSTTRP00000008259  MMD.-TEID...........TFTCQKDG-----RWF......PE.....RISCSPK..KCPLP-------........
ENSTTRP00000002416  FLQ.--GSK...........ESYCL-EG-----VWT......-T.....PPLC---..------------........
ENSTTRP00000004541  EVV.Q-GSVgltsf......YSTCQSNG-----KWS......NS.....KLRCQPV..DCGAP-------........
ENSTTRP00000015569  ELQ.--GAK...........TLTCI---NASKPHWS......SQ.....EPICSA-..------------pcg.....
ENSTTRP00000012400  FSG.-PEDT...........VSSCTALG-----TWE......SP.....KLNCQEI..NCGRPPE-----vq......
ENSTTRP00000003873  VLK.--GQA...........SIKCV---PGHPSHWS......DP.....PPICR--..------------........
ENSTTRP00000012358  TLS.--GTD...........TLTCM---LGSQLQFE......GS.....LPTCEX-..------------........
ENSTTRP00000003835  ELR.--GSP...........QLECTSQG-----QWT......QE.....VPSCQ--..------------........
ENSTTRP00000000295  QMV.--GSG...........LLTCVWKG--SIAEWS......SE.....TPMCK--..------------t.......
ENSTTRP00000003873  QLK.--GAR...........LLTCL---NATQPLWD......SQ.....EPVCIG-..------------eypg....
ENSTTRP00000008259  ALQ.--GPS...........VLKCLPSQ-----QWN......DS.....FPVCKMV..LCLPPPLIPFG-........
ENSTTRP00000012358  FLA.-GGSE...........HRTCKADM-----KWT......GK.....SPVCK--..------------........
ENSTTRP00000002120  RLV.--GHS...........MAICTRHP-QGYHLWS......EA.....IPLCQ--..------------........
ENSTTRP00000003462  TLV.--GNA...........ILTCR---LGERLQMD......GA.....PPVCQV-..------------lcp.....
ENSTTRP00000004065  MRD.HSLSG...........KVTCLQNF-----TWS......KP.....DEFCKKK..SCANPREIKNG-........
ENSTTRP00000003462  RLV.--GKS...........SAVCRKSS-YGYHTWD......AP.....VPACQX-..------------........
ENSTTRP00000004065  VKV.PGKGD...........SVVCLDNK------WS......-E.....LAECNR-..SCDV--------pt......
ENSTTRP00000006831  FYV.-WPFS...........SHTCEPNG-----SWS......PI.....EEACLRK..SCPNP-------e.......
ENSTTRP00000008853  VSR.-GGIR...........RFTCPLTG-----FWP......IN.....TLRCTPR..VCPFA-------gil.....
ENSTTRP00000005871  IQR.--HLP...........TIRCLGNG-----RWA......MP.....KITC---..------------........
ENSTTRP00000014802  HLV.--GEK...........TLFCNASK-----GWN......AS.....APECCLG..HCPDPL------lv......
ENSTTRP00000002255  ATQ.GHGSN...........VIHCRKDG-----TWS......GS.....FHVCQEMqgQ-----------csapd...
ENSTTRP00000003873  TLE.-QGSI...........IIECV---DPHDPQWN......ET.....EPACRAV..CS----------ge......
ENSTTRP00000008259  VLN.--TSA...........KIECLRGG-----QWN......PSpm...SIQCIPV..RCGEPP------r.......
ENSTTRP00000000827  IMV.--GAV...........SIQCYHFG------WS......PN.....LPTCK--..------------........
ENSTTRP00000008650  YRR.-LGSS...........RRTCLRTG-----KWS......GR.....APSCIPI..C-----------gkt.....
ENSTTRP00000000827  APV.-IQGN...........VATCTSQG------WS......-P.....APRC---..------------s.......
ENSTTRP00000014107  SLT.-SDYK...........YITCQYGE-----WFP......SY.....QV-----..------------yc......
ENSTTRP00000013753  AQR.--NLP...........LIRCQENG-----RWE......PP.....QISCV--..------------........
ENSTTRP00000008259  TYE.--GVN...........ISTCQVDG-----TWE......PPfs...DESCSPV..SCGKP-------........
ENSTTRP00000012400  ESP.-GGKI...........TSVCTEKG-----IWR......TS.....TLSCTE-..------------i.......
ENSTTRP00000014107  KLK.--GST...........KRLCMKHL-NGTLGWI......PSd....KPVCV--..------------........
ENSTTRP00000012358  YLE.--GQR...........LVQCHANG-----TWSig....AE.....RPRCRVI..SCGS--------l.......
ENSTTRP00000015569  SLE.--QPA...........IIECI---NVRDPYWN......DT.....EPLCRA-..------------mc......
ENSTTRP00000000827  LIE.--DEE...........ELVCK-DG-----RWQ......-S.....IPRC---..------------........
ENSTTRP00000011205  MLK.-GDYK...........YLTCK-NG-----EWK......PA.....-------..------------meisc...
ENSTTRP00000014813  KPK.ADGPT...........TVTCQRNL-----EWT......-P.....YIQCEEA..CCP---------v.......
ENSTTRP00000015569  ELM.--GDV...........IIPCI---LGQPSPWN......GP.....LP-----..------------........
ENSTTRP00000000827  GYG.--ERG...........DAVCTEFG------WT......-P.....VPSCKEI..TCDPP-------........
ENSTTRP00000003514  KPV.--GYQ...........YFSCLPDR-----TWR......RG.....DVECQRT..ECL---------kp......
ENSTTRP00000008090  HLV.--GSS...........RSICS-QG-----QWS......TP.....KPHCQ--..------------........
ENSTTRP00000010373  SLE.--GPS...........TFLCGSSL-----KWS......P-.....-------..------------e.......
ENSTTRP00000002255  HVP.--GSSrkskkraf...KTQCTQDG-----SWQ......--.....EGACVPV..TCDPP-------........
ENSTTRP00000002416  ERQ.--GSE...........EIRCE-NG-----KWT......--.....-------..------------e.......
ENSTTRP00000014431  SPS.-TSNH...........IRVCQPQG-----VWS......-E.....PPQCHEI..------------decrs...
ENSTTRP00000000827  SLQ.-NNQN...........TMTCTENG------WS......-P.....PPRCIRV..------------ktcsk...
ENSTTRP00000000827  RTL.--GSI...........VMVCK-DG-----KWQ......SL.....H------..------------p.......
ENSTTRP00000001262  RPL.QGGPT...........KSTCKM--IYGSMRWT......QP.....KLECI--..------------........
ENSTTRP00000013836  QLH.--GPE...........EVACTRRG------WD......SR.....PPVCKDI..------------nec.....
ENSTTRP00000002255  QLK.-GNNS...........LLTCMEDG-----LWS......FP.....EALCEL-..LC----------lapp....
ENSTTRP00000005562  YPY.--PVA...........TSLCKSNG-----RWHfprstqQT.....KAVCKPV..RCPAPVTFENG-........
ENSTTRP00000014813  THH.-----...........-ATCTEDG-----TWS......PR.....TPECYP-..DCHSP-------pv......
ENSTTRP00000010558  RLI.--GRR...........SVQCLPSR-----RWS......-G.....TAYCRQM..RCHAL-------p.......
ENSTTRP00000014107  KIR.YPDLYnm.........ASLCRDDG-----TWD......-H.....LPICQ--..------------........
ENSTTRP00000000827  RLE.--GAN...........TIQCIKSK------WI......G-.....-------..------------rpac....
ENSTTRP00000005169  ALE.PPGPPn..........AIECV---DPTEPHWN......DT.....EPACKAM..C-----------gg......
ENSTTRP00000000827  VTA.DGNTSg..........LITCLQSG------WS......-V.....QPVCIK-..SCD---------mp......
ENSTTRP00000004634  ELH.--GSS...........QLICQSNR-----RWS......-D.....KVICK--..------------x.......
ENSTTRP00000000827  ESR.-DGHTtg.........SIVCGENG------WS......-D.....RPACYER..ECSIP-------........
ENSTTRP00000015914  VTG.RRETAf..........TLLCNSCG-----EWY......GL.....VQAC---..------------........
ENSTTRP00000003462  TFS.--VQS...........SRTCQLNG-----HWS......GS.....QPHC---..------------s.......
ENSTTRP00000001793  KLR.-TGDG...........VYTLNTEK-----QWI......NKdlgeqLPECEA-..VCG---------kpkh....
ENSTTRP00000001262  RRR.---SP...........FMRCTGNS--SHSAWE......N-.....-------..------------rch.....
ENSTTRP00000002416  KTT.TG-QDeg.........VVQCLPVG------WS......-S.....QPTCRK-..------------........
ENSTTRP00000003514  VVA.--GPS...........RYTCSGDS------WT......PP.....-------..------------i.......
ENSTTRP00000002416  HTA.S-GKRte.........EVECHPYG------WA......-L.....TPRCAKL..IC----------........
ENSTTRP00000012358  QLQ.--GQA...........KITCVQ--LNNRFFWQ......-P.....DPTCIX-..------------........
ENSTTRP00000012358  RLE.---AT...........KLTCL---GGVRRVWS......AS.....LP-----..------------........
ENSTTRP00000008259  ILS.-GGRE...........EVRCTTSG-----KWS......A-.....-------..------------kv......
ENSTTRP00000002255  VLQ.IQRDDeliksqtgpsvTVTCT-EG-----KWN......-K.....QVVCEPV..DCGVP-------........
ENSTTRP00000002416  TTE.TGKQEa..........QTTCTAAG------WS......-P.....EPRCFT-..KCP---------kpd.....
ENSTTRP00000008090  EVV.--GPK...........VRKCLANG-----SWTdm....DT.....PSRCVRI..C-----------sk......
ENSTTRP00000000827  VPQ.-DRRP...........YLTCTRNG------WS......PE.....VP-----..------------........
ENSTTRP00000005589  YPY.--PVQ...........IRTCRSTG-----SWS......--.....-------..------------t.......
ENSTTRP00000013493  ---.--KRH...........PILCTKEG-----LWT......EE.....FKLCE--..------------........
ENSTTRP00000004075  RLS.--ESV...........YQQCQGTI-----PWF......ME.....IRLCKDI..TCPPPPVIYNG-........
ENSTTRP00000013493  KLQ.-GLSP...........WLTCLEDG-----LWS......LP.....EAYCKL-..ECDVPP------v.......


                                                      
                                                      
d2z3qb1               pps.............................
ENSTTRP00000002416  lrvqcdrgqlkyprciqrermlsyqerl....
ENSTTRP00000008853  qcidgviqipkcfkehssfafwkteasdvkpc
ENSTTRP00000012358  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000014813  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000008853  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000001935  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000014813  ................................
ENSTTRP00000014802  ................................
ENSTTRP00000003835  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000012479  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000010558  ................................
ENSTTRP00000003835  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000003873  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000003132  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000015569  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000014802  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000006831  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000004634  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000003829  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000001234  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000005169  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000002416  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000008531  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000001234  ................................
ENSTTRP00000014107  ................................
ENSTTRP00000014813  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003824  ................................
ENSTTRP00000008650  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000005169  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000005169  ................................
ENSTTRP00000006831  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000005589  ................................
ENSTTRP00000008853  ................................
ENSTTRP00000001261  ................................
ENSTTRP00000004541  ................................
ENSTTRP00000003873  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000014813  ................................
ENSTTRP00000005562  ................................
ENSTTRP00000006831  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000005441  ................................
ENSTTRP00000015569  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000007268  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003835  ................................
ENSTTRP00000005589  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000008853  ................................
ENSTTRP00000013493  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000005169  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000003829  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000005562  ................................
ENSTTRP00000002416  ................................
ENSTTRP00000010373  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000014813  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002416  ................................
ENSTTRP00000004541  ................................
ENSTTRP00000015569  ................................
ENSTTRP00000012400  ................................
ENSTTRP00000003873  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000003835  ................................
ENSTTRP00000000295  ................................
ENSTTRP00000003873  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000002120  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000004065  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000004065  ................................
ENSTTRP00000006831  ................................
ENSTTRP00000008853  ................................
ENSTTRP00000005871  ................................
ENSTTRP00000014802  ................................
ENSTTRP00000002255  ................................
ENSTTRP00000003873  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000008650  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000014107  ................................
ENSTTRP00000013753  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000012400  ................................
ENSTTRP00000014107  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000015569  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000011205  ................................
ENSTTRP00000014813  ................................
ENSTTRP00000015569  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000003514  ................................
ENSTTRP00000008090  ................................
ENSTTRP00000010373  ................................
ENSTTRP00000002255  ................................
ENSTTRP00000002416  ................................
ENSTTRP00000014431  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000001262  ................................
ENSTTRP00000013836  ................................
ENSTTRP00000002255  ................................
ENSTTRP00000005562  ................................
ENSTTRP00000014813  ................................
ENSTTRP00000010558  ................................
ENSTTRP00000014107  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000005169  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000004634  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000015914  ................................
ENSTTRP00000003462  ................................
ENSTTRP00000001793  ................................
ENSTTRP00000001262  ................................
ENSTTRP00000002416  ................................
ENSTTRP00000003514  ................................
ENSTTRP00000002416  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000012358  ................................
ENSTTRP00000008259  ................................
ENSTTRP00000002255  ................................
ENSTTRP00000002416  ................................
ENSTTRP00000008090  ................................
ENSTTRP00000000827  ................................
ENSTTRP00000005589  ................................
ENSTTRP00000013493  ................................
ENSTTRP00000004075  ................................
ENSTTRP00000013493  ................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0054764 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Thecamonas trahens ATCC 50062
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora infestans T30-4
NoYes   Perkinsus marinus ATCC 50983
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]