SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

RING/U-box alignments in Drosophila melanogaster 76_5

These alignments are sequences aligned to the 0050087 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                         10        2
                                                                                          |         
d1v87a_        ..............................................................gssg----SSGEPEQVIRKYTEE
FBpp0070117  .................................................................k-----RFEVKKWNAVALWA
FBpp0076341  .................................................................e----------DHITVTQEQ
FBpp0076342  .................................................................e----------DHITVTQEQ
FBpp0300874  .................................................................r---------KQWNAVALWA
FBpp0072446  .................................................................r------FVVKKWVAHAMWG
FBpp0087189  ................................................................km------FTLKKWNAVAMWS
FBpp0291421  ................................................................km------FTLKKWNAVAMWS
FBpp0072976  ...........................askyadnlqqldngkrippsgwqcekcdltnnlwlnltd-------------------
FBpp0298309  ...........................askyadnlqqldngkrippsgwqcekcdltnnlwlnltd-------------------
FBpp0079303  ...............................................................mkv-------TIKSWTGVATWR
FBpp0111655  ...............................................................mkv-------TIKSWTGVATWR
FBpp0305611  ...............................................................mkv-------TIKSWTGVATWR
FBpp0083160  ................................................................ti-------------------
FBpp0304474  ................................................................ti-------------------
FBpp0298372  ................................................lktcphlrllrpeeaprs-------------------
FBpp0073825  ................................................lktcphlrllrpeeaprs-------------------
FBpp0073827  ................................................lktcphlrllrpeeaprs-------------------
FBpp0073826  ................................................lktcphlrllrpeeaprs-------------------
FBpp0303431  ................................................lktcphlrllrpeeaprs-------------------
FBpp0080009  .....................tedecadapdefkdplmdtlmsdpvvlpsgtvmdraiitrhllns-------------------
FBpp0290465  .....................tedecadapdefkdplmdtlmsdpvvlpsgtvmdraiitrhllns-------------------
FBpp0078927  ........................gaqykeeqelladapeeyldpiistlmtdpvvlpsskvtvdr-------------------
FBpp0110216  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0083180  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0110215  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0083179  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0110218  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0110217  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0083178  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0110219  ...........................................epqslvwlpvlhrlaaaeaakhq-------------------
FBpp0079617  ..............................errkkrevpdflcgkisfeiltdpvitpsgityerk-------------------
FBpp0080686  ..................vgyqnqydliivdnaqvgvrhsnvvcdgcskagiagivfkcaqcpnyh-------------------
FBpp0074414  ........................................rvcpyldtinrnlldfdfeklcsisl-------------------
FBpp0081445  .................................................................r--------INEIPNVQINA
FBpp0304107  ............................................................aqnatl-------------------
FBpp0073495  ............................................................aqnatl-------------------
FBpp0271753  ............................................................aqnatl-------------------
FBpp0083052  .................................................................e-----------LPVHEIVK
FBpp0288650  .................................................................e-----------LPVHEIVK
FBpp0305755  .............................aydlrildsaptgvkhegtmcdtcrqqpifgirwkca-------------------
FBpp0075275  .............................aydlrildsaptgvkhegtmcdtcrqqpifgirwkca-------------------
FBpp0080794  ...................................psvddpsnftihdavecdgcglapligfryk-------------------
FBpp0099683  ...................................psvddpsnftihdavecdgcglapligfryk-------------------
FBpp0076010  ..............................................................wiaq-------------------
FBpp0076011  ..............................................................wiaq-------------------
FBpp0081594  ................................................................ne--------IDQLPSYKFNP
FBpp0081595  ................................................................ne--------IDQLPSYKFNP
FBpp0088499  .............................................................wiaan-------------------
FBpp0088500  .............................................................wiaan-------------------
FBpp0089023  .............................................................wiaan-------------------
FBpp0297199  .............................................................wiaan-------------------
FBpp0305073  .............................................................wiaan-------------------
FBpp0305074  .............................................................wiaan-------------------
FBpp0072361  ...............................................................fsd-------------------
FBpp0081596  ................................................................ne--------IDQLPSYKFNP
FBpp0085201  .................................................................n--------MNTLYPDATPE
FBpp0303146  .................................................................n--------MNTLYPDATPE
FBpp0289415  ...............................................................fsd-------------------
FBpp0297426  ...............................................................fsd-------------------
FBpp0289416  ...............................................................fsd-------------------
FBpp0081908  ...........................................................hkyrrvr----------------RPS
FBpp0081909  ...........................................................hkyrrvr----------------RPS
FBpp0300326  ...........................................................hkyrrvr----------------RPS
FBpp0303202  ...........................................................hkyrrvr----------------RPS
FBpp0289929  .................................................................l-------------------
FBpp0081217  ................................................................ml---------KKLPVLRYTK
FBpp0081218  ................................................................ml---------KKLPVLRYTK
FBpp0081219  ................................................................ml---------KKLPVLRYTK
FBpp0112110  ................................................................ml---------KKLPVLRYTK
FBpp0075265  ............................................................ydvnrf------------------Q
FBpp0305750  ............................................................ydvnrf------------------Q
FBpp0087040  ..............................................gpsclvwlplvhrlatveti-------------------
FBpp0087041  ..............................................gpsclvwlplvhrlatveti-------------------
FBpp0099693  ..............................................gpsclvwlplvhrlatveti-------------------
FBpp0293614  ..............................................gpsclvwlplvhrlatveti-------------------
FBpp0300837  ..............................................gpsclvwlplvhrlatveti-------------------
FBpp0293613  ..............................................gpsclvwlplvhrlatveti-------------------
FBpp0111987  ..............................................gpsclvwlplvhrlatveti-------------------
FBpp0088192  ..................................................................-------------------
FBpp0305836  ..................................................................-------------------
FBpp0080156  .............................................................civgh-------------------
FBpp0071136  ...............................................................ell-------------------
FBpp0071688  ........................................................yisahtkdcp-------------------
FBpp0072626  ..................................................................-------------------
FBpp0305589  ..................................................................-------------------
FBpp0085928  .................................................................i-------------------
FBpp0305076  .................................................................i-------------------
FBpp0073970  ..................................................................-------------------
FBpp0073971  ..................................................................-------------------
FBpp0073972  ..................................................................-------------------
FBpp0073973  ..................................................................-------------------
FBpp0073974  ..................................................................-------------------
FBpp0073969  ..................................................................-------------------
FBpp0112351  ..................................................................-------------------
FBpp0070738  ascqhikkavdaarlrrllkstgllyecsqcqklgktagsaagagasegavgpggnpvtfefdntl-------------------
FBpp0070739  ascqhikkavdaarlrrllkstgllyecsqcqklgktagsaagagasegavgpggnpvtfefdntl-------------------
FBpp0070740  ascqhikkavdaarlrrllkstgllyecsqcqklgktagsaagagasegavgpggnpvtfefdntl-------------------
FBpp0070741  ascqhikkavdaarlrrllkstgllyecsqcqklgktagsaagagasegavgpggnpvtfefdntl-------------------
FBpp0084614  .............................................................itdst-------------EIAVSP
FBpp0289967  ...............................................rhegvscdsclksnfngrr-------------------
FBpp0289968  ...............................................rhegvscdsclksnfngrr-------------------
FBpp0289969  ...............................................rhegvscdsclksnfngrr-------------------
FBpp0289970  ...............................................rhegvscdsclksnfngrr-------------------
FBpp0289971  ...............................................rhegvscdsclksnfngrr-------------------
FBpp0289972  ...............................................rhegvscdsclksnfngrr-------------------
FBpp0293183  ..............................................................gdsd-------------------
FBpp0078288  ............................................................qkeely-------------------
FBpp0078287  ............................................................qkeely-------------------
FBpp0070328  .................................................................n-------------------
FBpp0302591  .................................................................n-------------------
FBpp0080497  ..................................................................-------------------
FBpp0079604  ..............................................................sndd-------------------
FBpp0293056  ..............................................................sndd-------------------
FBpp0079599  ..............................................................sndd-------------------
FBpp0079600  ..............................................................sndd-------------------
FBpp0079601  ..............................................................sndd-------------------
FBpp0079602  ..............................................................sndd-------------------
FBpp0079603  ..............................................................sndd-------------------
FBpp0293055  ..............................................................sndd-------------------
FBpp0304028  ..............................................................sndd-------------------
FBpp0304029  ..............................................................sndd-------------------
FBpp0304027  ..............................................................sndd-------------------
FBpp0075392  ..............................................................esfy-------------------
FBpp0076222  ...............................................................qns-------------------
FBpp0301283  ...............................................................qns-------------------
FBpp0112083  ................................................................es-------------------
FBpp0305236  ................................................................es-------------------
FBpp0298003  ................................................................qe-------------------
FBpp0111417  ..................................................................-------------------
FBpp0090973  .............................................................enlsm-----------------KR
FBpp0073824  ................................................ygnllalvkriedtehli-------------------
FBpp0303430  ................................................ygnllalvkriedtehli-------------------
FBpp0071688  .................................................................q-------------------
FBpp0075105  ................................................................de-------------------
FBpp0305787  ................................................................de-------------------
FBpp0089378  ..............................................................kisa-----------LPEATPAQ
FBpp0072158  ................................................................qe-------------------
FBpp0088499  ..............................................................sqce-------------------
FBpp0088500  ..............................................................sqce-------------------
FBpp0089023  ..............................................................sqce-------------------
FBpp0297199  ..............................................................sqce-------------------
FBpp0305073  ..............................................................sqce-------------------
FBpp0305074  ..............................................................sqce-------------------
FBpp0305075  .................................................................l-------------------
FBpp0085929  .................................................................l-------------------
FBpp0089379  ..............................................................kisa-----------LPEATPAQ
FBpp0084797  ..............................................................kisa-----------LPEATPAQ
FBpp0084798  ..............................................................kisa-----------LPEATPAQ
FBpp0305390  ..............................................................kisa-----------LPEATPAQ
FBpp0291240  .................................................................n-------------------
FBpp0291241  .................................................................n-------------------
FBpp0080385  ................................................................rm-------------------
FBpp0081303  ...............................................................tky-------------------
FBpp0086906  ......................................................aspasrdvrqfh-------------------
FBpp0289616  ......................................................aspasrdvrqfh-------------------
FBpp0303463  ......................................................aspasrdvrqfh-------------------
FBpp0297447  .............................................................aaaaa-------------------
FBpp0074730  .............................................................aaaaa-------------------
FBpp0099776  ...............................................................tky-------------------
FBpp0084991  ..........................stlsipeefldsitwelmifptvlpsgkvvdqstidkhae-------------------
FBpp0288555  .............................................................aaaaa-------------------
FBpp0304246  .............................................................aaaaa-------------------
FBpp0076498  ................................................................ql-------------------
FBpp0293529  ................................................................ql-------------------
FBpp0288698  .......................gcrhyqsyvkehsydtfrvidayfaacvnrdarerkaihcncf-------------------
FBpp0072779  ................................................................gd-------------------
FBpp0289997  ................................................................gd-------------------
FBpp0080229  .............................................................ghrni-------------------
FBpp0290952  .............................................................ghrni-------------------
FBpp0072708  ...............................................................wsy--------------IEQIN
FBpp0072709  ...............................................................wsy--------------IEQIN
FBpp0086838  ..............................................................gdqp-------------------
FBpp0291638  ..............................................................gdqp-------------------
FBpp0074245  ...............................................................hld-------------------
FBpp0074242  ...............................................................hld-------------------
FBpp0074243  ...............................................................hld-------------------
FBpp0074244  ...............................................................hld-------------------
FBpp0087349  ................................................................pf-------------------
FBpp0291679  ................................................................pf-------------------
FBpp0076010  .................................................................l-------------------
FBpp0076011  .................................................................l-------------------
FBpp0085553  ...............................................................svg-------------------
FBpp0078590  ................................................................pe-------------------
FBpp0112237  ..................................................ghcnvrcdgcgnnrmt-------------------
FBpp0070521  ..................................................ghcnvrcdgcgnnrmt-------------------
FBpp0075071  ..............................................................ktin-------------------
FBpp0298337  ..............................................................ktin-------------------
FBpp0070506  ................................................................ge-------------------
FBpp0078038  ................................................................rs-------------------
FBpp0078039  ................................................................rs-------------------
FBpp0293874  ................................................................rs-------------------
FBpp0302614  ................................................................ge-------------------
FBpp0077675  ............................................................slpqrg-------------------
FBpp0305188  ............................................................slpqrg-------------------
FBpp0077974  ............................................................kvstkp-------------------
FBpp0077975  ............................................................kvstkp-------------------
FBpp0086007  .............................................................tlndl-------------------
FBpp0070905  ...............................................................esg-------------------
FBpp0071135  .................................................................d-------------------
FBpp0078401  .................................................................k-------------------
FBpp0288691  .................................................................p-------------------
FBpp0070876  ............................................................kvvepp-------------------
FBpp0083160  ......................................................avwvseverseh-------------------
FBpp0304474  ......................................................avwvseverseh-------------------
FBpp0085754  ............................................................rnsppp-------------------
FBpp0304302  ............................................................rnsppp-------------------
FBpp0303663  .................................................fqrklrdrsllqdpnfk-------------------
FBpp0303660  .................................................fqrklrdrsllqdpnfk-------------------
FBpp0303662  .................................................fqrklrdrsllqdpnfk-------------------
FBpp0303658  .................................................fqrklrdrsllqdpnfk-------------------
FBpp0074856  ...............................................................ars-------------------
FBpp0073752  ................................................................sq-------------------
FBpp0077310  ................................................................kk-------------------
FBpp0077311  ................................................................kk-------------------
FBpp0077312  ................................................................kk-------------------
FBpp0078830  ..........................................npperhfghrcenckisdfqgrry-------------------
FBpp0084491  ...............................................................ler-------------------
FBpp0073027  ..................................................................-------------------
FBpp0080198  ......................................nrherieckgcgkrsltfrcyrclscqd-------------------
FBpp0073674  ...........................................................avnktsl-----------------DE
FBpp0297897  ...............................................................qry-------------------
FBpp0085902  ..........................................lvcaltnevpetpvvsphsgavfe--------------K----
FBpp0076706  ..............................................................dsad-------------------
FBpp0304173  ..............................................................dsad-------------------
FBpp0071688  ............................dkyqqfafkdyvkshpelrfcpgpncqiivqsseisak-------------------
FBpp0071337  ..................................aqfstlsmlyelhnqgqdkfvytcnhcktave-------------------
FBpp0291863  ..................................aqfstlsmlyelhnqgqdkfvytcnhcktave-------------------
FBpp0291862  ..................................aqfstlsmlyelhnqgqdkfvytcnhcktave-------------------
FBpp0305701  ..................................aqfstlsmlyelhnqgqdkfvytcnhcktave-------------------
FBpp0086323  ..................................pfehccitmapyempycdlqgnvfeyeailkf-------------------
FBpp0076010  ...................................eryqqlitntfvecnmlmrwcpapncshavk-------------------
FBpp0076011  ...................................eryqqlitntfvecnmlmrwcpapncshavk-------------------
FBpp0088499  ............................................kyqqlitnsfvecnqllrwcps-------------------
FBpp0088500  ............................................kyqqlitnsfvecnqllrwcps-------------------
FBpp0089023  ............................................kyqqlitnsfvecnqllrwcps-------------------
FBpp0297199  ............................................kyqqlitnsfvecnqllrwcps-------------------
FBpp0305073  ............................................kyqqlitnsfvecnqllrwcps-------------------
FBpp0305074  ............................................kyqqlitnsfvecnqllrwcps-------------------
FBpp0297896  ...............................................................neq-------------------
FBpp0293251  ................................................................gd-------------------
FBpp0082202  ..............................................................rrnl-------------------
FBpp0081830  .................................................................d-------------------
FBpp0293250  .................................................................d-------------------
FBpp0083244  ................................................................pf-------------------
FBpp0076822  ...........................................................ieeirey-------------------
FBpp0087350  .................................................................d-------------------
FBpp0071001  ................................................................kg-------------------
FBpp0087349  .............................................................nelik-------------------
FBpp0291679  .............................................................nelik-------------------
FBpp0083719  ...............................................................lye-------------------
FBpp0085756  ..............................................................eqll-------------------
FBpp0085757  ..............................................................eqll-------------------
FBpp0073753  ................................................................sk-------------------
FBpp0113114  ..............................................................eqll-------------------
FBpp0079210  ................................................................ft-------------------
FBpp0303663  ..................................................................-------------------
FBpp0303660  ..................................................................-------------------
FBpp0303662  ..................................................................-------------------
FBpp0303658  ..................................................................-------------------
FBpp0086911  ...............................................................phi-------------------
FBpp0078901  .................................................................s-------------------
FBpp0303613  .................................................................s-------------------
FBpp0081480  ..................................................................-------------------
FBpp0081479  ..................................................................-------------------
FBpp0289643  ..................................................................-------------------
FBpp0075181  ............................................................swtdfl-------------------
FBpp0303600  ............................................................swtdfl-------------------
FBpp0305463  ............................................................swtdfl-------------------
FBpp0081482  ..................................................................-------------------
FBpp0081481  ..................................................................-------------------
FBpp0082488  .................................................................s-------------------
FBpp0297356  .................................................................s-------------------
FBpp0073049  ...............................................................tls-------------------
FBpp0076498  ...............................................................dfd-------------------
FBpp0293529  ...............................................................dfd-------------------
FBpp0072874  ..............................................................isna-------------------
FBpp0086712  ..............................................................lpsg-------------------
FBpp0076329  ..................................................................-------------------
FBpp0088148  .................................................................n-------------------
FBpp0088149  .................................................................n-------------------
FBpp0083630  ...............................................................kci-------------VQSYLQ
FBpp0111519  ...................................................slqkfatclqhisql-------------------
FBpp0291525  ...................................................slqkfatclqhisql-------------------
FBpp0072214  ...............................................................ale------------------S
FBpp0302533  .................................................................r-------------------
FBpp0302535  .................................................................r-------------------
FBpp0080921  .................................................................r-------------------
FBpp0302534  .................................................................r-------------------
FBpp0302531  .................................................................r-------------------
FBpp0302532  .................................................................r-------------------
FBpp0070904  ...............................................................esg-------------------
FBpp0088160  ..................................................................-------------------
FBpp0302676  ..................................................................-------------------
FBpp0302677  ..................................................................-------------------
FBpp0302678  ..................................................................-------------------
FBpp0078948  .................................................................n-------------------
FBpp0305541  .................................................................n-------------------
FBpp0073787  ..............................................................tqda-------------------
FBpp0303660  ...............................................................hla-------------------
FBpp0303662  ...............................................................hla-------------------
FBpp0303658  ...............................................................hla-------------------
FBpp0084637  ......................................................ihcnkcfrrrnv-------------------
FBpp0303663  ...............................................................hla-------------------
FBpp0079685  .................................................................e-------------------
FBpp0293057  .................................................................e-------------------
FBpp0074742  ..................................................................-------------------
FBpp0074330  ..........................................ymcpithdvlsnavpcavlrptgd-------------------
FBpp0077974  ...........................................teeyvlqaggvlcpqpgcgmgll-------------------
FBpp0077975  ...........................................teeyvlqaggvlcpqpgcgmgll-------------------
FBpp0074330  .....................................................vksfdccsltlqp-------------------
FBpp0075091  .............................................................dltsl-------------------
FBpp0075092  .............................................................dltsl-------------------
FBpp0304749  ..............................................................ieqr-------------------
FBpp0086919  .................................................................t-------------------
FBpp0080265  ..............................................................ieqr-------------------
FBpp0080266  ..............................................................ieqr-------------------
FBpp0304750  ..............................................................ieqr-------------------
FBpp0305755  ................................................................fq--------MDDVQKLKQQL
FBpp0075275  ................................................................fq--------MDDVQKLKQQL
FBpp0084259  .........................................................vpkelksll-------------------
FBpp0293345  .........................................................vpkelksll-------------------
FBpp0077338  ...............................................................hte-------------------
FBpp0076695  ............................................................lwvttt-------------------
FBpp0084258  .........................................................vpkelksll-------------------
FBpp0074479  ......................................................vhcnkcfrhrkt-------------------
FBpp0070458  ...............................................................egl-------------------
FBpp0293251  ...................................................vllnerrivgrspng-------------------
FBpp0086219  ...............................................................pts-------------------
FBpp0081830  .........................................................rsspysrsp-------------------
FBpp0293250  .........................................................rsspysrsp-------------------
FBpp0290962  ...............................................................dng-------------------
FBpp0303730  ...............................................................dng-------------------
FBpp0303731  ...............................................................dng-------------------
FBpp0070045  ...........................................................lytnnpi-------------------
FBpp0289844  .................................................................k-------------------
FBpp0083320  .................................................................k-------------------
FBpp0070259  .............................................................qqlrq-----------------HS
FBpp0303076  .................................................................k-------------------
FBpp0077259  ...................................................lskrrveelnsglge-------------------
FBpp0077260  ...................................................lskrrveelnsglge-------------------
FBpp0071476  ............................................................fhsifa-------------------
FBpp0305661  .................................................................g-------------------
FBpp0071238  .................................................................g-------------------
FBpp0305660  .................................................................g-------------------
FBpp0305662  .................................................................g-------------------
FBpp0290897  ................................................................ll-------------------
FBpp0080804  .......................................................ccdqcdkpilv-------------------
FBpp0110415  .............................................................qqvsy-------------------
FBpp0070464  .................................................................i-------------------
FBpp0083736  ................................................................lv-------------------
FBpp0110416  .............................................................qqvsy-------------------
FBpp0305698  .............................................................qqvsy-------------------
FBpp0110417  .............................................................qqvsy-------------------
FBpp0305699  .............................................................qqvsy-------------------
FBpp0077974  ................................................................vp-------------------
FBpp0077975  ................................................................vp-------------------
FBpp0303687  .......................................................ccdqcdkpilv-------------------
FBpp0084110  .........................vqsrlicrvtglplnehnqpmmlpngqifgqmalpditkdd-------------------
FBpp0301716  ..............................................................ehda-------------------
FBpp0306230  ..............................................................ehda-------------------


               0                   30        40        50             60                        70  
               |                    |         |         |              |                         |  
d1v87a_        LKVAPEE...........DCIICMEKLAVASGYSDMTDSKAL..GPMV..V.GRLTK..C.....S......HA.FHLL.C.LLA
FBpp0070117  WDIVVD-...........NCAICRNHIMDLCIECQANQASAT..SEEC..T.VAWGV..C.....N......HA.FHFH.C.ISR
FBpp0076341  YELYCEMgstfq......LCKICAEND---------------..KD--..-.IRIEP..C.....G......HL.LCTP.C.LTS
FBpp0076342  YELYCEMgstfq......LCKICAEND---------------..KD--..-.IRIEP..C.....G......HL.LCTP.C.LTS
FBpp0300874  WDIVVD-...........NCAICRNHIMDLCIECQANQASAT..SEEC..T.VAWGV..C.....N......HA.FHFH.C.ISR
FBpp0072446  WDVAVD-...........NCAICRNHIMNLCIECQADPNAN-..QDEC..T.VAWGE..C.....N......HA.FHYH.C.IAR
FBpp0087189  WDVECD-...........ICAICRVQVMDSCLRCQADNKRDVmgRQDC..V.VVWGE..C.....N......HS.FHHC.C.MSL
FBpp0291421  WDVECD-...........ICAICRVQVMDSCLRCQADNKRDVmgRQDC..V.VVWGE..C.....N......HS.FHHC.C.MSL
FBpp0072976  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0298309  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0079303  WIANDE-...........NCGICRMSF-----ESTCPECALP..GDDC..P.LVWGV..C.....S......HC.FHMH.C.IVK
FBpp0111655  WIANDE-...........NCGICRMSF-----ESTCPECALP..GDDC..P.LVWGV..C.....S......HC.FHMH.C.IVK
FBpp0305611  WIANDE-...........NCGICRMSF-----ESTCPECALP..GDDC..P.LVWGV..C.....S......HC.FHMH.C.IVK
FBpp0083160  -------...........------------------------..----..-.----L..C.....N......HA.FHAS.C.LMK
FBpp0304474  -------...........------------------------..----..-.----L..C.....N......HA.FHAS.C.LMK
FBpp0298372  --LDSGA...........ECSVCGSTG---------------..EN--..-.WVCLS..C.....R......HV.ACGR.-.---
FBpp0073825  --LDSGA...........ECSVCGSTG---------------..EN--..-.WVCLS..C.....R......HV.ACGR.-.---
FBpp0073827  --LDSGA...........ECSVCGSTG---------------..EN--..-.WVCLS..C.....R......HV.ACGR.-.---
FBpp0073826  --LDSGA...........ECSVCGSTG---------------..EN--..-.WVCLS..C.....R......HV.ACGR.-.---
FBpp0303431  --LDSGA...........ECSVCGSTG---------------..EN--..-.WVCLS..C.....R......HV.ACGR.-.---
FBpp0080009  -------...........----C-------------------..----..-.-----..-.....-......--.----.-.---
FBpp0290465  -------...........----C-------------------..----..-.-----..-.....-......--.----.-.---
FBpp0078927  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0110216  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0083180  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0110215  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0083179  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0110218  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0110217  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0083178  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0110219  ------A...........KCNICKEYP---------------..IVGF..R.YRCLK..C.....F......NFdMCQK.C.FF-
FBpp0079617  -D-----...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0080686  -------...........LCAYCY------------------..----..-.-----..-.....-......--.----.-.---
FBpp0074414  ------Trinvy......ACLVCGKYF---------------..----..-.-----..-.....-......--.----.-.---
FBpp0081445  EEVNRKI...........QCSICWDDF---------------..KIDE..T.VRKLP..C.....S......HL.YHEN.C.IVP
FBpp0304107  -------...........KCTLCQERL---------------..ED--..-.THFVQ..Cpsvn.H......HK.FCFP.C.SRE
FBpp0073495  -------...........KCTLCQERL---------------..ED--..-.THFVQ..Cpsvn.H......HK.FCFP.C.SRE
FBpp0271753  -------...........KCTLCQERL---------------..ED--..-.THFVQ..Cpsvn.H......HK.FCFP.C.SRE
FBpp0083052  SDEGGDL...........ECSVCKEPA---------------..EEGQ..K.YRILP..C.....K......HE.FHEE.C.ILL
FBpp0288650  SDEGGDL...........ECSVCKEPA---------------..EEGQ..K.YRILP..C.....K......HE.FHEE.C.ILL
FBpp0305755  ------Ecinyd......LCSICYHG----------------..----..-.-----..-.....-......--.----.-.---
FBpp0075275  ------Ecinyd......LCSICYHG----------------..----..-.-----..-.....-......--.----.-.---
FBpp0080794  -------...........------------------------..----..-.--CVQ..C.....S......--.----.-.---
FBpp0099683  -------...........------------------------..----..-.--CVQ..C.....S......--.----.-.---
FBpp0076010  ----NTK...........ECPKCNVTIE-----------KDG..GCNH..M.VCKNPs.C.....R......YD.FCWV.C.LGS
FBpp0076011  ----NTK...........ECPKCNVTIE-----------KDG..GCNH..M.VCKNPs.C.....R......YD.FCWV.C.LGS
FBpp0081594  EVHNGDQs..........SCVVCMCDF---------------..ELRQ..L.LRVLP..C.....S......HE.FHAK.C.VDK
FBpp0081595  EVHNGDQs..........SCVVCMCDF---------------..ELRQ..L.LRVLP..C.....S......HE.FHAK.C.VDK
FBpp0088499  -----TK...........ECPRCSVTIEKDG-----G-----..CNHM..V.CKNQN..C.....K......NE.FCWV.C.LGS
FBpp0088500  -----TK...........ECPRCSVTIEKDG-----G-----..CNHM..V.CKNQN..C.....K......NE.FCWV.C.LGS
FBpp0089023  -----TK...........ECPRCSVTIEKDG-----G-----..CNHM..V.CKNQN..C.....K......NE.FCWV.C.LGS
FBpp0297199  -----TK...........ECPRCSVTIEKDG-----G-----..CNHM..V.CKNQN..C.....K......NE.FCWV.C.LGS
FBpp0305073  -----TK...........ECPRCSVTIEKDG-----G-----..CNHM..V.CKNQN..C.....K......NE.FCWV.C.LGS
FBpp0305074  -----TK...........ECPRCSVTIEKDG-----G-----..CNHM..V.CKNQN..C.....K......NE.FCWV.C.LGS
FBpp0072361  EKDLDSD...........CCAICIEAY---------------..KPTD..T.IRILP..C.....K......HE.FHKN.C.IDP
FBpp0081596  EVHNGDQs..........SCVVCMCDF---------------..ELRQ..L.LRVLP..C.....S......HE.FHAK.C.VDK
FBpp0085201  ELRQSDN...........ICIICREDM---------------..VN--..H.SKKLP..C.....G......HI.FHTT.C.LRS
FBpp0303146  ELRQSDN...........ICIICREDM---------------..VN--..H.SKKLP..C.....G......HI.FHTT.C.LRS
FBpp0289415  EKDLDSD...........CCAICIEAY---------------..KPTD..T.IRILP..C.....K......HE.FHKN.C.IDP
FBpp0297426  EKDLDSD...........CCAICIEAY---------------..KPTD..T.IRILP..C.....K......HE.FHKN.C.IDP
FBpp0289416  EKDLDSD...........CCAICIEAY---------------..KPTD..T.IRILP..C.....K......HE.FHKN.C.IDP
FBpp0081908  ETDEDAE...........KCAICLNLF---------------..EIEN..E.VRRLP..C.....M......HL.FHTD.C.VDQ
FBpp0081909  ETDEDAE...........KCAICLNLF---------------..EIEN..E.VRRLP..C.....M......HL.FHTD.C.VDQ
FBpp0300326  ETDEDAE...........KCAICLNLF---------------..EIEN..E.VRRLP..C.....M......HL.FHTD.C.VDQ
FBpp0303202  ETDEDAE...........KCAICLNLF---------------..EIEN..E.VRRLP..C.....M......HL.FHTD.C.VDQ
FBpp0289929  -------...........-CPICHDAF---------------..NT--..-.PTVLE..C.....G......HI.FCDE.C.VQT
FBpp0081217  NNANNKYd..........TCVICLEDF---------------..IEDD..K.LRVLP..C.....S......HP.YHTH.C.IDP
FBpp0081218  NNANNKYd..........TCVICLEDF---------------..IEDD..K.LRVLP..C.....S......HP.YHTH.C.IDP
FBpp0081219  NNANNKYd..........TCVICLEDF---------------..IEDD..K.LRVLP..C.....S......HP.YHTH.C.IDP
FBpp0112110  NNANNKYd..........TCVICLEDF---------------..IEDD..K.LRVLP..C.....S......HP.YHTH.C.IDP
FBpp0075265  GEVDEEL...........TCPICSGVL---------------..ED--..-.PLQAVm.C.....E......HA.FCRG.C.INE
FBpp0305750  GEVDEEL...........TCPICSGVL---------------..ED--..-.PLQAVm.C.....E......HA.FCRG.C.INE
FBpp0087040  --VHP-T...........VCSVCHKEN---------------..FTGF..R.YRCQR..C.....Ha.....YQ.LCQE.C.FW-
FBpp0087041  --VHP-T...........VCSVCHKEN---------------..FTGF..R.YRCQR..C.....Ha.....YQ.LCQE.C.FW-
FBpp0099693  --VHP-T...........VCSVCHKEN---------------..FTGF..R.YRCQR..C.....Ha.....YQ.LCQE.C.FW-
FBpp0293614  --VHP-T...........VCSVCHKEN---------------..FTGF..R.YRCQR..C.....Ha.....YQ.LCQE.C.FW-
FBpp0300837  --VHP-T...........VCSVCHKEN---------------..FTGF..R.YRCQR..C.....Ha.....YQ.LCQE.C.FW-
FBpp0293613  --VHP-T...........VCSVCHKEN---------------..FTGF..R.YRCQR..C.....Ha.....YQ.LCQE.C.FW-
FBpp0111987  --VHP-T...........VCSVCHKEN---------------..FTGF..R.YRCQR..C.....Ha.....YQ.LCQE.C.FW-
FBpp0088192  -------...........ECVICMAEF---------------..CVNE..A.VRYLP..C.....M......HI.YHVN.C.IDD
FBpp0305836  -------...........ECVICMAEF---------------..CVNE..A.VRYLP..C.....M......HI.YHVN.C.IDD
FBpp0080156  --VDEEL...........ICPICTDVL---------------..EE--..-.PVQSSe.C.....E......HA.FCRA.C.IDK
FBpp0071136  ---DSRY...........ECAICIDWL---------------..NE--..-.PVLTS..C.....G......HR.FCRS.C.LTA
FBpp0071688  -------...........KCHICIEKN---------------..GGCN..H.MQCFN..C.....K......HD.FCWM.C.LGD
FBpp0072626  -------...........QCILCLEPR---------------..SD--..-.SSLTP..C.....G......HI.FCWS.C.LLE
FBpp0305589  -------...........QCILCLEPR---------------..SD--..-.SSLTP..C.....G......HI.FCWS.C.LLE
FBpp0085928  -------...........LCAICNEFF---------------..RAND..I.IFSTSr.C.....G......HV.FHKD.C.LTR
FBpp0305076  -------...........LCAICNEFF---------------..RAND..I.IFSTSr.C.....G......HV.FHKD.C.LTR
FBpp0073970  -------...........ECNICLDTA---------------..KD--..-.AVVSM..C.....G......HL.FCWP.C.LHQ
FBpp0073971  -------...........ECNICLDTA---------------..KD--..-.AVVSM..C.....G......HL.FCWP.C.LHQ
FBpp0073972  -------...........ECNICLDTA---------------..KD--..-.AVVSM..C.....G......HL.FCWP.C.LHQ
FBpp0073973  -------...........ECNICLDTA---------------..KD--..-.AVVSM..C.....G......HL.FCWP.C.LHQ
FBpp0073974  -------...........ECNICLDTA---------------..KD--..-.AVVSM..C.....G......HL.FCWP.C.LHQ
FBpp0073969  -------...........ECNICLDTA---------------..KD--..-.AVVSM..C.....G......HL.FCWP.C.LHQ
FBpp0112351  -------...........ECNICLDTA---------------..KD--..-.AVVSM..C.....G......HL.FCWP.C.LHQ
FBpp0070738  -------...........------------------------..----..-.W----..-.....-......--.----.-.---
FBpp0070739  -------...........------------------------..----..-.W----..-.....-......--.----.-.---
FBpp0070740  -------...........------------------------..----..-.W----..-.....-......--.----.-.---
FBpp0070741  -------...........------------------------..----..-.W----..-.....-......--.----.-.---
FBpp0084614  RSLHSEL...........MCPICLDML---------------..KK--..-.TMTTKe.C.....L......HR.FCSD.C.IVT
FBpp0289967  ------Y...........KCLICYDYD---------------..----..-.-----..-.....-......--.----.-.---
FBpp0289968  ------Y...........KCLICYDYD---------------..----..-.-----..-.....-......--.----.-.---
FBpp0289969  ------Y...........KCLICYDYD---------------..----..-.-----..-.....-......--.----.-.---
FBpp0289970  ------Y...........KCLICYDYD---------------..----..-.-----..-.....-......--.----.-.---
FBpp0289971  ------Y...........KCLICYDYD---------------..----..-.-----..-.....-......--.----.-.---
FBpp0289972  ------Y...........KCLICYDYD---------------..----..-.-----..-.....-......--.----.-.---
FBpp0293183  ----EPY...........MCPICMENV---------------..RR-R..Q.PAATP..C.....G......HV.FCYD.C.IQK
FBpp0078288  -------...........KCPICMDSV---------------..SK-R..E.PVSTK..C.....G......HV.FCRE.C.IET
FBpp0078287  -------...........KCPICMDSV---------------..SK-R..E.PVSTK..C.....G......HV.FCRE.C.IET
FBpp0070328  -----NV...........ICTICSERF---------------..RTSD..N.IQAGS..C.....G......HA.FHED.C.LDH
FBpp0302591  -----NV...........ICTICSERF---------------..RTSD..N.IQAGS..C.....G......HA.FHED.C.LDH
FBpp0080497  -------...........TCCICLDPWEA-------------..KDHH..R.LVSLR..C.....G......HL.FGEM.C.IRT
FBpp0079604  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0293056  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0079599  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0079600  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0079601  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0079602  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0079603  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0293055  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0304028  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0304029  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0304027  -----AV...........ECPLCMEPL---------------..EVDD..L.TFFPCt.C.....G......YQ.ICRF.C.WHR
FBpp0075392  -------...........ECNICLDTA---------------..QN--..-.AVVSM..C.....G......HL.FCWP.C.LYQ
FBpp0076222  -----GD...........ICRICHCES---------------..DP-Q..N.PLLTP..C.....Ycsgsl.KY.VHQA.C.LQQ
FBpp0301283  -----GD...........ICRICHCES---------------..DP-Q..N.PLLTP..C.....Ycsgsl.KY.VHQA.C.LQQ
FBpp0112083  --MQEDI...........TCSICLSPWSS-------------..NGRH..R.VVSLR..C.....G......HL.FGNS.C.IRT
FBpp0305236  --MQEDI...........TCSICLSPWSS-------------..NGRH..R.VVSLR..C.....G......HL.FGNS.C.IRT
FBpp0298003  --IPEDL...........ICGICRDIF---------------..VD--..-.AVMIPc.C.....G......SS.FCDD.C.VRT
FBpp0111417  -------...........TCLVCMQTA---------------..ES--..-.PRVSF..C.....G......HH.FCSQ.C.IYN
FBpp0090973  KKIAEEN...........KCYICKWNYEV-------------..TGDH..R.PVSIK..C.....G......HL.FGAN.C.ILH
FBpp0073824  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0303430  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0071688  -------...........MCPVCASSQ---------------..-LGD..K.FYSLA..C.....G......HS.FCKD.C.WTI
FBpp0075105  ---DDGM...........TCPICLDSWEM-------------..SGEH..R.LVSLR..C.....G......HL.FGES.C.IRR
FBpp0305787  ---DDGM...........TCPICLDSWEM-------------..SGEH..R.LVSLR..C.....G......HL.FGES.C.IRR
FBpp0089378  LQAFDD-...........VCAICYQEM---------------..YS--..-.AKITR..C.....R......HF.FHGV.C.LRK
FBpp0072158  --IPEDL...........ICGICRDIF---------------..VD--..-.AVMIPc.C.....G......SS.FCDD.C.VRT
FBpp0088499  -------...........ECEICFSQL---------------..PP-D..S.MAGLE..C.....G......HR.FCMP.C.WHE
FBpp0088500  -------...........ECEICFSQL---------------..PP-D..S.MAGLE..C.....G......HR.FCMP.C.WHE
FBpp0089023  -------...........ECEICFSQL---------------..PP-D..S.MAGLE..C.....G......HR.FCMP.C.WHE
FBpp0297199  -------...........ECEICFSQL---------------..PP-D..S.MAGLE..C.....G......HR.FCMP.C.WHE
FBpp0305073  -------...........ECEICFSQL---------------..PP-D..S.MAGLE..C.....G......HR.FCMP.C.WHE
FBpp0305074  -------...........ECEICFSQL---------------..PP-D..S.MAGLE..C.....G......HR.FCMP.C.WHE
FBpp0305075  -------...........NCVICAELF---------------..GQAD..E.VFATV..C.....G......HM.FHHN.C.LNQ
FBpp0085929  -------...........NCVICAELF---------------..GQAD..E.VFATV..C.....G......HM.FHHN.C.LNQ
FBpp0089379  LQAFDD-...........VCAICYQEM---------------..YS--..-.AKITR..C.....R......HF.FHGV.C.LRK
FBpp0084797  LQAFDD-...........VCAICYQEM---------------..YS--..-.AKITR..C.....R......HF.FHGV.C.LRK
FBpp0084798  LQAFDD-...........VCAICYQEM---------------..YS--..-.AKITR..C.....R......HF.FHGV.C.LRK
FBpp0305390  LQAFDD-...........VCAICYQEM---------------..YS--..-.AKITR..C.....R......HF.FHGV.C.LRK
FBpp0291240  -------...........-CPVCLEDV---------------..RE-K..L.PVSTN..C.....G......HV.FCKA.C.IKR
FBpp0291241  -------...........-CPVCLEDV---------------..RE-K..L.PVSTN..C.....G......HV.FCKA.C.IKR
FBpp0080385  ---VENS...........TCSICLLPW---------------..TDNGihR.LVSLR..C.....G......HL.FGSS.C.IHM
FBpp0081303  -------...........NCTNCQDDI---------------..QG--..-.IRVHCaeC.....E......NFdLCLQ.-.---
FBpp0086906  -----DLi..........TCRLCRGYM---------------..ID--..-.PTTVDy.C.....Y......HT.YCRS.C.ILK
FBpp0289616  -----DLi..........TCRLCRGYM---------------..ID--..-.PTTVDy.C.....Y......HT.YCRS.C.ILK
FBpp0303463  -----DLi..........TCRLCRGYM---------------..ID--..-.PTTVDy.C.....Y......HT.YCRS.C.ILK
FBpp0297447  ------L...........ECPICLQTC---------------..IH--..-.PARLP..C.....G......HI.FCFL.C.VKG
FBpp0074730  ------L...........ECPICLQTC---------------..IH--..-.PARLP..C.....G......HI.FCFL.C.VKG
FBpp0099776  -------...........NCTNCQDDI---------------..QG--..-.IRVHCaeC.....E......NFdLCLQ.-.---
FBpp0084991  ----E--...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0288555  ------L...........ECPICLQTC---------------..IH--..-.PARLP..C.....G......HI.FCFL.C.VKG
FBpp0304246  ------L...........ECPICLQTC---------------..IH--..-.PARLP..C.....G......HI.FCFL.C.VKG
FBpp0076498  -IDASDF...........DCVVCSRTL---------------..WK--..-.PVVTP..C.....G......HT.YCLV.C.LDR
FBpp0293529  -IDASDF...........DCVVCSRTL---------------..WK--..-.PVVTP..C.....G......HT.YCLV.C.LDR
FBpp0288698  -------...........------------------------..ECGS..Y.GIQLYa.C.....L......HC.IYFG.C.RGA
FBpp0072779  -------...........ICRVCRCEA---------------..QPDR..-.PLFYP..Cic...Tgsi...KY.IHQD.C.LML
FBpp0289997  -------...........ICRVCRCEA---------------..QPDR..-.PLFYP..Cic...Tgsi...KY.IHQD.C.LML
FBpp0080229  -------...........CCNGCQMTI---------------..FQGS..R.FRCLR..C.....V......NYnLCDI.C.YDH
FBpp0290952  -------...........CCNGCQMTI---------------..FQGS..R.FRCLR..C.....V......NYnLCDI.C.YDH
FBpp0072708  IQTTEEL...........QCPICLYPP---------------..VA--..-.AKLTR..C.....G......HA.YCWP.C.LLH
FBpp0072709  IQTTEEL...........QCPICLYPP---------------..VA--..-.AKLTR..C.....G......HA.YCWP.C.LLH
FBpp0086838  ------D...........MCAFCLDRI---------------..QN--..-.PEKLH..C.....N......HA.FCKS.C.LAL
FBpp0291638  ------D...........MCAFCLDRI---------------..QN--..-.PEKLH..C.....N......HA.FCKS.C.LAL
FBpp0074245  -----QN...........VCAVCGNQL-----LVSEKEEGVI..EN--..-.TYKLS..C.....N......HV.FHEF.C.IRG
FBpp0074242  -----QN...........VCAVCGNQL-----LVSEKEEGVI..EN--..-.TYKLS..C.....N......HV.FHEF.C.IRG
FBpp0074243  -----QN...........VCAVCGNQL-----LVSEKEEGVI..EN--..-.TYKLS..C.....N......HV.FHEF.C.IRG
FBpp0074244  -----QN...........VCAVCGNQL-----LVSEKEEGVI..EN--..-.TYKLS..C.....N......HV.FHEF.C.IRG
FBpp0087349  -------...........TCKLCLIDV---------------..EDVG..E.AMALQq.C.....G......CQ.FCIE.C.MRA
FBpp0291679  -------...........TCKLCLIDV---------------..EDVG..E.AMALQq.C.....G......CQ.FCIE.C.MRA
FBpp0076010  -------...........-CGICFCSC---------------..DE--..-.LIGLG..C.....G......HN.FCAA.C.WKQ
FBpp0076011  -------...........-CGICFCSC---------------..DE--..-.LIGLG..C.....G......HN.FCAA.C.WKQ
FBpp0085553  -----SL...........VCRICHNAD---------------..NPEQ..L.VSPCL..C.....KgsltyvH-.--VH.C.LEC
FBpp0078590  ------R...........CCWICFATD---------------..EDNR..L.AAWVKp.C.....Qcrgtt.KW.VHQS.C.LYR
FBpp0112237  -------...........------------------------..----..-.FYRYK..C.....L......HC.----.-.LDY
FBpp0070521  -------...........------------------------..----..-.FYRYK..C.....L......HC.----.-.LDY
FBpp0075071  ----PHI...........TCKICGGYF---------------..ID--..A.TTVTE..C.....L......HT.FCKS.C.LVK
FBpp0298337  ----PHI...........TCKICGGYF---------------..ID--..A.TTVTE..C.....L......HT.FCKS.C.LVK
FBpp0070506  ------R...........ICWICFATSEDNPHAHWVQPCQCR..GD--..-.TKW--..-.....-......--.VHQS.C.LYR
FBpp0078038  ----KDK...........TCGICFDTIMEKA-----------..GREK..R.FGILPn.C.....N......HI.FCLE.C.IRT
FBpp0078039  ----KDK...........TCGICFDTIMEKA-----------..GREK..R.FGILPn.C.....N......HI.FCLE.C.IRT
FBpp0293874  ----KDK...........TCGICFDTIMEKA-----------..GREK..R.FGILPn.C.....N......HI.FCLE.C.IRT
FBpp0302614  ------R...........ICWICFATSEDNPHAHWVQPCQCR..GD--..-.TKW--..-.....-......--.VHQS.C.LYR
FBpp0077675  -------...........ECPVCLLSI---------------..QT--..-.PTACSv.S.....G......YV.FCWK.C.IVS
FBpp0305188  -------...........ECPVCLLSI---------------..QT--..-.PTACSv.S.....G......YV.FCWK.C.IVS
FBpp0077974  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0077975  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0086007  ------L...........ECSVCLERL---------------..DT--..T.SKVLP..C.....Q......HT.FCRK.C.LQD
FBpp0070905  ------N...........SCRICRWNRNDMEIIKCPCNCKGS..VG--..-.-----..-.....-......-Y.IHLK.C.LKR
FBpp0071135  -----DR...........MCWICLRGDEDHRRRDWVHPCRCR..GTNK..-.-----..-.....-......-W.VHEA.C.LSR
FBpp0078401  -------...........-CPICLLTF---------------..RQQE..I.GTPAT..C.....E......HI.FCAA.C.IDA
FBpp0288691  -------...........-CIFCLDEQ---------------..RY--..-.PHHIS..C.....G......HS.FCSA.C.LKK
FBpp0070876  -LWPNAQ...........PCPMCMEELVH-------------..SAQN..P.AISLSr.C.....Q......HL.MHLQ.C.LNG
FBpp0083160  ------Gappmghtelp.TCPVCLERM---------------..DESV..D.GVLTIl.C.....N......HA.FHAS.C.LMK
FBpp0304474  ------Gappmghtelp.TCPVCLERM---------------..DESV..D.GVLTIl.C.....N......HA.FHAS.C.LMK
FBpp0085754  -------...........NCAICLSRC---------------..RR--..-.KCFTDs.C.....M......HQ.FCFK.C.LCE
FBpp0304302  -------...........NCAICLSRC---------------..RR--..-.KCFTDs.C.....M......HQ.FCFK.C.LCE
FBpp0303663  -------...........WCIQCSSGFFA-------------..RPKQ..K.RLICPd.C.....G......SV.TCAQ.C.RKP
FBpp0303660  -------...........WCIQCSSGFFA-------------..RPKQ..K.RLICPd.C.....G......SV.TCAQ.C.RKP
FBpp0303662  -------...........WCIQCSSGFFA-------------..RPKQ..K.RLICPd.C.....G......SV.TCAQ.C.RKP
FBpp0303658  -------...........WCIQCSSGFFA-------------..RPKQ..K.RLICPd.C.....G......SV.TCAQ.C.RKP
FBpp0074856  ----QDK...........KCGICFETIMEKE-----------..GGDK..R.FGILPs.C.....N......HV.FCFQ.C.ICT
FBpp0073752  -----DK...........MCGICLETVVKKR-----------..GREC..R.FGILPk.C.....K......HI.FCLT.C.IRR
FBpp0077310  -------...........DCWICYDSD---------------..KP--..E.PLIQP..C.....Rctgdv.SS.VHHE.C.LKR
FBpp0077311  -------...........DCWICYDSD---------------..KP--..E.PLIQP..C.....Rctgdv.SS.VHHE.C.LKR
FBpp0077312  -------...........DCWICYDSD---------------..KP--..E.PLIQP..C.....Rctgdv.SS.VHHE.C.LKR
FBpp0078830  -------...........TCRFCAEYT---------------..----..-.-----..-.....-......--.----.-.---
FBpp0084491  -------...........CCWICFETDKEAG-----------..---R..Q.AWVNP..ClcrgtN......KW.VHQS.C.ISL
FBpp0073027  -------...........ICSICDLKCEP-------------..HGRH..S.MVSLR..C.....G......HL.FGRH.C.INN
FBpp0080198  -------...........------------------------..----..-.-----..-.....-......-F.----.-.---
FBpp0073674  EIDDHGS...........ECVICMSET---------------..RD--..-.TLILP..C.....R......HLcLCNS.C.ADS
FBpp0297897  -------...........------------------------..----..-.PHHIS..C.....G......HS.FCSA.C.LKK
FBpp0085902  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0076706  ------K...........PCPICQT-----------------..QDDV..R.YVMMV..C.....G......HF.VCQH.C.LDS
FBpp0304173  ------K...........PCPICQT-----------------..QDDV..R.YVMMV..C.....G......HF.VCQH.C.LDS
FBpp0071688  -----RA...........ICKACHTGF---------------..----..-.-----..-.....-......--.-CFR.-.---
FBpp0071337  ------TryhctvcddfdLCIVCKEKV---------------..----..-.-----..-.....-......--.----.-.---
FBpp0291863  ------TryhctvcddfdLCIVCKEKV---------------..----..-.-----..-.....-......--.----.-.---
FBpp0291862  ------TryhctvcddfdLCIVCKEKV---------------..----..-.-----..-.....-......--.----.-.---
FBpp0305701  ------TryhctvcddfdLCIVCKEKV---------------..----..-.-----..-.....-......--.----.-.---
FBpp0086323  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0076010  -------...........----------------------AV..CAEP..R.AVLCK..C.....G......HE.FCFA.C.GEN
FBpp0076011  -------...........----------------------AV..CAEP..R.AVLCK..C.....G......HE.FCFA.C.GEN
FBpp0088499  -------...........--------------VDCTYAVKVP..YAEP..R.RVHCK..C.....G......HV.FCFA.C.GEN
FBpp0088500  -------...........--------------VDCTYAVKVP..YAEP..R.RVHCK..C.....G......HV.FCFA.C.GEN
FBpp0089023  -------...........--------------VDCTYAVKVP..YAEP..R.RVHCK..C.....G......HV.FCFA.C.GEN
FBpp0297199  -------...........--------------VDCTYAVKVP..YAEP..R.RVHCK..C.....G......HV.FCFA.C.GEN
FBpp0305073  -------...........--------------VDCTYAVKVP..YAEP..R.RVHCK..C.....G......HV.FCFA.C.GEN
FBpp0305074  -------...........--------------VDCTYAVKVP..YAEP..R.RVHCK..C.....G......HV.FCFA.C.GEN
FBpp0297896  -------...........------------------------..---R..Y.PHHIS..C.....G......HS.FCSA.C.LKK
FBpp0293251  -------...........LCTICLDPLSV-------------..YT--..-.MVYLR..C.....S......HA.LHEK.C.LHQ
FBpp0082202  --HLDPY...........VCNECNQYV---------------..RG--..-.GVITI..C.....G......HL.FCWT.C.LWP
FBpp0081830  -------...........LCTICLDPLSV-------------..YT--..-.MVYLR..C.....S......HA.LHEK.C.LHQ
FBpp0293250  -------...........LCTICLDPLSV-------------..YT--..-.MVYLR..C.....S......HA.LHEK.C.LHQ
FBpp0083244  -------...........KCHICRQSF---------------..VN--..-.PVVTK..C.....K......HY.FCEK.C.ALA
FBpp0076822  ---KETL...........TCPSCKVKR---------------..KD--..-.AVLSK..C.....F......HV.FCYD.C.LRT
FBpp0087350  -----DQ...........ACPRCKTTK---------------..YRNP..S.LKLMVnvC.....G......HT.LCES.C.VDL
FBpp0071001  -------...........ECVICLEDL---------------..SPGD..T.IARLP..C.....L......CI.YHKG.C.IDR
FBpp0087349  -------...........CCPMCAVPI---------------..EKDEgcA.QMMCKr.C.....K......HV.FCWY.C.LAS
FBpp0291679  -------...........CCPMCAVPI---------------..EKDEgcA.QMMCKr.C.....K......HV.FCWY.C.LAS
FBpp0083719  KQAQGKY...........KCLICIDDY---------------..KN--..P.AISVS..C.....W......HV.HCEQ.C.WLQ
FBpp0085756  -------...........TCCVCLDRY---------------..RI--..-.PKLLP..C.....Q......HS.FCMEpC.MEG
FBpp0085757  -------...........TCCVCLDRY---------------..RI--..-.PKLLP..C.....Q......HS.FCMEpC.MEG
FBpp0073753  -----DK...........MCGICFDTVVEKKG----------..RER-..R.FGILSk.C.....K......HI.FCLT.C.IRT
FBpp0113114  -------...........TCCVCLDRY---------------..RI--..-.PKLLP..C.....Q......HS.FCMEpC.MEG
FBpp0079210  ----DDL...........KCGICLDVY---------------..TD--..-.PRTLH..C.....L......HS.FCLQ.C.LV-
FBpp0303663  -------...........ECELCMNSY---------------..PMNQ..M.VSMLK..C.....L......HK.CCKQ.C.AKS
FBpp0303660  -------...........ECELCMNSY---------------..PMNQ..M.VSMLK..C.....L......HK.CCKQ.C.AKS
FBpp0303662  -------...........ECELCMNSY---------------..PMNQ..M.VSMLK..C.....L......HK.CCKQ.C.AKS
FBpp0303658  -------...........ECELCMNSY---------------..PMNQ..M.VSMLK..C.....L......HK.CCKQ.C.AKS
FBpp0086911  -------...........ICHLCQGYL---------------..IN--..A.TTIVE..C.....L......HS.FCHS.C.LIN
FBpp0078901  -------...........HCPVCLGDI---------------..HTSR..I.PCHIPd.C.....G......HL.LHKM.C.FDQ
FBpp0303613  -------...........HCPVCLGDI---------------..HTSR..I.PCHIPd.C.....G......HL.LHKM.C.FDQ
FBpp0081480  -------...........ECTICYENP---------------..ID--..-.SVLYM..C.....G......HMcMCYD.CaIEQ
FBpp0081479  -------...........ECTICYENP---------------..ID--..-.SVLYM..C.....G......HMcMCYD.CaIEQ
FBpp0289643  -------...........ECTICYENP---------------..ID--..-.SVLYM..C.....G......HMcMCYD.CaIEQ
FBpp0075181  -------...........NCPICCNEFA--------------..ASQR..C.PVSLG..C.....G......HT.ICKL.C.LTT
FBpp0303600  -------...........NCPICCNEFA--------------..ASQR..C.PVSLG..C.....G......HT.ICKL.C.LTT
FBpp0305463  -------...........NCPICCNEFA--------------..ASQR..C.PVSLG..C.....G......HT.ICKL.C.LTT
FBpp0081482  -------...........ECTICYENP---------------..ID--..-.SVLYM..C.....G......HMcMCYD.CaIEQ
FBpp0081481  -------...........ECTICYENP---------------..ID--..-.SVLYM..C.....G......HMcMCYD.CaIEQ
FBpp0082488  ----EDS...........LCPICCAKP---------------..IT--..-.AVFTP..C.....K......HQ.SCSD.C.IMQ
FBpp0297356  ----EDS...........LCPICCAKP---------------..IT--..-.AVFTP..C.....K......HQ.SCSD.C.IMQ
FBpp0073049  ----QDQ...........LCVVCSTNP---------------..KE--..-.IILLP..C.....G......HVcLCED.C.AQK
FBpp0076498  -----PL...........MCPLCSDIL---------------..RC--..-.PVTTN..C.....G......HT.FCRQ.C.CET
FBpp0293529  -----PL...........MCPLCSDIL---------------..RC--..-.PVTTN..C.....G......HT.FCRQ.C.CET
FBpp0072874  ------L...........CCAVCLDLP---------------..KT--..-.-AMYQ..Cqm...G......HL.MCAA.C.FTH
FBpp0086712  -------...........QCVVCLYGF---------------..ADGD..E.FTRTE..C.....F......HY.LHSY.C.LAR
FBpp0076329  -------...........TCTFCGERP---------------..TL--..-.PHHMG..C.....G......HI.YCYY.C.LNA
FBpp0088148  -------...........-CGACGELLG-----------LRP..EN--..-.LEALP..C.....A......HI.LHAR.C.AYE
FBpp0088149  -------...........-CGACGELLG-----------LRP..EN--..-.LEALP..C.....A......HI.LHAR.C.AYE
FBpp0083630  WLRDSDYis.........NCTLCGTTL---------------..EQGD..-.CVRLV..C.....Y......HV.FHWD.C.LNA
FBpp0111519  ------L...........ECPVCLEVI---------------..KP--..-.PGWQC..C.....Ng.....HV.LCNN.C.RS-
FBpp0291525  ------L...........ECPVCLEVI---------------..KP--..-.PGWQC..C.....Ng.....HV.LCNN.C.RS-
FBpp0072214  YTGNDDN...........ACVVCFKNV---------------..EI--..-.FSIGD..C.....D......HP.VCYE.C.STR
FBpp0302533  -------...........-CATCRCSL---------------..TE--..-.PYIK-..-.....-......--.-CSE.C.LDT
FBpp0302535  -------...........-CATCRCSL---------------..TE--..-.PYIK-..-.....-......--.-CSE.C.LDT
FBpp0080921  -------...........-CVVCMAQS---------------..RN--..-.VVVMP..C.....R......HLcLCKE.C.SLQ
FBpp0302534  -------...........-CATCRCSL---------------..TE--..-.PYIK-..-.....-......--.-CSE.C.LDT
FBpp0302531  -------...........-CATCRCSL---------------..TE--..-.PYIK-..-.....-......--.-CSE.C.LDT
FBpp0302532  -------...........-CATCRCSL---------------..TE--..-.PYIK-..-.....-......--.-CSE.C.LDT
FBpp0070904  ------N...........SCRICRWNR---------------..ND-M..E.IIKCP..C.....N......-C.KGSV.C.LKR
FBpp0088160  -------...........ECFVCNENT---------------..VT--..-.TALVP..C.....G......HNmFCME.C.ANH
FBpp0302676  -------...........ECFVCNENT---------------..VT--..-.TALVP..C.....G......HNmFCME.C.ANH
FBpp0302677  -------...........ECFVCNENT---------------..VT--..-.TALVP..C.....G......HNmFCME.C.ANH
FBpp0302678  -------...........ECFVCNENT---------------..VT--..-.TALVP..C.....G......HNmFCME.C.ANH
FBpp0078948  -------...........-CTLCKCLVL--------------..WD--..-.IRCGS..C.....N......IQ.YHRG.C.IQT
FBpp0305541  -------...........-CTLCKCLVL--------------..WD--..-.IRCGS..C.....N......IQ.YHRG.C.IQT
FBpp0073787  -----DD...........MCMICFVEA---------------..LSCA..P.SIHLE..C.....G......HV.FHYH.C.CKA
FBpp0303660  ---QNGI...........DCPKCKFRYSLA------------..RGGC..MhFTCTQ..C.....K......FE.FCYG.C.ARP
FBpp0303662  ---QNGI...........DCPKCKFRYSLA------------..RGGC..MhFTCTQ..C.....K......FE.FCYG.C.ARP
FBpp0303658  ---QNGI...........DCPKCKFRYSLA------------..RGGC..MhFTCTQ..C.....K......FE.FCYG.C.ARP
FBpp0084637  -------...........------------------------..EPTL..I.FHMTQ..C.....Q......HV.LCAS.C.LSE
FBpp0303663  ---QNGI...........DCPKCKFRYSLA------------..RGGC..MhFTCTQ..C.....K......FE.FCYG.C.ARP
FBpp0079685  ----DEL...........RCPTCKQLY---------------..AN--..-.PVLLP..C.....F......HA.LCLG.C.AL-
FBpp0293057  ----DEL...........RCPTCKQLY---------------..AN--..-.PVLLP..C.....F......HA.LCLG.C.AL-
FBpp0074742  -------...........ECYVCYTVIHQ-------------..ETCQ..L.PKLTCktC.....K......KK.FHGP.C.LYK
FBpp0074330  -------...........------------------------..----..-.V----..-.....-......--.----.-.---
FBpp0077974  -------...........-----------------------V..EPDC..R.KVTCQngC.....G......YV.FCRN.C.LQG
FBpp0077975  -------...........-----------------------V..EPDC..R.KVTCQngC.....G......YV.FCRN.C.LQG
FBpp0074330  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0075091  ------F...........ECPVCFDYV---------------..L---..-.PPILQ..Css...G......HL.VCVS.C.RSK
FBpp0075092  ------F...........ECPVCFDYV---------------..L---..-.PPILQ..Css...G......HL.VCVS.C.RSK
FBpp0304749  -----RL...........ECLVCVEAI---------------..KSHQ..P.TWSCRn.C.....Y......HM.LHLK.C.TIT
FBpp0086919  -----DE...........LCKICMDAP---------------..IE--..-.CVFLE..C.....G......HMaTCTS.C.G--
FBpp0080265  -----RL...........ECLVCVEAI---------------..KSHQ..P.TWSCRn.C.....Y......HM.LHLK.C.TIT
FBpp0080266  -----RL...........ECLVCVEAI---------------..KSHQ..P.TWSCRn.C.....Y......HM.LHLK.C.TIT
FBpp0304750  -----RL...........ECLVCVEAI---------------..KSHQ..P.TWSCRn.C.....Y......HM.LHLK.C.TIT
FBpp0305755  QDIKEQT...........MCPVCFDRI---------------..KN--..-.-MVFL..C.....G......HG.TCQM.C.GDQ
FBpp0075275  QDIKEQT...........MCPVCFDRI---------------..KN--..-.-MVFL..C.....G......HG.TCQM.C.GDQ
FBpp0084259  -------...........SCGLCHRPYDL-------------..ATGL..L.PQELA..C.....R......HS.FCKK.C.VQR
FBpp0293345  -------...........SCGLCHRPYDL-------------..ATGL..L.PQELA..C.....R......HS.FCKK.C.VQR
FBpp0077338  -------...........RCPICDSTVLPEYPEDIETDDNAD..FF--..-.IERVY..C.....G......HL.FHQG.C.LKK
FBpp0076695  -------...........KCSMCRQRL---------------..YDHS..Q.VLIFGg.C.....G......HG.IHEQ.C.MEE
FBpp0084258  -------...........SCGLCHRPYDL-------------..ATGL..L.PQELA..C.....R......HS.FCKK.C.VQR
FBpp0074479  -------...........------------------------..-DPA..VpFHLTQ..C.....R......HV.ICGP.C.LGQ
FBpp0070458  ---IEEL...........RCPGCAGAM---------------..KA--..-.PILLCk.S.....G......HS.VCEQ.C.TRI
FBpp0293251  -------...........RCTFCQYEL---------------..SDDD..-.RRRMR..C.....G......HA.MHNL.C.YLV
FBpp0086219  ----QED...........ECVICINAR---------------..AT--..-.MQTSP..C.....G......HRvVCRR.C.FVK
FBpp0081830  -----NG...........RCTFCQYEL---------------..SDDD..-.RRRMR..C.....G......HA.MHNL.C.YLV
FBpp0293250  -----NG...........RCTFCQYEL---------------..SDDD..-.RRRMR..C.....G......HA.MHNL.C.YLV
FBpp0290962  -------...........------------------------..----..-.VHVQS..C.....G......HH.VHLS.C.LEA
FBpp0303730  -------...........------------------------..----..-.VHVQS..C.....G......HH.VHLS.C.LEA
FBpp0303731  -------...........------------------------..----..-.VHVQS..C.....G......HH.VHLS.C.LEA
FBpp0070045  --EFRND...........KCDICREML---------------..SM--..Q.SIYFL..C.....Q......HS.FHEE.C.LNY
FBpp0289844  -------...........-CVYCAQLL---------------..GSND..R.PKLLE..C.....L......HV.ACAQ.C.VST
FBpp0083320  -------...........-CVYCAQLL---------------..GSND..R.PKLLE..C.....L......HV.ACAQ.C.VST
FBpp0070259  LTVESQD...........TCEICEMMLLV-------------..KP--..-.FFIFI..C.....G......HK.FHSD.C.LEK
FBpp0303076  -------...........-CVYCAQLL---------------..GSND..R.PKLLE..C.....L......HV.ACAQ.C.VST
FBpp0077259  ------Lrqll.......SCVVCCQLL---------------..VDPY..S.PKGKR..C.....Q......HN.VCRL.C.LRG
FBpp0077260  ------Lrqll.......SCVVCCQLL---------------..VDPY..S.PKGKR..C.....Q......HN.VCRL.C.LRG
FBpp0071476  -------...........-CPILRQQT---------------..SEDN..P.PKKLT..C.....G......HV.ISND.A.LHK
FBpp0305661  -----DK...........LCKLCSLRL---------------..VM--..-.PRILS..C.....L......HV.FCED.C.LQA
FBpp0071238  -----DK...........LCKLCSLRL---------------..VM--..-.PRILS..C.....L......HV.FCED.C.LQA
FBpp0305660  -----DK...........LCKLCSLRL---------------..VM--..-.PRILS..C.....L......HV.FCED.C.LQA
FBpp0305662  -----DK...........LCKLCSLRL---------------..VM--..-.PRILS..C.....L......HV.FCED.C.LQA
FBpp0290897  -------...........ECPVCFGYI---------------..MP--..-.-PIMQ..Cpr...G......HL.ICST.C.RSK
FBpp0080804  -------...........------------------------..-Y--..-.GRMIP..C.....K......HV.FCLK.C.ARA
FBpp0110415  -----EQ...........LCSLCHRPVLMAGT--------HL..YC--..-.IIRLE..C.....G......HV.YHKP.C.IQG
FBpp0070464  -------...........HCNSCCALF---------------..CDKK..H.TFFLLa.C.....H......HV.FCER.C.VKV
FBpp0083736  -------...........ECPVCGVTI---------------..SP--..-.-PAMQ..Cqn...G......HL.LCVD.C.---
FBpp0110416  -----EQ...........LCSLCHRPVLMAGT--------HL..YC--..-.IIRLE..C.....G......HV.YHKP.C.IQG
FBpp0305698  -----EQ...........LCSLCHRPVLMAGT--------HL..YC--..-.IIRLE..C.....G......HV.YHKP.C.IQG
FBpp0110417  -----EQ...........LCSLCHRPVLMAGT--------HL..YC--..-.IIRLE..C.....G......HV.YHKP.C.IQG
FBpp0305699  -----EQ...........LCSLCHRPVLMAGT--------HL..YC--..-.IIRLE..C.....G......HV.YHKP.C.IQG
FBpp0077974  -------...........-CLACTDVS---------------..DT--..-.VLVFP..C.....Asq....HV.TCID.C.FRH
FBpp0077975  -------...........-CLACTDVS---------------..DT--..-.VLVFP..C.....Asq....HV.TCID.C.FRH
FBpp0303687  -------...........------------------------..-Y--..-.GRMIP..C.....K......HV.FCLK.C.ARA
FBpp0084110  -------...........------------------------..----..-.-----..-.....-......--.----.-.---
FBpp0301716  ----SGS...........VCPSCRISF---------------..DKGK..R.RKLIDt.C.....G......HE.RCYS.C.MFR
FBpp0306230  ----SGS...........VCPSCRISF---------------..DKGK..R.RKLIDt.C.....G......HE.RCYS.C.MFR


                     80                               90       100       110                        
                      |                                |         |         |                        
d1v87a_        MYCNGNKDG.......................SLQCPSCKTIYGEKTGTQPWGKMEVFRSGP---ssg.................
FBpp0070117  WLKTRQV--.......................---CPLDNREWDFQ-------------------k...................
FBpp0076341  WQVDSEGQG.......................---CPFCRAEIK---------------------gteqivvdaf..........
FBpp0076342  WQVDSEGQG.......................---CPFCRAEIK---------------------gteqivvdaf..........
FBpp0300874  WLKTRQV--.......................---CPLDNREWDFQ-------------------k...................
FBpp0072446  WLKTRLV--.......................---CPLDNKEWVYQ-------------------k...................
FBpp0087189  WVKQNNR--.......................---CPLCQQEWSIQ-------------------r...................
FBpp0291421  WVKQNNR--.......................---CPLCQQEWSIQ-------------------r...................
FBpp0072976  ---------.......................-------------------G-------------simcgrkffdgsggndhave
FBpp0298309  ---------.......................-------------------G-------------simcgrkffdgsggndhave
FBpp0079303  WLNLQPLNK.......................Q--CPMCRQSWK---------------------f...................
FBpp0111655  WLNLQPLNK.......................Q--CPMCRQSWK---------------------f...................
FBpp0305611  WLNLQPLNK.......................Q--CPMCRQSWK---------------------f...................
FBpp0083160  WG--DST--.......................---CPVCRHVQTP--------------------glvedsvcmecegtdslwic
FBpp0304474  WG--DST--.......................---CPVCRHVQTP--------------------glvedsvcmecegtdslwic
FBpp0298372  ---------.......................---------------------------------yvnahmeqhsveeqhplams
FBpp0073825  ---------.......................---------------------------------yvnahmeqhsveeqhplams
FBpp0073827  ---------.......................---------------------------------yvnahmeqhsveeqhplams
FBpp0073826  ---------.......................---------------------------------yvnahmeqhsveeqhplams
FBpp0303431  ---------.......................---------------------------------yvnahmeqhsveeqhplams
FBpp0080009  ---------.......................---------------------------------tdpfnrqpltedmlvaniel
FBpp0290465  ---------.......................---------------------------------tdpfnrqpltedmlvaniel
FBpp0078927  ---------.......................--------S------------------------tiarhllsdqtdpfnreplt
FBpp0110216  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0083180  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0110215  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0083179  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0110218  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0110217  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0083178  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0110219  ---------.......................---------------------------------fgrnaknhklthpmheyctt
FBpp0079617  ---------.......................---------------------------------ieehlqrvghfdpvtrvklt
FBpp0080686  ---------.......................---------------------------------aedlhdiehpfiryttpnsl
FBpp0074414  ---------.......................---------------------------------qgrgtnthaythsvgeahhv
FBpp0081445  WLNLHST--.......................---CPICRKSL----------------------add.................
FBpp0304107  SIKRQNGLGn......................EVYCPS---------------------------gdrcplansvipwafmqgei
FBpp0073495  SIKRQNGLGn......................EVYCPS---------------------------gdrcplansvipwafmqgei
FBpp0271753  SIKRQNGLGn......................EVYCPS---------------------------gdrcplansvipwafmqgei
FBpp0083052  WLKKTNS--.......................---CPLCRYELE---------------------td..................
FBpp0288650  WLKKTNS--.......................---CPLCRYELE---------------------td..................
FBpp0305755  ---------.......................---------------------------------dkhhlrhrfyrittpggert
FBpp0075275  ---------.......................---------------------------------dkhhlrhrfyrittpggert
FBpp0080794  ---------.......................---------------------------------nydlcqkcelahkhpehlml
FBpp0099683  ---------.......................---------------------------------nydlcqkcelahkhpehlml
FBpp0076010  WEPHGSS--.......................---------------------------------wyscnrfde...........
FBpp0076011  WEPHGSS--.......................---------------------------------wyscnrfde...........
FBpp0081594  WLRSNRT--.......................---CPICRGN-----------------------asd.................
FBpp0081595  WLRSNRT--.......................---CPICRGN-----------------------asd.................
FBpp0088499  WEPHGSS--.......................---------------------------------wyncnryde...........
FBpp0088500  WEPHGSS--.......................---------------------------------wyncnryde...........
FBpp0089023  WEPHGSS--.......................---------------------------------wyncnryde...........
FBpp0297199  WEPHGSS--.......................---------------------------------wyncnryde...........
FBpp0305073  WEPHGSS--.......................---------------------------------wyncnryde...........
FBpp0305074  WEPHGSS--.......................---------------------------------wyncnryde...........
FBpp0072361  WLIEHRT--.......................---CPMCKLDVLK--------------------fyg.................
FBpp0081596  WLRSNRT--.......................---CPICRGN-----------------------asd.................
FBpp0085201  WFQRQQT--.......................---CPTCRLNIL---------------------rt..................
FBpp0303146  WFQRQQT--.......................---CPTCRLNIL---------------------rt..................
FBpp0289415  WLIEHRT--.......................---CPMCKLDVL---------------------kf..................
FBpp0297426  WLIEHRT--.......................---CPMCKLDVL---------------------kf..................
FBpp0289416  WLIEHRT--.......................---CPMCKLDVLK--------------------fyg.................
FBpp0081908  WLVTNKH--.......................---CPICRVDIETH-------------------mp..................
FBpp0081909  WLVTNKH--.......................---CPICRVDIETH-------------------mp..................
FBpp0300326  WLVTNKH--.......................---CPICRVDIETH-------------------mp..................
FBpp0303202  WLVTNKH--.......................---CPICRVDIETH-------------------mp..................
FBpp0289929  WFKREQT--.......................---CPMCRAKVSDD-------------------pawqd...............
FBpp0081217  WLTENRRV-.......................---CPICKRKVFT--------------------k...................
FBpp0081218  WLTENRRV-.......................---CPICKRKVFT--------------------k...................
FBpp0081219  WLTENRRV-.......................---CPICKRKVFT--------------------k...................
FBpp0112110  WLTENRRV-.......................---CPICKRKVFT--------------------k...................
FBpp0075265  WLTRQPT--.......................---CPVDRNSLTTA-------------------nlravprilrnllsrlsitc
FBpp0305750  WLTRQPT--.......................---CPVDRNSLTTA-------------------nlravprilrnllsrlsitc
FBpp0087040  ---------.......................---------------------------------hgktslnhqndhevkeyssy
FBpp0087041  ---------.......................---------------------------------hgktslnhqndhevkeyssy
FBpp0099693  ---------.......................---------------------------------hgktslnhqndhevkeyssy
FBpp0293614  ---------.......................---------------------------------hgktslnhqndhevkeyssy
FBpp0300837  ---------.......................---------------------------------hgktslnhqndhevkeyssy
FBpp0293613  ---------.......................---------------------------------hgktslnhqndhevkeyssy
FBpp0111987  ---------.......................---------------------------------hgktslnhqndhevkeyssy
FBpp0088192  WLLRSLT--.......................---CPSCLEPV----------------------d...................
FBpp0305836  WLLRSLT--.......................---CPSCLEPV----------------------d...................
FBpp0080156  WMIQKQI--.......................---CPVDRSGLLTS-------------------hlvpvsrlmrnmlsrlkikc
FBpp0071136  WMQKNNQC-.......................---CPMDNKRLSAEHDIFPDNYT----------rreieqlkrdcp........
FBpp0071688  WKTHGSE--.......................---------------------------------yyecsrykd...........
FBpp0072626  WLEERDE--.......................---CPLCRESL----------------------kk..................
FBpp0305589  WLEERDE--.......................---CPLCRESL----------------------kk..................
FBpp0085928  WLNRSRT--.......................---CPQCRDPC----------------------dr..................
FBpp0305076  WLNRSRT--.......................---CPQCRDPC----------------------dr..................
FBpp0073970  WLLTRPNRK.......................L--CPVCKAAVD---------------------kd..................
FBpp0073971  WLLTRPNRK.......................L--CPVCKAAVD---------------------kd..................
FBpp0073972  WLLTRPNRK.......................L--CPVCKAAVD---------------------kd..................
FBpp0073973  WLLTRPNRK.......................L--CPVCKAAVD---------------------kd..................
FBpp0073974  WLLTRPNRK.......................L--CPVCKAAVD---------------------kd..................
FBpp0073969  WLLTRPNRK.......................L--CPVCKAAVD---------------------kd..................
FBpp0112351  WLLTRPNRK.......................L--CPVCKAAVD---------------------kd..................
FBpp0070738  ---------.......................---------------------------------lclkcgsqlcgrarhkhale
FBpp0070739  ---------.......................---------------------------------lclkcgsqlcgrarhkhale
FBpp0070740  ---------.......................---------------------------------lclkcgsqlcgrarhkhale
FBpp0070741  ---------.......................---------------------------------lclkcgsqlcgrarhkhale
FBpp0084614  ALRSGNKE-.......................---CPTCRKKLVSKRSLRA--------------dpnf................
FBpp0289967  ---------.......................---------------------------------lcadcyedgvtstrhlvehp
FBpp0289968  ---------.......................---------------------------------lcadcyedgvtstrhlvehp
FBpp0289969  ---------.......................---------------------------------lcadcyedgvtstrhlvehp
FBpp0289970  ---------.......................---------------------------------lcadcyedgvtstrhlvehp
FBpp0289971  ---------.......................---------------------------------lcadcyedgvtstrhlvehp
FBpp0289972  ---------.......................---------------------------------lcadcyedgvtstrhlvehp
FBpp0293183  AIGDYKK--.......................---CPMCNKKIMYK-------------------qltrif..............
FBpp0078288  AIRATHK--.......................---CPICNKKLTA--------------------rqffriy.............
FBpp0078287  AIRATHK--.......................---CPICNKKLTA--------------------rqffriy.............
FBpp0070328  WRKQSRT--.......................---CPICRS------------------------q...................
FBpp0302591  WRKQSRT--.......................---CPICRS------------------------q...................
FBpp0080497  HLQHADM--.......................---CPICRKVA----------------------ie..................
FBpp0079604  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0293056  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0079599  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0079600  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0079601  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0079602  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0079603  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0293055  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0304028  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0304029  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0304027  IRTDENKL-.......................---CPACRKEYPEN-------------------padfkp..............
FBpp0075392  WILTKPDHT.......................V--CPVCKSGVDR--------------------skvipvyar...........
FBpp0076222  WLTASETNS.......................---CELCKFPF----------------------i...................
FBpp0301283  WLTASETNS.......................---CELCKFPF----------------------i...................
FBpp0112083  AIRRSHR--.......................---CPICRRR-----------------------a...................
FBpp0305236  AIRRSHR--.......................---CPICRRR-----------------------a...................
FBpp0298003  SLLESEDSE.......................---CPDCKEKNCSPGSLIP--------------nrflrnsvnafknetgy...
FBpp0111417  WIRSQKY--.......................QAKCPYCQSLIG---------------------en..................
FBpp0090973  YLQRNKT--.......................---CPICKSQM----------------------irc.................
FBpp0073824  ---HSNS--.......................---CAGCRKEHIV--------------------girfrcqvcrdislclpcfa
FBpp0303430  ---HSNS--.......................---CAGCRKEHIV--------------------girfrcqvcrdislclpcfa
FBpp0071688  YFETQIFQG.......................---------------------------------istqigcmaqmcnvrvpedl
FBpp0075105  WLNESHRQSs......................VKVCPQCKTKA----------------------tf..................
FBpp0305787  WLNESHRQSs......................VKVCPQCKTKA----------------------tf..................
FBpp0089378  WLYVQDR--.......................---CPLCHEIM----------------------my..................
FBpp0072158  SLLESEDSE.......................---CPDCKEKNCSPGSLIP--------------nrflrnsvnafknetgy...
FBpp0088499  YLSTKIV--.......................---------------------------------aeglgqtiscaahgcdilvd
FBpp0088500  YLSTKIV--.......................---------------------------------aeglgqtiscaahgcdilvd
FBpp0089023  YLSTKIV--.......................---------------------------------aeglgqtiscaahgcdilvd
FBpp0297199  YLSTKIV--.......................---------------------------------aeglgqtiscaahgcdilvd
FBpp0305073  YLSTKIV--.......................---------------------------------aeglgqtiscaahgcdilvd
FBpp0305074  YLSTKIV--.......................---------------------------------aeglgqtiscaahgcdilvd
FBpp0305075  WLDRSKT--.......................---CPQCRNKC----------------------tt..................
FBpp0085929  WLDRSKT--.......................---CPQCRNKC----------------------tt..................
FBpp0089379  WLYVQDR--.......................---CPLCHEI-----------------------mm..................
FBpp0084797  WLYVQDR--.......................---CPLCHEI-----------------------mm..................
FBpp0084798  WLYVQDR--.......................---CPLCHEI-----------------------mm..................
FBpp0305390  WLYVQDR--.......................---CPLCHEI-----------------------mm..................
FBpp0291240  AVDTGRV--.......................---CPLCGV------------------------d...................
FBpp0291241  AVDTGRV--.......................---CPLCGV------------------------d...................
FBpp0080385  AIRRNHR--.......................---CPICRRR-----------------------a...................
FBpp0081303  ---------.......................---------------------------------cfaagaeigahqnnhsyqfm
FBpp0086906  HLLRAVY--.......................---CPECKASGG---------------------keinelnlksddtlrsliyk
FBpp0289616  HLLRAVY--.......................---CPECKASGG---------------------keinelnlksddtlrsliyk
FBpp0303463  HLLRAVY--.......................---CPECKASGG---------------------keinelnlksddtlrsliyk
FBpp0297447  VAYKNRR--.......................---CAMCRREIP---------------------ae..................
FBpp0074730  VAYKNRR--.......................---CAMCRREIP---------------------ae..................
FBpp0099776  ---------.......................---------------------------------cfaagaeigahqnnhsyqfm
FBpp0084991  ---------.......................---------------------------------eakwgrqpsdpftglefnaq
FBpp0288555  VAYKNRR--.......................---CAMCRREIP---------------------ae..................
FBpp0304246  VAYKNRR--.......................---CAMCRREIP---------------------ae..................
FBpp0076498  CMDYNSP--.......................---CPLCMSPLVE--------------------f...................
FBpp0293529  CMDYNSP--.......................---CPLCMSPLVE--------------------f...................
FBpp0288698  HITSHLRSKkhnvalelshg............TLYCYACRDF-----------------------iyda................
FBpp0072779  WMRYSHKEY.......................---CELCSYS-----------------------f...................
FBpp0289997  WMRYSHKEY.......................---CELCSYS-----------------------f...................
FBpp0080229  Q--------.......................---------------------------------ieteehranhpmqlf.....
FBpp0290952  Q--------.......................---------------------------------ieteehranhpmqlf.....
FBpp0072708  YLSLSDK-T.......................WRKCPICY-------------------------dai.................
FBpp0072709  YLSLSDK-T.......................WRKCPICY-------------------------dai.................
FBpp0086838  YREARNWVA.......................-KRCPICRSSLDM--------------------d...................
FBpp0291638  YREARNWVA.......................-KRCPICRSSLDM--------------------d...................
FBpp0074245  WCIVGKKQT.......................---CPYCKEKVDLQKMFR---------------npwe................
FBpp0074242  WCIVGKKQT.......................---CPYCKEKVDLQKMFR---------------npwe................
FBpp0074243  WCIVGKKQT.......................---CPYCKEKVDLQKMFR---------------npwe................
FBpp0074244  WCIVGKKQT.......................---CPYCKEKVDLQKMFR---------------npwe................
FBpp0087349  YVEFEISEGay.....................EISCP----------------------------datcpaqgaislpeianltt
FBpp0291679  YVEFEISEGay.....................EISCP----------------------------datcpaqgaislpeianltt
FBpp0076010  YLANKTCSEglan...................TIKCPA---------------------------anceilvdyisflkladdse
FBpp0076011  YLANKTCSEglan...................TIKCPA---------------------------anceilvdyisflkladdse
FBpp0085553  WISTSRCTT.......................---CELCQFQY----------------------n...................
FBpp0078590  WIDEKTQKGnalr...................TVSCPQCQTEY----------------------i...................
FBpp0112237  ---------.......................---------------------------------dlcsdckengvsnglhsldh
FBpp0070521  ---------.......................---------------------------------dlcsdckengvsnglhsldh
FBpp0075071  HLEEKKT--.......................---CPTCDNIIHQSH------------------plqyi...............
FBpp0298337  HLEEKKT--.......................---CPTCDNIIHQSH------------------plqyi...............
FBpp0070506  WIDEKQLGDrrq....................TVICQQCQTEY----------------------i...................
FBpp0078038  WRQAKQFENki.....................TRACPECRVC-----------------------sdf.................
FBpp0078039  WRQAKQFENki.....................TRACPECRVC-----------------------sdf.................
FBpp0293874  WRQAKQFENki.....................TRACPECRVC-----------------------sdf.................
FBpp0302614  WIDEKQLGDrrq....................TVICQQCQTEY----------------------i...................
FBpp0077675  HMKEHGT--.......................---CPVTHYPISL--------------------ddlvriy.............
FBpp0305188  HMKEHGT--.......................---CPVTHYPISL--------------------ddlvriy.............
FBpp0077974  ---------.......................---CPKCRTPTERD-------------------ggcmhmvctragcgfewcwv
FBpp0077975  ---------.......................---CPKCRTPTERD-------------------ggcmhmvctragcgfewcwv
FBpp0086007  IVASQHKLR.......................---CPECRILVSCKIDELPPNVLL---------mri.................
FBpp0070905  WIMHRRDNR.......................---CEICNAVF----------------------n...................
FBpp0071135  WIDEKEMLSpga....................PVTCTQCRTEY----------------------i...................
FBpp0078401  WSRNVQT--.......................---CPIDRIEFD---------------------ri..................
FBpp0288691  YLELGRDSR.......................---CPLCRRDFR---------------------ad..................
FBpp0070876  MIIAQQNEMnknl...................FIECPVCGIVYGEKVGNQPIGSMSWSIIS----kn..................
FBpp0083160  WG--DST--.......................---CPVCRHV-----------------------qt..................
FBpp0304474  WG--DST--.......................---CPVCRHV-----------------------qt..................
FBpp0085754  WSKIKPE--.......................---CPLCKQPFRT--------------------ii..................
FBpp0304302  WSKIKPE--.......................---CPLCKQPFRT--------------------ii..................
FBpp0303663  WERQHE---.......................---------------------------------gssceaylewkr........
FBpp0303660  WERQHE---.......................---------------------------------gssceaylewkr........
FBpp0303662  WERQHE---.......................---------------------------------gssceaylewkr........
FBpp0303658  WERQHE---.......................---------------------------------gssceaylewkr........
FBpp0074856  WRHATQYAYqv.....................TRACPECRVW-----------------------snf.................
FBpp0073752  WRQAEYIEDnv.....................KRGCPECRV------------------------fse.................
FBpp0077310  WLVESCSNSea.....................QLSCKVCGHPY----------------------e...................
FBpp0077311  WLVESCSNSea.....................QLSCKVCGHPY----------------------e...................
FBpp0077312  WLVESCSNSea.....................QLSCKVCGHPY----------------------e...................
FBpp0078830  ---------.......................---------------------------------lcgkcfdanhlpaspqhryy
FBpp0084491  WIDEKTRINnnlq...................AVSCPQCQTEY----------------------t...................
FBpp0073027  VLRESSR--.......................---CPTCSR------------------------ra..................
FBpp0080198  ---------.......................---------------------------------diceecydndfttsthpfdh
FBpp0073674  LRYQANN--.......................---CPICRAPFRA--------------------llqi................
FBpp0297897  YLELGRDSR.......................---CPLCRRDFR---------------------ad..................
FBpp0085902  ---------.......................---------------------------------rviekyllengcdpisgkel
FBpp0076706  MRRKNGRAG.......................VTKCPLCRQDS----------------------pql.................
FBpp0304173  MRRKNGRAG.......................VTKCPLCRQDS----------------------pql.................
FBpp0071688  ---------.......................---------------------------------cgmdyhaptdcqvikkwl..
FBpp0071337  ---------.......................---------------------------------ghqhkmek............
FBpp0291863  ---------.......................---------------------------------ghqhkmek............
FBpp0291862  ---------.......................---------------------------------ghqhkmek............
FBpp0305701  ---------.......................---------------------------------ghqhkmek............
FBpp0086323  -L-------.......................---------------------------------ktfkvnpitgqkmdskslvk
FBpp0076010  WHEP-----.......................---------------------------------ascsslkkwv..........
FBpp0076011  WHEP-----.......................---------------------------------ascsslkkwv..........
FBpp0088499  WH-------.......................---------------------------------dpvkcrwlkkwi........
FBpp0088500  WH-------.......................---------------------------------dpvkcrwlkkwi........
FBpp0089023  WH-------.......................---------------------------------dpvkcrwlkkwi........
FBpp0297199  WH-------.......................---------------------------------dpvkcrwlkkwi........
FBpp0305073  WH-------.......................---------------------------------dpvkcrwlkkwi........
FBpp0305074  WH-------.......................---------------------------------dpvkcrwlkkwi........
FBpp0297896  YLELGRDSR.......................---CPLCRRDFR---------------------ad..................
FBpp0293251  YQANGGRH-.......................---CPVCRMG-----------------------i...................
FBpp0082202  KLSGTAQPR.......................---CPCCQRHLLMYEDI----------------mpf.................
FBpp0081830  YQANGGRH-.......................---CPVCRMG-----------------------i...................
FBpp0293250  YQANGGRH-.......................---CPVCRMG-----------------------i...................
FBpp0083244  QYKKSQR--.......................---CIICSQQT----------------------ngifnpa.............
FBpp0076822  RYETRQRK-.......................---CPKCNCAF----------------------g...................
FBpp0087350  LFLKGSGA-.......................---CPECMVPLR---------------------rnnfrvql............
FBpp0071001  WFEVNRS--.......................---CP----------------------------e...................
FBpp0087349  ---------.......................---------------------------------ldd.................
FBpp0291679  ---------.......................---------------------------------ldd.................
FBpp0083719  TLGARKL--.......................---CPQCNSITTP--------------------k...................
FBpp0085756  LVDYVRR--.......................QVKCPECRAEHRIPYN-----------------gvqafptnvtlqrflelhie
FBpp0085757  LVDYVRR--.......................QVKCPECRAEHRIPYN-----------------gvqafptnvtlqrflelhie
FBpp0073753  WRQAHQFEAtv.....................TRGCPECRVFS----------------------efvc................
FBpp0113114  LVDYVRR--.......................QVKCPECRAEHRIPYN-----------------gvqafptnvtlqrflelhie
FBpp0079210  ---------.......................---------------------------------s...................
FBpp0303663  YFTVQITDRsin....................DCSCPFCKLP-----------------------elsn................
FBpp0303660  YFTVQITDRsin....................DCSCPFCKLP-----------------------elsn................
FBpp0303662  YFTVQITDRsin....................DCSCPFCKLP-----------------------elsn................
FBpp0303658  YFTVQITDRsin....................DCSCPFCKLP-----------------------elsn................
FBpp0086911  HLRKERF--.......................---CPRCEMVIN---------------------nak.................
FBpp0078901  LLASGHYT-.......................---CPTCQTSLIDM-------------------talwv...............
FBpp0303613  LLASGHYT-.......................---CPTCQTSLIDM-------------------talwv...............
FBpp0081480  WRGVGGGQ-.......................---CPLCRAVIR---------------------dv..................
FBpp0081479  WRGVGGGQ-.......................---CPLCRAVIR---------------------dv..................
FBpp0289643  WRGVGGGQ-.......................---CPLCRAVIR---------------------dv..................
FBpp0075181  LYNRQ----.......................---CPFDQTVIVSDIDNLPINHAL---------lqlvk...............
FBpp0303600  LYNRQ----.......................---CPFDQTVIVSDIDNLPINHAL---------lqlvk...............
FBpp0305463  LYNRQ----.......................---CPFDQTVIVSDIDNLPINHAL---------lqlvk...............
FBpp0081482  WRGVGGGQ-.......................---CPLCRAVIR---------------------dv..................
FBpp0081481  WRGVGGGQ-.......................---CPLCRAVIR---------------------dv..................
FBpp0082488  HMMNSKV--.......................---CFYCKTTIQT--------------------i...................
FBpp0297356  HMMNSKV--.......................---CFYCKTTIQT--------------------i...................
FBpp0073049  ---ISVT--.......................---CPVCRGSIVS--------------------k...................
FBpp0076498  ITQ------.......................---CNICQVRFP---------------------riqassp.............
FBpp0293529  ITQ------.......................---CNICQVRFP---------------------riqassp.............
FBpp0072874  LLADGRLRDq......................IATCPNCRVEISKSTAS----------------rnlavekaaselpsec....
FBpp0086712  HLNALRRNYqeefdklpawlqktadpf.....QALCPVCREHI----------------------gde.................
FBpp0076329  NVLTDASF-.......................--CCPNCGSA-----------------------cp..................
FBpp0088148  ILRRREKNA.......................PRSCPACNKLIS---------------------sr..................
FBpp0088149  ILRRREKNA.......................PRSCPACNKLIS---------------------sr..................
FBpp0083630  RQAALPANTapr....................GHQCPACSVEIFPN-------------------an..................
FBpp0111519  ---RSVK--.......................---CPVCRVPLG---------------------pr..................
FBpp0291525  ---RSVK--.......................---CPVCRVPLG---------------------pr..................
FBpp0072214  MRVLCQQNE.......................---CPICRHVLS---------------------kv..................
FBpp0302533  LLCLQ----.......................---------------------------------cfsrgkeafshrnnhayiiv
FBpp0302535  LLCLQ----.......................---------------------------------cfsrgkeafshrnnhayiiv
FBpp0080921  LVLLLEDR-.......................---CPVCRHNIT---------------------sf..................
FBpp0302534  LLCLQ----.......................---------------------------------cfsrgkeafshrnnhayiiv
FBpp0302531  LLCLQ----.......................---------------------------------cfsrgkeafshrnnhayiiv
FBpp0302532  LLCLQ----.......................---------------------------------cfsrgkeafshrnnhayiiv
FBpp0070904  WIMHRRDNR.......................---CEICNAVF----------------------n...................
FBpp0088160  ICLSMDAV-.......................---CPVCNSIVY---------------------ha..................
FBpp0302676  ICLSMDAV-.......................---CPVCNSIVY---------------------ha..................
FBpp0302677  ICLSMDAV-.......................---CPVCNSIVY---------------------ha..................
FBpp0302678  ICLSMDAV-.......................---CPVCNSIVY---------------------ha..................
FBpp0078948  YLQRRDI--.......................---CPSCGNLWTT--------------------p...................
FBpp0305541  YLQRRDI--.......................---CPSCGNLWTT--------------------p...................
FBpp0073787  VLEKRWSGPritfg..................FSLCPICKADIQH--------------------p...................
FBpp0303660  FMMGAK---.......................---------------------------------ctvstycaklglhahhprnc
FBpp0303662  FMMGAK---.......................---------------------------------ctvstycaklglhahhprnc
FBpp0303658  FMMGAK---.......................---------------------------------ctvstycaklglhahhprnc
FBpp0084637  S-STDKK--.......................---CPLCKRDLR---------------------aip.................
FBpp0303663  FMMGAK---.......................---------------------------------ctvstycaklglhahhprnc
FBpp0079685  ---------.......................---------------------------------diqt................
FBpp0293057  ---------.......................---------------------------------diqt................
FBpp0074742  WFTTSSKST.......................---CPICRN------------------------v...................
FBpp0074330  ---------.......................---------------------------------vtmecverlirkdmihpltd
FBpp0077974  ---------.......................---------------------------------yhi.................
FBpp0077975  ---------.......................---------------------------------yhi.................
FBpp0074330  ---------.......................------CRRPVITKDG-----------------ylfdkeailqyivtkk....
FBpp0075091  -----LTC-.......................---CPTCRGPLANIR------------------nlamekvasnvk........
FBpp0075092  -----LTC-.......................---CPTCRGPLANIR------------------nlamekvasnvk........
FBpp0304749  WASSSKSEV.......................GWRCPACQNVL----------------------q...................
FBpp0086919  --KVLNE--.......................---CPICRQYIV---------------------rv..................
FBpp0080265  WASSSKSEV.......................GWRCPACQNVL----------------------q...................
FBpp0080266  WASSSKSEV.......................GWRCPACQNVL----------------------q...................
FBpp0304750  WASSSKSEV.......................GWRCPACQNVL----------------------q...................
FBpp0305755  I------EG.......................---CPICRKTV----------------------ek..................
FBpp0075275  I------EG.......................---CPICRKTV----------------------ek..................
FBpp0084259  NTDHNSS--.......................ECICNLCGYRTQLDGQQLPQSVT----------imyllrelpalil.......
FBpp0293345  NTDHNSS--.......................ECICNLCGYRTQLDGQQLPQSVT----------imyllrelpalil.......
FBpp0077338  YLSEPPFPKg......................GKLCP----------------------------....................
FBpp0076695  SETQFEE--.......................---CPRCFTAIP---------------------dq..................
FBpp0084258  NTDHNSS--.......................ECICNLCGYRTQLDGQQLPQSVT----------imyllrelpalil.......
FBpp0074479  SSLEK-N--.......................---CPLCGQVLK---------------------aiq.................
FBpp0070458  LLM------.......................---CPLCKEPFTN--------------------srs.................
FBpp0293251  FRYSHRK--.......................---CLECDKVV----------------------nv..................
FBpp0086219  TIQSAVAQRll.....................PLRCVICRARVN---------------------rl..................
FBpp0081830  FRYSHRK--.......................---CLECDKVV----------------------nv..................
FBpp0293250  FRYSHRK--.......................---CLECDKVV----------------------nv..................
FBpp0290962  YLKTLYTTQrqpvqdrg...............EFYCPVCRQLS----------------------nsvl................
FBpp0303730  YLKTLYTTQrqpvqdrg...............EFYCPVCRQLS----------------------nsvl................
FBpp0303731  YLKTLYTTQrqpvqdrg...............EFYCPVCRQLS----------------------nsvl................
FBpp0070045  KSTKRQE--.......................KFLCIICKT------------------------rn..................
FBpp0289844  KFSELDRSLpp.....................LIHCPVCD-------------------------na..................
FBpp0083320  KFSELDRSLpp.....................LIHCPVCD-------------------------na..................
FBpp0070259  H--------.......................---------------------------------v...................
FBpp0303076  KFSELDRSLpp.....................LIHCPVCD-------------------------na..................
FBpp0077259  KKHLFPS--.......................---CTQCEGCS----------------------dfktyeenrmm.........
FBpp0077260  KKHLFPS--.......................---CTQCEGCS----------------------dfktyeenrmm.........
FBpp0071476  LSVGH----.......................ILKCPYCPVE-----------------------qnaeeavriy..........
FBpp0305661  VVSKDTMSAsspnscssssfdgsehqnrlsavFIECPVCKQE-----------------------tp..................
FBpp0071238  VVSKDTMSAsspnscssssfdgsehqnrlsavFIECPVCKQE-----------------------tp..................
FBpp0305660  VVSKDTMSAsspnscssssfdgsehqnrlsavFIECPVCKQE-----------------------tp..................
FBpp0305662  VVSKDTMSAsspnscssssfdgsehqnrlsavFIECPVCKQE-----------------------tp..................
FBpp0290897  L-----TI-.......................---CPVCRVFM----------------------tn..................
FBpp0080804  EP-------.......................IKSCPRCTDK-----------------------vl..................
FBpp0110415  ELLKN----.......................---------------------------------cn..................
FBpp0070464  SAGRTPSDAp......................IFECSTCRRSV----------------------rgrq................
FBpp0083736  -RIRSER--.......................---CPVCRDFYTP--------------------r...................
FBpp0110416  ELLKN----.......................---------------------------------cn..................
FBpp0305698  ELLKN----.......................---------------------------------cn..................
FBpp0110417  ELLKN----.......................---------------------------------cn..................
FBpp0305699  ELLKN----.......................---------------------------------cn..................
FBpp0077974  YCRSRLG--.......................---------------------------------erqfmphpdfgytlpcpagc
FBpp0077975  YCRSRLG--.......................---------------------------------erqfmphpdfgytlpcpagc
FBpp0303687  EP-------.......................IKSCPRCTDK-----------------------vl..................
FBpp0084110  --------G.......................TVTCPVT--------------------------ntkfsnpkvek.........
FBpp0301716  ----NDQ--.......................---CPMCMN------------------------ssl.................
FBpp0306230  ----NDQ--.......................---CPMCMN------------------------ssl.................


                                                                   
                                                                   
d1v87a_        ....................................................
FBpp0070117  ....................................................
FBpp0076341  ....................................................
FBpp0076342  ....................................................
FBpp0300874  ....................................................
FBpp0072446  ....................................................
FBpp0087189  ....................................................
FBpp0291421  ....................................................
FBpp0072976  hyrvtgfplavklgtitadgksdvfsypedemvldphlerhlshfginm...
FBpp0298309  hyrvtgfplavklgtitadgksdvfsypedemvldphlerhlshfginm...
FBpp0079303  ....................................................
FBpp0111655  ....................................................
FBpp0305611  ....................................................
FBpp0083160  licghvgcgryqgghaaahfratnhtfamqlgtssvwdyagdnfvhrlfqnk
FBpp0304474  licghvgcgryqgghaaahfratnhtfamqlgtssvwdyagdnfvhrlfqnk
FBpp0298372  tadlsvwcyacsayvdhprlyaylnplhed......................
FBpp0073825  tadlsvwcyacsayvdhprlyaylnplhed......................
FBpp0073827  tadlsvwcyacsayvdhprlyaylnplhed......................
FBpp0073826  tadlsvwcyacsayvdhprlyaylnplhed......................
FBpp0303431  tadlsvwcyacsayvdhprlyaylnplhed......................
FBpp0080009  kqridawrkeqrg.......................................
FBpp0290465  kqridawrkeqrg.......................................
FBpp0078927  mdkvksnealkqeieswiq.................................
FBpp0110216  ttstedvrdftr........................................
FBpp0083180  ttstedvrdftr........................................
FBpp0110215  ttstedvrdftr........................................
FBpp0083179  ttstedvrdftr........................................
FBpp0110218  ttstedvrdftr........................................
FBpp0110217  ttstedvrdftr........................................
FBpp0083178  ttstedvrdftr........................................
FBpp0110219  ttstedvrdftr........................................
FBpp0079617  qdqlipnfsmkevvdsfiaenews............................
FBpp0080686  gvrlpmr.............................................
FBpp0074414  flnlhtlrfyclpdnyeiidsslddikyvlnptf..................
FBpp0081445  ....................................................
FBpp0304107  tti.................................................
FBpp0073495  tti.................................................
FBpp0271753  tti.................................................
FBpp0083052  ....................................................
FBpp0288650  ....................................................
FBpp0305755  mlep................................................
FBpp0075275  mlep................................................
FBpp0080794  rmptnngpgmvdawft....................................
FBpp0099683  rmptnngpgmvdawft....................................
FBpp0076010  ....................................................
FBpp0076011  ....................................................
FBpp0081594  ....................................................
FBpp0081595  ....................................................
FBpp0088499  ....................................................
FBpp0088500  ....................................................
FBpp0089023  ....................................................
FBpp0297199  ....................................................
FBpp0305073  ....................................................
FBpp0305074  ....................................................
FBpp0072361  ....................................................
FBpp0081596  ....................................................
FBpp0085201  ....................................................
FBpp0303146  ....................................................
FBpp0289415  ....................................................
FBpp0297426  ....................................................
FBpp0289416  ....................................................
FBpp0081908  ....................................................
FBpp0081909  ....................................................
FBpp0300326  ....................................................
FBpp0303202  ....................................................
FBpp0289929  ....................................................
FBpp0081217  ....................................................
FBpp0081218  ....................................................
FBpp0081219  ....................................................
FBpp0112110  ....................................................
FBpp0075265  dnapygc.............................................
FBpp0305750  dnapygc.............................................
FBpp0087040  kspskqig............................................
FBpp0087041  kspskqig............................................
FBpp0099693  kspskqig............................................
FBpp0293614  kspskqig............................................
FBpp0300837  kspskqig............................................
FBpp0293613  kspskqig............................................
FBpp0111987  kspskqig............................................
FBpp0088192  ....................................................
FBpp0305836  ....................................................
FBpp0080156  tfsq................................................
FBpp0071136  ....................................................
FBpp0071688  ....................................................
FBpp0072626  ....................................................
FBpp0305589  ....................................................
FBpp0085928  ....................................................
FBpp0305076  ....................................................
FBpp0073970  ....................................................
FBpp0073971  ....................................................
FBpp0073972  ....................................................
FBpp0073973  ....................................................
FBpp0073974  ....................................................
FBpp0073969  ....................................................
FBpp0112351  ....................................................
FBpp0070738  hyqtphsdshalamntrsfdiwcyecdmkic.....................
FBpp0070739  hyqtphsdshalamntrsfdiwcyecdmkic.....................
FBpp0070740  hyqtphsdshalamntrsfdiwcyecdmkic.....................
FBpp0070741  hyqtphsdshalamntrsfdiwcyecdmkic.....................
FBpp0084614  ....................................................
FBpp0289967  mqciltrsdiel........................................
FBpp0289968  mqciltrsdiel........................................
FBpp0289969  mqciltrsdiel........................................
FBpp0289970  mqciltrsdiel........................................
FBpp0289971  mqciltrsdiel........................................
FBpp0289972  mqciltrsdiel........................................
FBpp0293183  ....................................................
FBpp0078288  ....................................................
FBpp0078287  ....................................................
FBpp0070328  ....................................................
FBpp0302591  ....................................................
FBpp0080497  ....................................................
FBpp0079604  ....................................................
FBpp0293056  ....................................................
FBpp0079599  ....................................................
FBpp0079600  ....................................................
FBpp0079601  ....................................................
FBpp0079602  ....................................................
FBpp0079603  ....................................................
FBpp0293055  ....................................................
FBpp0304028  ....................................................
FBpp0304029  ....................................................
FBpp0304027  ....................................................
FBpp0075392  ....................................................
FBpp0076222  ....................................................
FBpp0301283  ....................................................
FBpp0112083  ....................................................
FBpp0305236  ....................................................
FBpp0298003  ....................................................
FBpp0111417  ....................................................
FBpp0090973  ....................................................
FBpp0073824  vgfaggrhepghrmcevfvedqpplrw.........................
FBpp0303430  vgfaggrhepghrmcevfvedqpplrw.........................
FBpp0071688  vltlvtrpvmrdkyqqfafkdyvks...........................
FBpp0075105  ....................................................
FBpp0305787  ....................................................
FBpp0089378  ....................................................
FBpp0072158  ....................................................
FBpp0088499  dvtvanlvtdarvrvkyqqlitns............................
FBpp0088500  dvtvanlvtdarvrvkyqqlitns............................
FBpp0089023  dvtvanlvtdarvrvkyqqlitns............................
FBpp0297199  dvtvanlvtdarvrvkyqqlitns............................
FBpp0305073  dvtvanlvtdarvrvkyqqlitns............................
FBpp0305074  dvtvanlvtdarvrvkyqqlitns............................
FBpp0305075  ....................................................
FBpp0085929  ....................................................
FBpp0089379  ....................................................
FBpp0084797  ....................................................
FBpp0084798  ....................................................
FBpp0305390  ....................................................
FBpp0291240  ....................................................
FBpp0291241  ....................................................
FBpp0080385  ....................................................
FBpp0081303  dtgtsil.............................................
FBpp0086906  l...................................................
FBpp0289616  l...................................................
FBpp0303463  l...................................................
FBpp0297447  ....................................................
FBpp0074730  ....................................................
FBpp0099776  dtgtsil.............................................
FBpp0084991  rkailhlalkariekflmensehf............................
FBpp0288555  ....................................................
FBpp0304246  ....................................................
FBpp0076498  ....................................................
FBpp0293529  ....................................................
FBpp0288698  ....................................................
FBpp0072779  ....................................................
FBpp0289997  ....................................................
FBpp0080229  ....................................................
FBpp0290952  ....................................................
FBpp0072708  ....................................................
FBpp0072709  ....................................................
FBpp0086838  ....................................................
FBpp0291638  ....................................................
FBpp0074245  ....................................................
FBpp0074242  ....................................................
FBpp0074243  ....................................................
FBpp0074244  ....................................................
FBpp0087349  tnllkkhhryrlnr......................................
FBpp0291679  tnllkkhhryrlnr......................................
FBpp0076010  vveryqqlitnt........................................
FBpp0076011  vveryqqlitnt........................................
FBpp0085553  ....................................................
FBpp0078590  ....................................................
FBpp0112237  plqcl...............................................
FBpp0070521  plqcl...............................................
FBpp0075071  ....................................................
FBpp0298337  ....................................................
FBpp0070506  ....................................................
FBpp0078038  ....................................................
FBpp0078039  ....................................................
FBpp0293874  ....................................................
FBpp0302614  ....................................................
FBpp0077675  ....................................................
FBpp0305188  ....................................................
FBpp0077974  cqtewtr.............................................
FBpp0077975  cqtewtr.............................................
FBpp0086007  ....................................................
FBpp0070905  ....................................................
FBpp0071135  ....................................................
FBpp0078401  ....................................................
FBpp0288691  ....................................................
FBpp0070876  ....................................................
FBpp0083160  ....................................................
FBpp0304474  ....................................................
FBpp0085754  ....................................................
FBpp0304302  ....................................................
FBpp0303663  ....................................................
FBpp0303660  ....................................................
FBpp0303662  ....................................................
FBpp0303658  ....................................................
FBpp0074856  ....................................................
FBpp0073752  ....................................................
FBpp0077310  ....................................................
FBpp0077311  ....................................................
FBpp0077312  ....................................................
FBpp0078830  hpmsvyyaya..........................................
FBpp0084491  ....................................................
FBpp0073027  ....................................................
FBpp0080198  pvvcvlipadvely......................................
FBpp0073674  ....................................................
FBpp0297897  ....................................................
FBpp0085902  kpeeliei............................................
FBpp0076706  ....................................................
FBpp0304173  ....................................................
FBpp0071688  ....................................................
FBpp0071337  ....................................................
FBpp0291863  ....................................................
FBpp0291862  ....................................................
FBpp0305701  ....................................................
FBpp0086323  lnfhrnandeyhcp......................................
FBpp0076010  ....................................................
FBpp0076011  ....................................................
FBpp0088499  ....................................................
FBpp0088500  ....................................................
FBpp0089023  ....................................................
FBpp0297199  ....................................................
FBpp0305073  ....................................................
FBpp0305074  ....................................................
FBpp0297896  ....................................................
FBpp0293251  ....................................................
FBpp0082202  ....................................................
FBpp0081830  ....................................................
FBpp0293250  ....................................................
FBpp0083244  ....................................................
FBpp0076822  ....................................................
FBpp0087350  ....................................................
FBpp0071001  ....................................................
FBpp0087349  ....................................................
FBpp0291679  ....................................................
FBpp0083719  ....................................................
FBpp0085756  i...................................................
FBpp0085757  i...................................................
FBpp0073753  ....................................................
FBpp0113114  i...................................................
FBpp0079210  ....................................................
FBpp0303663  ....................................................
FBpp0303660  ....................................................
FBpp0303662  ....................................................
FBpp0303658  ....................................................
FBpp0086911  ....................................................
FBpp0078901  ....................................................
FBpp0303613  ....................................................
FBpp0081480  ....................................................
FBpp0081479  ....................................................
FBpp0289643  ....................................................
FBpp0075181  ....................................................
FBpp0303600  ....................................................
FBpp0305463  ....................................................
FBpp0081482  ....................................................
FBpp0081481  ....................................................
FBpp0082488  ....................................................
FBpp0297356  ....................................................
FBpp0073049  ....................................................
FBpp0076498  ....................................................
FBpp0293529  ....................................................
FBpp0072874  ....................................................
FBpp0086712  ....................................................
FBpp0076329  ....................................................
FBpp0088148  ....................................................
FBpp0088149  ....................................................
FBpp0083630  ....................................................
FBpp0111519  ....................................................
FBpp0291525  ....................................................
FBpp0072214  ....................................................
FBpp0302533  rdniqvf.............................................
FBpp0302535  rdniqvf.............................................
FBpp0080921  ....................................................
FBpp0302534  rdniqvf.............................................
FBpp0302531  rdniqvf.............................................
FBpp0302532  rdniqvf.............................................
FBpp0070904  ....................................................
FBpp0088160  ....................................................
FBpp0302676  ....................................................
FBpp0302677  ....................................................
FBpp0302678  ....................................................
FBpp0078948  ....................................................
FBpp0305541  ....................................................
FBpp0073787  ....................................................
FBpp0303660  lfyl................................................
FBpp0303662  lfyl................................................
FBpp0303658  lfyl................................................
FBpp0084637  ....................................................
FBpp0303663  lfyl................................................
FBpp0079685  ....................................................
FBpp0293057  ....................................................
FBpp0074742  ....................................................
FBpp0074330  rklkekdiipl.........................................
FBpp0077974  ....................................................
FBpp0077975  ....................................................
FBpp0074330  ....................................................
FBpp0075091  ....................................................
FBpp0075092  ....................................................
FBpp0304749  ....................................................
FBpp0086919  ....................................................
FBpp0080265  ....................................................
FBpp0080266  ....................................................
FBpp0304750  ....................................................
FBpp0305755  ....................................................
FBpp0075275  ....................................................
FBpp0084259  ....................................................
FBpp0293345  ....................................................
FBpp0077338  ....................................................
FBpp0076695  ....................................................
FBpp0084258  ....................................................
FBpp0074479  ....................................................
FBpp0070458  ....................................................
FBpp0293251  ....................................................
FBpp0086219  ....................................................
FBpp0081830  ....................................................
FBpp0293250  ....................................................
FBpp0290962  ....................................................
FBpp0303730  ....................................................
FBpp0303731  ....................................................
FBpp0070045  ....................................................
FBpp0289844  ....................................................
FBpp0083320  ....................................................
FBpp0070259  ....................................................
FBpp0303076  ....................................................
FBpp0077259  ....................................................
FBpp0077260  ....................................................
FBpp0071476  ....................................................
FBpp0305661  ....................................................
FBpp0071238  ....................................................
FBpp0305660  ....................................................
FBpp0305662  ....................................................
FBpp0290897  ....................................................
FBpp0080804  ....................................................
FBpp0110415  ....................................................
FBpp0070464  ....................................................
FBpp0083736  ....................................................
FBpp0110416  ....................................................
FBpp0305698  ....................................................
FBpp0110417  ....................................................
FBpp0305699  ....................................................
FBpp0077974  ehsfieeihhfklltreeydryqrfateey......................
FBpp0077975  ehsfieeihhfklltreeydryqrfateey......................
FBpp0303687  ....................................................
FBpp0084110  ....................................................
FBpp0301716  ....................................................
FBpp0306230  ....................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0050087 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Halothece sp. PCC 7418
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Candidatus Phytoplasma mali
NoYes   Conexibacter woesei DSM 14684
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Anaerolinea thermophila UNI-1
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Candidatus Cardinium hertigii
NoYes   Fibrella aestuarina
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Spirosoma linguale DSM 74
NoYes   Cellulophaga algicola DSM 14237
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Cupriavidus metallidurans CH34
NoYes   Variovorax paradoxus S110
NoYes   Caulobacter sp. K31
NoYes   Caulobacter segnis ATCC 21756
NoYes   Sphingobium sp. SYK-6
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Agrobacterium sp. H13-3
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanothermococcus okinawensis IH1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Prochlorococcus marinus str. MIT 9215
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Frankia sp. EuI1c
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium smegmatis JS623
NoYes   Ruminococcus champanellensis 18P13
NoYes   Thermoanaerobacter sp. X513
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia lata
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Mesorhizobium australicum WSM2073
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Coxiella burnetii CbuG_Q212
NoYes   Legionella pneumophila str. Paris
NoYes   Legionella pneumophila str. Lens
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila ATCC 43290
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1
NoYes   Methanolobus psychrophilus R15
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Guillardia theta
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Core Eukaryotic Genes 458 (CEGMA)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot Spring microbial communities from Yellowstone Obsidian Hot Spring, Sample 10594 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]