SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Integrin domains alignments in Gorilla gorilla 76_3.1

These alignments are sequences aligned to the 0047690 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1jv2a1               ..............................................................................
ENSGGOP00000004877  laaveirgvsspdhiflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhlqwpykynnntllyilhydi
ENSGGOP00000014812  aqveirgvshppqivlpihnwepeeephkeeevgplvehiyelhnigpstisdtilevgwpfsardefllyifhiqtl
ENSGGOP00000012548  aeaqvelrgnsfpaslvvaaeegereqnsldswgpkvehtyelhnngpgtvnglhlsihlpgqsqpsdllyildiqpq
ENSGGOP00000019684  aeaqvelrgnsfpaslvvaaeegereqnsldswgpkvehtyelhnngpgtvnglhlsihlpgqsqpsdllyildiqpq
ENSGGOP00000021655  elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkv
ENSGGOP00000007656  elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkv
ENSGGOP00000000711  qaqvtlngvskpeavlfpvsdwhprdqpqkeedlgpavhhvyelinqgpssisqgvlelscpqalegqqllyvtritg
ENSGGOP00000022058  qaqvtlngvskpeavlfpvsdwhprdqpqkeedlgpavhhvyelinqgpssisqgvlelscpqalegqqllyvtritg
ENSGGOP00000003107  ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqslrtlgsaflnimwpheiangkwllypmr
ENSGGOP00000014812  ..............................................................................
ENSGGOP00000013236  tlqtslsmvnhrlqsffggtvmgesgmktvedvgsplkyefqvgpmgeglvglgtlvlglewpyevsngkwllyptei
ENSGGOP00000022058  ..............................................................................
ENSGGOP00000000711  ..............................................................................
ENSGGOP00000001271  ydaeihltrstninfyeissdgnvpsivhsfedvgpkfifslkvttgsvpvsmatviihipqytkeknplmyltgvqt
ENSGGOP00000025315  ydaeihltrstninfyeissdgnvpsivhsfedvgpkfifslkvttgsvpvsmatviihipqytkeknplmyltgvqt
ENSGGOP00000014812  dnlcvpdlklsarpdkhqviigdenhlmliinarnegegayeaelfvmipeeadyvgiernnkgfrplsceykmenvt
ENSGGOP00000012548  ..............................................................................
ENSGGOP00000019684  ..............................................................................
ENSGGOP00000022673  ..............................................................................
ENSGGOP00000003107  ..............................................................................
ENSGGOP00000007587  kirskvelevrdlpeelslsfnatclnnevipglkscm........................................
ENSGGOP00000024170  kirskvelevrdlpeelslsfnatclnnevipglkscm........................................
ENSGGOP00000027645  ..............................................................................
ENSGGOP00000017850  ..............................................................................
ENSGGOP00000021655  ..............................................................................
ENSGGOP00000007656  ..............................................................................
ENSGGOP00000000711  dnicvpdlqlevfgeqnhvylgdknalnltfhaqnvgeggayeaelrvtappeaeysglvrhpgnfsslscdyfavnq
ENSGGOP00000022058  dnicvpdlqlevfgeqnhvylgdknalnltfhaqnvgeggayeaelrvtappeaeysglvrhpgnfsslscdyfavnq
ENSGGOP00000012737  ..............................................................................
ENSGGOP00000012782  ..............................................................................
ENSGGOP00000011589  sirskvelsvwdqpedlnlfftatcqdgvsypgqrkceglkigdtas...............................
ENSGGOP00000023681  sirskvelsvwdqpedlnlfftatcqdgvsypgqrkceglkigdtas...............................
ENSGGOP00000012325  ..............................................................................
ENSGGOP00000012325  dhicqdnlgisfsfpglktllvgsnlelnaevmvwndgedsygttitfshptglsyryvaegqkqgqlrslh......
ENSGGOP00000022105  ..............................................................................
ENSGGOP00000005987  dglcegdlgvtlsfsglqtltvgsslelnvivtvwnagedsygtvvslyypaglshrrvsgaqkqphqsalrlacetv
ENSGGOP00000004003  ..............................................................................
ENSGGOP00000022673  ncsadlqvsakigflkphenktylavgsmktlmlnvslfnagddayettlhvklpvglyfikileleekqincevt..
ENSGGOP00000005987  ..............................................................................
ENSGGOP00000007324  fcvaelqlattvsqqelvvgltkeltlninltnsgedsymtsmalnyprnlqlkrm......................
ENSGGOP00000017451  fcvaelqlattvsqqelvvgltkeltlninltnsgedsymtsmalnyprnlqlkrm......................
ENSGGOP00000012737  dcaadlqlrgklllssmdektlylalgavknislnisisnlgddaydanvsfnvsrelffinmw..............
ENSGGOP00000019684  ddvcvpqlqltasvtgspllvgadnvlelqmdaanegegayeaelavhlpqga.........................
ENSGGOP00000012548  ddvcvpqlqltasvtgspllvgadnvlelqmdaanegegayeaelavhlpqga.........................
ENSGGOP00000022673  yevkltvhgfvnptsfvygsndenepetcmvekmnltfhvintgnsmapnvsveimvpnsfspqtdklfnildvqttt
ENSGGOP00000021655  dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgddaheakliatfpd
ENSGGOP00000007656  dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgddaheakliatfpd
ENSGGOP00000015038  ..............................................................................
ENSGGOP00000004877  ..............................................................................
ENSGGOP00000013236  ..............................................................................
ENSGGOP00000001271  dglcisd.......................................................................
ENSGGOP00000025315  dglcisd.......................................................................
ENSGGOP00000006652  vqlimdaynslsstvtlehsslppgvhisyesqcegpekregkaedrgqcnhvrinq.....................
ENSGGOP00000004877  dnvckpklevsvdsdqkkiyigddnpltlivklqadfigvvrnnealarlscafktenqtrqvv..............
ENSGGOP00000002159  dkkceanlrvsfsparsralrltafaslsvelslsnleedaywvqldlhfprglsfrkv...................
ENSGGOP00000022105  dnicqddlsitfsfmsldclvvggpre...................................................
ENSGGOP00000009194  lrsevelevlgdteglnlsftaicnngtlfqhqkkcshmk......................................
ENSGGOP00000003107  dkicqsnlqlvrarfctrvsdtefqplpmdv...............................................
ENSGGOP00000004003  dnicqddlsitfsfmsldclvvggpre...................................................
ENSGGOP00000027645  kcvsdlslhvattekdllivrsqndkfnvsltvkntkdsayntrtivhyspnlvfsgieaiqkds.............
ENSGGOP00000015038  dnecvtdlvlqvnmdirgsrkapfvvrggrrkvlvsttlenrkenayntsls..........................
ENSGGOP00000013236  dnkcesnlqm....................................................................
ENSGGOP00000017850  kcvsdlslhvattekdllivrsqndkfnvsltvkntkdsayntrtivhyspnlvfsgieaiqkds.............
ENSGGOP00000002159  ..............................................................................
ENSGGOP00000005989  pksavgtlsanssnviqliidaynslssevilengklsegvtisyksyckngvngtgengrkcsn.............
ENSGGOP00000012782  dehcvpdlvldarsdlptameycqrvlrkpaqdcsaytlsfdttvfiiestrrrvaveatlenrgenaystvlnisqs
ENSGGOP00000001271  adva..........................................................................
ENSGGOP00000025315  adva..........................................................................
ENSGGOP00000014106  ipksavgelsedssnvvhliknaynklssrvfldhnalpdtlkvty................................
ENSGGOP00000012737  evdtsitgimsptsfvygesvdaanfiqlddlechfqpinitlqvyntgpstlpgssvsisfpnrlssggaemfhvqe
ENSGGOP00000012782  shyevkpnsslerydgigppfscifriqnlglfpihgmmmkitipiatrsgnrllklrdfltdqvantscniwgnste
ENSGGOP00000017933  nlvlfnvtvtmkkcdvtggknyaiikpigfn...............................................
ENSGGOP00000012325  vamhryqvnnlgqrdlpvsinfwvpvelnqeavwmdvevshpqnp.................................
ENSGGOP00000015038  pgpefkttlrvqnlgcyvvsgliisallpavahggnyflslsqvitnnascivqnlteppgppvhpeelqhinr....
ENSGGOP00000017850  kyevglqfyssaseyhisiaanetvpevinstedigneinifylirksgsfpmpelklsisfpnmtsngypvlyptgl
ENSGGOP00000005987  aehryrvnnlsqrdlaisinfwvpvllngvavwdvvmeapsqslpcvserkppqhsdfltqisrs.............
ENSGGOP00000004003  avymvvtvsnlgqrslpislvflvpvrlnqtviwdrpqvtfsenlsstchtkerlpshsdflaelrka..........
ENSGGOP00000027645  kyevglqfyssaseyhisiaanetvpevinstedigneinifylirksgsfpmpelkls...................
ENSGGOP00000007324  ..............................................................................
ENSGGOP00000017451  ..............................................................................
ENSGGOP00000009194  sqveilknkplsvgrqknssdivqiapqslilklrpggaqtlqv..................................


                                                                                     10        20   
                                                                                      |         |   
d1jv2a1               ......................................................PVITV.NAGLEVYPSILNQDNKT.
ENSGGOP00000004877  .............dgpmnctsdmeinplrikisslqttekndtvagqgerdhli-----.-------------T---.
ENSGGOP00000014812  ..........gplqcqtnpninpqdikpaaspedtpelsaflqnstiphlvrkr-----.-----------D-----.
ENSGGOP00000012548  ..................gglqcfpqppvnplkvdwglptpspspihpahhkrd-----.-----------------.
ENSGGOP00000019684  ..................gglqcfpqppvnplkvdwglptpspspihpahhkrd-----.-----------------.
ENSGGOP00000021655  eskglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt-----.-----------------.
ENSGGOP00000007656  eskglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt-----.-----------------.
ENSGGOP00000000711  .............lncttnhpinpkgleldpegslhhqqkreapsrssassgpq-----.-----------------.
ENSGGOP00000022058  ................lncttnhpinpkgleldpegslhhqqkreapsrssass-----.-----------------.
ENSGGOP00000003107  ..........veleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqep-----.-----------------.
ENSGGOP00000014812  ......................................................PVVTV.DAQLLLHPMIINLENKT.
ENSGGOP00000013236  ....tvhgngswpcqppgdlinplnltlsdpgdrpsspqrrrrqldpgggqgpp-----.-----------------.
ENSGGOP00000022058  ......................................................PIVSA.SASLTIFPAMFNPEERS.
ENSGGOP00000000711  ......................................................PIVSA.SASLTIFPAMFNPEERS.
ENSGGOP00000001271  .................dqagdiscnadinplkigqtsssvsfkrenfrhtkel-----.-----------------.
ENSGGOP00000025315  .................dqagdiscnadinplkigqtsssvsfkrenfrhtkel-----.-----------------.
ENSGGOP00000014812  ............................................rmvvcdlgnp-----.-----------------.
ENSGGOP00000012548  ......................................................PVVKA.SVQL-LVQDSLNPAVKS.
ENSGGOP00000019684  ......................................................PVVKA.SVQL-LVQDSLNPAVKS.
ENSGGOP00000022673  ......................................................PVVIV.DASL-SHPESVNRTKFD.
ENSGGOP00000003107  ......................................................PILHV.SHEVSIAPRSIDLEQPN.
ENSGGOP00000007587  ......................................................-----.-----------------.
ENSGGOP00000024170  ......................................................-----.-----------------.
ENSGGOP00000027645  ......................................................-VAVV.KVTMNFEPNKVNIQKKN.
ENSGGOP00000017850  ......................................................-VAVV.KVTMNFEPNKVNIQKKN.
ENSGGOP00000021655  ......................................................PVINI.QKTITVTPNRIDLRQKTa
ENSGGOP00000007656  ......................................................PVINI.QKTITVTPNRIDLRQKTa
ENSGGOP00000000711  .....................................srllvcdlgnpmkagas-----.-----------------.
ENSGGOP00000022058  .....................................srllvcdlgnpmkagas-----.-----------------.
ENSGGOP00000012737  ......................................................PVITV.DVSI-FLPGSINITAPQ.
ENSGGOP00000012782  ......................................................PVVQI.NASLHFEPSKINIFHRD.
ENSGGOP00000011589  ......................................................-----.-----------------.
ENSGGOP00000023681  ......................................................-----.-----------------.
ENSGGOP00000012325  ......................................................PVLWV.GVSMQFIPAEIPRSAFE.
ENSGGOP00000012325  ......................................................-----.-----------------.
ENSGGOP00000022105  ......................................................PVLRV.KAIMEFNPREVARNVFE.
ENSGGOP00000005987  ...................................ptedeglrssrcsvnhpif-----.-----------------.
ENSGGOP00000004003  ......................................................PVLRV.KAIMEFNPREVARNVFE.
ENSGGOP00000022673  ......................................................-----.-----------------.
ENSGGOP00000005987  ......................................................PVLKV.GVAMRFSPVEVAKAVYR.
ENSGGOP00000007324  ......................................................-----.-----------------.
ENSGGOP00000017451  ......................................................-----.-----------------.
ENSGGOP00000012737  ......................................................-----.--------------Q--.
ENSGGOP00000019684  ......................................................-----.-----------------.
ENSGGOP00000012548  ......................................................-----.-----------------.
ENSGGOP00000022673  ...........................................gechfenyqrv-----.-----------------.
ENSGGOP00000021655  ...........................tltysayrelrafpekqlscvanqngs-----.--------------Q--.
ENSGGOP00000007656  ...........................tltysayrelrafpekqlscvanqngs-----.--------------Q--.
ENSGGOP00000015038  ......................................................PIVHL.TPSLEVTPQAISVVQRD.
ENSGGOP00000004877  ......................................................PVITV.NAGLEVYPSILNQDNKT.
ENSGGOP00000013236  ......................................................PVINIvHKTLVARPAVLDPALCT.
ENSGGOP00000001271  ......................................................-----.-----------------.
ENSGGOP00000025315  ......................................................-----.-----------------.
ENSGGOP00000006652  ......................................................-----.-----------------.
ENSGGOP00000004877  ......................................................-----.-----------------.
ENSGGOP00000002159  ......................................................-----.----------------E.
ENSGGOP00000022105  ......................................................-----.-----------------.
ENSGGOP00000009194  ......................................................-----.-----------------.
ENSGGOP00000003107  ......................................................-----.-----------------.
ENSGGOP00000004003  ......................................................-----.-----------------.
ENSGGOP00000027645  ......................................................-----.-----------------.
ENSGGOP00000015038  ......................................................-----.-----------------.
ENSGGOP00000013236  ......................................................-----.-----------------.
ENSGGOP00000017850  ......................................................-----.-----------------.
ENSGGOP00000002159  ......................................................PVVDV.VTLMSFSPAEIPVHEVE.
ENSGGOP00000005989  ......................................................-----.-----------------.
ENSGGOP00000012782  .............................................anlqfasli-----.-----------------.
ENSGGOP00000001271  ......................................................-----.-IEASFTPEKITLVNKN.
ENSGGOP00000025315  ......................................................-----.-IEASFTPEKITLVNKN.
ENSGGOP00000014106  ......................................................-----.-----------------.
ENSGGOP00000012737  ....................................mvvgqekgncsfqknptp-----.-----------------.
ENSGGOP00000012782  .........................yrptpmeedlrrapqlnhsnsdvvsincn-----.---I-------------.
ENSGGOP00000017933  ......................................................-----.-----------------.
ENSGGOP00000012325  ......................................................-----.-----------------.
ENSGGOP00000015038  ......................................................-----.-----------------.
ENSGGOP00000017850  ..........sssdhdtcnkefyqsnmerlsvlslvcreskvlldeyintdegl-----.-------------SLFN.
ENSGGOP00000005987  ......................................................-----.-----------------.
ENSGGOP00000004003  ......................................................-----.-----------------.
ENSGGOP00000027645  ......................................................-----.-----------------.
ENSGGOP00000007324  ......................................................PVVRL.KVSMAFTPSALPIGFN-.
ENSGGOP00000017451  ......................................................PVVRL.KVSMAFTPSALPIGFN-.
ENSGGOP00000009194  ......................................................-----.-----------------.


                            30        40            50            60         70            80       
                             |         |             |             |          |             |       
d1jv2a1               CSLPGTALKVSCFNVRFCLKADGKG....VLPRKL....NFQVELLLDKLKQK.GAIRRALF....LYSRS.PSHSKN
ENSGGOP00000004877  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000014812  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000012548  -------------------------....------....--------------.---RRQIFl...PEPEQ.PSRLQD
ENSGGOP00000019684  -------------------------....------....--------------.---RRQIFl...PEPEQ.PSRLQD
ENSGGOP00000021655  -------------------------....------....--------------.--------....-----.--L---
ENSGGOP00000007656  -------------------------....------....--------------.--------....-----.--L---
ENSGGOP00000000711  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000022058  -------------------------....------....--------------.--------....-----.-----G
ENSGGOP00000003107  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000014812  CQVPDSMTSAACFSLRVCASVTGQS....-IANTI....VLMAEVQLDSLKQK.GAIKRTLF....LDNHQ.AHRIFP
ENSGGOP00000013236  -------------------------....------....--------------.----P---....-----.------
ENSGGOP00000022058  CSLEGN--PVACINLSFCLNASGKH....-VADSI....GFTVELQLDWQKQK.GGVRRALF....LASRQ.ATLTQT
ENSGGOP00000000711  CSLEGN--PVACINLSFCLNASGKH....-VADSI....GFTVELQLDWQKQK.GGVRRALF....LASRQ.ATLTQT
ENSGGOP00000001271  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000025315  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000014812  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000012548  CVLPQTKTPVSCFNIQMCVGATGHN....-IPQKL....SLNAELQLDRQKP-.RQGRRVLL....LGSQQ.AGTTLN
ENSGGOP00000019684  CVLPQTKTPVSCFNIQMCVGATGHN....-IPQKL....SLNAELQLDRQKP-.RQGRRVLL....LGSQQ.AGTTLN
ENSGGOP00000022673  CVENGW--PSVCMDLTLCFSYKGKE....-VPGYI....VLFYNMSLDVNRKA.ESPPRFYF....SSNGT.SDVITG
ENSGGOP00000003107  CAGGHS----VCVDLRVCFSYIAVPs...SYSPTV....ALDYVLDADTDRRLrGQVPRVTFlsrnLEEPK.HQASGT
ENSGGOP00000007587  -------------------G-----....------....--------------.--------....-----.------
ENSGGOP00000024170  -------------------G-----....------....--------------.--------....-----.------
ENSGGOP00000027645  CHMEGK--ETVCINATVCFDVKLKSke..DTIYEA....DLQYRVTLDSLRQ-.--ISRSFF....SGTQE.RKVQRN
ENSGGOP00000017850  CHMEGK--ETVCINATVCFDVKLKSke..DTIYEA....DLQYRVTLDSLRQ-.--ISRSFF....SGTQE.RKVQRN
ENSGGOP00000021655  CGAPSG----ICLQVKSCFEYTANPa...GYNPSI....SIVGTLEAEKERRKsGLSSRVQF....RNQGSePKYTQE
ENSGGOP00000007656  CGAPSG----ICLQVKSCFEYTANPa...GYNPSI....SIVGTLEAEKERRKsGLSSRVQF....RNQGSePKYTQE
ENSGGOP00000000711  -------------------------....-L----....--------------.--------....-----.------
ENSGGOP00000022058  -------------------------....-L----....--------------.--------....-----.------
ENSGGOP00000012737  CHDGQQ--PVNCLNVTTCFSFHGKH....-VPGEI....GLNYVLMADVAKKEkGQMPRVYFvl..LGETM.GQITEK
ENSGGOP00000012782  CKRSGR--DATCLAAFLCFTPVFLAph..FQTTTV....GIRYNATMDERRY-.--TPRAHL....DEGGD.RFTNRA
ENSGGOP00000011589  --------F----------------....------....--------------.--------....-----.------
ENSGGOP00000023681  --------F----------------....------....--------------.--------....-----.------
ENSGGOP00000012325  CREQVV-SEQTLGQSNICLYIDKRSk...NLLGSR....DLQSSVTLDLALDPgRLSPRATF....QETKN.RSLSRV
ENSGGOP00000012325  -------------------------....------....--------------.-------L....-----.------
ENSGGOP00000022105  CNDQVV-KGKEAGEVRVCLHVQKSTr...DRLREGqiqsVVTYDLALDSGRP-.--HSRAVF....NETKN.STRRQT
ENSGGOP00000005987  -------------------------....------....--------------.--------....H----.------
ENSGGOP00000004003  CNDQVV-KGKEAGEVRVCLHVQKSTr...DRLREGqiqsVVTYDLALDSGRP-.--HSRAVF....NETKN.STRRQT
ENSGGOP00000022673  ----D--------------------....------....--------------.--------....-----.------
ENSGGOP00000005987  CWEEKP-SALEAGDVTICLTIQKSSl...DQLGDIqs..SVRFDLALDPGRL-.--TSRAIF....NETKN.PTLTRR
ENSGGOP00000007324  -------------------------....------....-------------Q.--------....-----.------
ENSGGOP00000017451  -------------------------....------....-------------Q.--------....-----.------
ENSGGOP00000012737  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000019684  -------------------------....------....--------------.--------....-----.H-----
ENSGGOP00000012548  -------------------------....------....--------------.--------....-----.H-----
ENSGGOP00000022673  -----------------C-------....------....--------------.--------....-----.------
ENSGGOP00000021655  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000007656  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000015038  CRRRGQ--EAVCLTAALCFRVTSRT....PGRWDH....QFYMRFTASLDEW-.TAGARAAF....DGSGQ.RLSPRR
ENSGGOP00000004877  CSLPGTALKVSCFNVRFCLKADGKG....VLPRKL....NFQVELLLDKLKQK.GAIRRALF....LYSRS.PSHSKN
ENSGGOP00000013236  --------ATSCVQVELCFAYNQSAgnp.NYRRNI....TLAYTLEADRDRR-.--PPRLRF....AGSES.AVFHGF
ENSGGOP00000001271  -------------------------....------....-----LVLDVQQIP.AAQEQPFI....VSNQN.KRLTFS
ENSGGOP00000025315  -------------------------....------....-----LVLDVQQIP.AAQEQPFI....VSNQN.KRLTFS
ENSGGOP00000006652  -----TVTFWVSLQ-----------....------....--------------.--------....-----.------
ENSGGOP00000004877  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000002159  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000022105  ------------FNVTVTVRNDGED....SYRTQV....TFFFPLGLSYRKV-.--------....-----.------
ENSGGOP00000009194  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000003107  -------------------------....------....--D-----------.--------....-----.------
ENSGGOP00000004003  ------------FNVTVTVRNDGED....SYRTQV....TFFFPLGLSYRKV-.--------....-----.------
ENSGGOP00000027645  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000015038  -------------------------....------....-L------------.--------....-----.------
ENSGGOP00000013236  -------------------------....------....--------------.----RAAF....VSEQQ.QKLSRL
ENSGGOP00000017850  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000002159  CSYSTSNKMKEGVNITICFQIKSLIp...QFQGRLva..NLTYTLQLDGHRT-.--RRRGLF....PGGR-.HELRRN
ENSGGOP00000005989  --------------------I----....------....--------------.--------....-----.------
ENSGGOP00000012782  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000001271  ----------AQIILKLCFSAKFRPt...KQNNQV....AIVYNITLDADGFSsRVTSRGLF....KENNE.RCLQKN
ENSGGOP00000025315  ----------AQIILKLCFSAKFRPt...KQNNQV....AIVYNITLDADGFSsRVTSRGLF....KENNE.RCLQKN
ENSGGOP00000014106  -------------------------....------....--------------.--------....----D.SFCSNG
ENSGGOP00000012737  -----------C-------------....------....--------------.--------....-----.------
ENSGGOP00000012782  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000017933  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000012325  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000015038  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000017850  CFMSHNIEQVFLNVVVSCL-ATLKS....-YFSSL....NLTI----------.--------....-----.------
ENSGGOP00000005987  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000004003  --------P----------------....------....--------------.--------....-----.------
ENSGGOP00000027645  -------------------------....------....--------------.--------....-----.------
ENSGGOP00000007324  ----------GVVNVRLCFEISSVTtaseSGLRGA....LLNFTLDVDVGKQ-.----RRRL....QCSDV.RSCLGC
ENSGGOP00000017451  ----------GVVNVRLCFEISSVTtaseSGLRGA....LLNFTLDVDVGKQ-.----RRRL....QCSDV.RSCLGC
ENSGGOP00000009194  -------------------------....------....--------------.--------....-----.------


                        90       100        110       120            130             140         150
                         |         |          |         |              |               |           |
d1jv2a1               MTISRGGLMQCEELIAYLRD.ESEFRDKLTPITIFMEYRLDY.....RTAAD......TTGLQPILNQF..TPANISR
ENSGGOP00000004877  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000014812  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000012548  PVLVSCDSAPCTVVQCDLQ-.---------------------.....-----......-----------..-------
ENSGGOP00000019684  PVLVSCDSAPCTVVQCDLQ-.---------------------.....-----......-----------..-------
ENSGGOP00000021655  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000007656  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000000711  --I-----------------.---------------------.....-----......-----------..-------
ENSGGOP00000022058  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000003107  --------------------.---------------------.....-----......G----------..-------
ENSGGOP00000014812  LVIKRQKSHQCQNFIVYLRD.ETEFRDKLSPINISLNYSLDE.....STFKE......GLGVKPVLNYY..RENIVSE
ENSGGOP00000013236  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000022058  LLIQNGAREDCREMKIYLRN.ESEFRDKLSPIHIALNFSLDP.....QAPVD......SHGLRPALHYQ..SKSRIED
ENSGGOP00000000711  LLIQNGAREDCREMKIYLRN.ESEFRDKLSPIHIALNFSLDP.....QAPVD......SHGLRPALHYQ..SKSRIED
ENSGGOP00000001271  ----NCRTASCSNVTCWLKD.---------------------.....-----......-----------..-------
ENSGGOP00000025315  ----NCRTASCSNVTCWLKD.---------------------.....-----......-----------..-------
ENSGGOP00000014812  --------------------.----------M----------.....-----......-----------..-------
ENSGGOP00000012548  LDLGGKHSPICHTTMAFLRD.EADFRDKLSPIVLSLNVSLPP.....TEAG-......---LAPAVVLH..GDTHVQE
ENSGGOP00000019684  LDLGGKHSPICHTTMAFLRD.EADFRDKLSPIVLSLNVSLPP.....TEAG-......---LAPAVVLH..GDTHVQE
ENSGGOP00000022673  SIQVSSRVANCRTHQAFLRK.D--VRDILTPIQIEAAYHLGPhviskRSTEE......FPPLQPILQQKk.EKDIIKK
ENSGGOP00000003107  VWLKHQHDRVCGDAMFQLQE.N--VKDKLRAIVVTLSYSLQT.....PRLRRqapgqgLPPVAPILNAH..QPSTQRA
ENSGGOP00000007587  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000024170  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000027645  ITVRKS---ECTKHSFYMLD.KHDFQD---SVRITLDFNLTD.....PENG-......-----PVLDDS..LPNSVHE
ENSGGOP00000017850  ITVRKS---ECTKHSFYMLD.KHDFQD---SVRITLDFNLTD.....PENG-......-----PVLDDS..LPNSVHE
ENSGGOP00000021655  LTLKRQKQKVCMEETLWLQD.N--IRDKLRPIPITASVEIQE.....PSSRRrvns..LPEVLPILNSD..EPKTAHI
ENSGGOP00000007656  LTLKRQKQKVCMEETLWLQD.N--IRDKLRPIPITASVEIQE.....PSSRRrvns..LPEVLPILNSD..EPKTAHI
ENSGGOP00000000711  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000022058  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000012737  LQLTYM-EETCRHYVAHVKR.R--VQDVISPIVFEAAYSLSEhvtg.EEERE......LPPLTPVLRWKkgQKIAQKN
ENSGGOP00000012782  VLL-SSGQELCERINFHVLD.---TADYVKPVTFSVEYSLED.....PDHG-......-----PMLDDG..WPTTLRV
ENSGGOP00000011589  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000023681  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000012325  RVLGLK--AHCENFNLLLPS.C--VEDSVTPITLRLNFTLVG.....KPLPA......FRNLRPMLAAD..AQRYFTA
ENSGGOP00000012325  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000022105  QVLGLT--QTCETLKLQLPN.C--IEDPVSPIVLRLNFSLVG.....TPLSA......FGNLRPVLAED..AQRLFTA
ENSGGOP00000005987  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000004003  QVLGLT--QTCETLKLQLPN.C--IEDPVSPIVLRLNFSLVG.....TPLSA......FGNLRPVLAED..AQRLFTA
ENSGGOP00000022673  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000005987  KTLGLG--IHCETLKLLLPD.C--VEDVVSSIILHLNFSLVR.....EPIPS......PQNLRPVLAMG..SQDLFTA
ENSGGOP00000007324  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000017451  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000012737  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000019684  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000012548  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000022673  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000021655  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000007656  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000015038  LRL-SVGNVTCEQLHFHVLD.---TSDYLRPVALTVTFALDN.....TTKP-......----GPVLNEG..SPTSIQK
ENSGGOP00000004877  MTISRGGLMQCEELIAYLRV.R--------------------.....-----......-----------..-------
ENSGGOP00000013236  FSM---PEMRCQKLELLLMD.N--LRDKLRPIIISMNYSLPLrm...PDRPRlglr..SLDAYPILNQA..QALENHT
ENSGGOP00000001271  VTLKNK--------------.---------------------.....-----......-----------..-------
ENSGGOP00000025315  VTLKNK--------------.---------------------.....-----......-----------..-------
ENSGGOP00000006652  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000004877  ----------C---------.---------------------.....-----......-----------..-------
ENSGGOP00000002159  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000022105  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000009194  ---------------V----.---------------------.....-----......-----------..-------
ENSGGOP00000003107  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000004003  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000027645  ----------C---------.---------------------.....-----......-----------..-------
ENSGGOP00000015038  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000013236  QY------------------.---------------------.....-----......-----------..-------
ENSGGOP00000017850  ----------C---------.---------------------.....-----......-----------..-------
ENSGGOP00000002159  IAVTTS--MSCTDFSFHFPV.C--VQDLISPINVSLNFSLRE.....EEGTPrdqraqGKDIPPILRPS..LH-SETW
ENSGGOP00000005989  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000012782  Q-------------------.---------------------.....-----......-----------..-------
ENSGGOP00000001271  MVVNQA--QSCPEHIIYIQE.---PSDVVNSLDLRVDISLEN.....PGTS-......-----PALEAY..SETAKVF
ENSGGOP00000025315  MVVNQA--QSCPEHIIYIQE.---PSDVVNSLDLRVDISLEN.....PGTS-......-----PALEAY..SETAKVF
ENSGGOP00000014106  VTHRNQPRGDCDGVQINV--.---------------------.....-----......-----------..-------
ENSGGOP00000012737  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000012782  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000017933  --------------------.---------------------.....-----......-----------..----ETA
ENSGGOP00000012325  --------------------.---------------------.....-----......------SLR--..-------
ENSGGOP00000015038  ---L----------------.---------------------.....-----......-----------..-------
ENSGGOP00000017850  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000005987  --------------------.---------------------.....-----......-----P-----..-------
ENSGGOP00000004003  --------------------.---------------------.....-----......-----------..-------
ENSGGOP00000027645  --------------------.----------------I----.....-----......-----------..-------
ENSGGOP00000007324  LREWSSGSQLCEDLLLMPTEaELCEEDCFSNASVKVSYQLQT.....PEGQ-......TDHPQPILDRY..TEPFAIF
ENSGGOP00000017451  LREWSSGSQLCEDLLLMPTEaELCEEDCFSNASVKVSYQLQT.....PEGQ-......TDHPQPILDRY..TEPFAIF
ENSGGOP00000009194  ----------------H---.---------------------.....-----......-----------..-------


                              160                                                                   
                                |                                                                   
d1jv2a1               QAHILL.DCGE...................................................................
ENSGGOP00000004877  ------.----krdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhsyslkssas
ENSGGOP00000014812  ------.----vhvvefhrqspakilnctnieclqiscavgqleggesavlkvrsrlwahtflqrkndpyalaslvsf
ENSGGOP00000012548  ------.----emargqramvtvlaflwlpslyqrpldqfvlqshawfnvsslpyavpplslprgeaqvrtqllrale
ENSGGOP00000019684  ------.----emargqramvtvlaflwlpslyqrpldqfvlqshawfnvsslpyavpplslprgeaqvrtqllrale
ENSGGOP00000021655  ------.----ncsvnvncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpna
ENSGGOP00000007656  ------.----ncsvnvncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpna
ENSGGOP00000000711  ------.----lkcpeaecfrlrcelgplhqqesqslqlhfrvwaktflqrehqpfslqceavykalkmpyrilprql
ENSGGOP00000022058  ------.----pqilkcpeaecfrlrcelgplhqqesqslqlhfrvwaktflqpkrehqpfslqceavykalkmpyri
ENSGGOP00000003107  ------.----erqepsmswwpvssaekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavk
ENSGGOP00000014812  QAHILV.DCGE...................................................................
ENSGGOP00000013236  ------.----vtlaaakkaksetvltcatgrahcvwlecpipdapivtnvtvkarvwnstfiedyrdfdrvrvngwa
ENSGGOP00000022058  KAQILL.DCGE...................................................................
ENSGGOP00000000711  KAQILL.DCGE...................................................................
ENSGGOP00000001271  ------.----ihmkgeyfvnvttriwnrtfasstfqtvqltaaaeintynpeiyviedntvtiplmimkpdekaevp
ENSGGOP00000025315  ------.----ihmkgeyfvnvttriwnrtfasstfqtvqltaaaeintynpeiyviedntvtiplmimkpdekaevp
ENSGGOP00000014812  ------.----vsgtnyslglrfavprlektnmsinfdlqirssnkdnpdsnfvslq.....................
ENSGGOP00000012548  QTRIVL.DCGE...................................................................
ENSGGOP00000019684  QTRIVL.DCGE...................................................................
ENSGGOP00000022673  TINFAR.FC--...................................................................
ENSGGOP00000003107  EIHFLKqGCGE...................................................................
ENSGGOP00000007587  ------.----lkigdtvsfsieakvrgcpqekeksftikpvgfkdslivqvtfdcdcacqaq...............
ENSGGOP00000024170  ------.----lkigdtvsfsieakvrgcpqekeksftikpvgfkdslivqvtfdcdcacqaq...............
ENSGGOP00000027645  YIPFAK.DCGN...................................................................
ENSGGOP00000017850  YIPFAK.DCGN...................................................................
ENSGGOP00000021655  DVHFLKeGCGD...................................................................
ENSGGOP00000007656  DVHFLKeGCGD...................................................................
ENSGGOP00000000711  ------.----wgglrftvphlrdtkktiqfdfqilsknlnnsqsdvvsf............................
ENSGGOP00000022058  ------.----wgglrftvphlrdtkktiqfdfqilsknlnnsqsdvvsf............................
ENSGGOP00000012737  QTVFER.NC--...................................................................
ENSGGOP00000012782  SVPFWN.GCNE...................................................................
ENSGGOP00000011589  ------.----evsvearscpsrhtehvfalrpvgfrdslevgvtynctcgcs.........................
ENSGGOP00000023681  ------.----evsvearscpsrhtehvfalrpvgfrdslevgvtynctcgcs.........................
ENSGGOP00000012325  SLPFEK.NCG-...................................................................
ENSGGOP00000012325  ------.----tcdsapvgsqgtwstscrinhlifrggaqitflatfdvspkavlgdrllltanvssenntprtsktt
ENSGGOP00000022105  LFPFEK.NCGN...................................................................
ENSGGOP00000005987  ------.----egsngtfivtfdvsykatlgdrmlmrasassennkassskatfqlelp...................
ENSGGOP00000004003  LFPFEK.NCGN...................................................................
ENSGGOP00000022673  ------.----nsgvvqldcsigyiyvdhlsridisflldvsslsraeedlsitvhatceneeemdnlkhsrv.....
ENSGGOP00000005987  SLPFEK.NCG-...................................................................
ENSGGOP00000007324  ------.----kppspniqcddpqpvasvlimncrighpvlkrssahvsviwqleenafpnrtaditvtvtnsnerrs
ENSGGOP00000017451  ------.----kppspniqcddpqpvasvlimncrighpvlkrssahvsviwqleenafpnrtaditvtvtnsnerrs
ENSGGOP00000012737  ------.----keemgiscellesdflkcsvgfpfmrskskyefsvifdtshlsgeeevlsfivtaqsgnterseslh
ENSGGOP00000019684  ------.----ymqalsnvegferlicnqkkenetrvvlcelgnpmkknaqvrll.......................
ENSGGOP00000012548  ------.----ymqalsnvegferlicnqkkenetrvvlcelgnpmkknaqvrll.......................
ENSGGOP00000022673  ------.----aleqrksamqtlkgivqflsktdkrllycikadphclnflcnfgkmesgkeasvhiqlegrpsilem
ENSGGOP00000021655  ------.----adcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqdnlapitakakv..........
ENSGGOP00000007656  ------.----adcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqdnlapitakakv..........
ENSGGOP00000015038  LVPFSK.DCGP...................................................................
ENSGGOP00000004877  ------.----anfsa..............................................................
ENSGGOP00000013236  EVQFQK.ECGP...................................................................
ENSGGOP00000001271  ------.----resayntgivvdfsenlffasfslpvdgtevtcqvaasqksvacdvgypalkreqqvtftinfdfnl
ENSGGOP00000025315  ------.----resayntgivvdfsenlffasfslpvdgtevtcqvaasqksvacdvgypalkreqqvtftinfdfnl
ENSGGOP00000006652  ------.----athclpephllrlralgfseelivelhtlcdcncsdt..............................
ENSGGOP00000004877  ------.----dlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqssnlfdkvspvvs.................
ENSGGOP00000002159  ------.----mlkphsqipvsceelpeesrllsralscnvsspifkaghlvalqmmfntlvnsswgdsvelhanvtc
ENSGGOP00000022105  ------.----srlqnqrsqrswrlacesassievsgalkstscsinhpifpensevrt...................
ENSGGOP00000009194  ------.----gdtasfnvtvnipncerrsrhiiikpvglgdalellvspecncdcqk....................
ENSGGOP00000003107  ------.----gttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpdslhysgvraldpaekplcl
ENSGGOP00000004003  ------.----srlqnqrsqrswrlacesassievsgalkstscsinhpifpenseen....................
ENSGGOP00000027645  ------.----esnhnitckvgypflrrgemvtfkilfqfntsylmenvtiylsatsdseeppetlsdnvvn......
ENSGGOP00000015038  ------.----ifsrnlhlasltpqrespikvecaapsaharlcsvghpvfqtgakvafllefefscssllsqvfvkl
ENSGGOP00000013236  ------.----srdvrklllsinvtntrtsegsgedahealltlvvppalllssvrppgacqanetifcelgnpfkrn
ENSGGOP00000017850  ------.----esnhnitckvgypflrrgemvtfkilfqfntsylmenvtiylsatsdseeppetlsdnvvn......
ENSGGOP00000002159  EIPFEK.NCGE...................................................................
ENSGGOP00000005989  ------.----sigdevqfeisitsnkcpkkdsdsfkirplgfteevevilqyicececqs.................
ENSGGOP00000012782  ------.----kedsdgsiecvneerrlqkkvcnvsypffrakakvafrldfefsksiflhhleielsagsdsnerds
ENSGGOP00000001271  SIPFHK.DCGE...................................................................
ENSGGOP00000025315  SIPFHK.DCGE...................................................................
ENSGGOP00000014106  ------.----pitfqvkvtateciqeqsfviralgftdivtvqvlpqcecrcrdq......................
ENSGGOP00000012737  ------.----iipqeqenifhtifafftksgrkvvdcekpgiscltahcnfsalakeesrtidiymllnteilkkds
ENSGGOP00000012782  ------.----rlvpnqeinfhllgnlwlrslkalkyksmkimvnaalqrqfhspfifreedpsrqivfeiskqedwq
ENSGGOP00000017933  KIHIHR.NC--scqced.............................................................
ENSGGOP00000012325  ------.----cssekiappasdflahiqknpvldcsiagclrfrcdvpsfsvqeeldftlkgnlsfgwvrqtlqkkv
ENSGGOP00000015038  ------.----ngsntqcqvvrchlgqlakgtkvsvgllrlvhneffqrakfksltvvstfelgte............
ENSGGOP00000017850  ------.----rgelrsenaslvlsssnqkrelaiqiskdglpgtvplwvi...........................
ENSGGOP00000005987  ------.----mldcsiadclqfrcdvpsfsvqeeldftlkgnlsfgwvretlqkkvsvvsvaeitfdtsvysqlpgq
ENSGGOP00000004003  ------.----vvncsiavcqriqcdipffgiqeefnatlkgnlsfdwyiktshnhllivstaeilfndsvftllpgq
ENSGGOP00000027645  ------.----sfpnmtsngypvlyptglsssdsyfsslnltirgelrsenaslvl......................
ENSGGOP00000007324  QLPYEK.AC--k..................................................................
ENSGGOP00000017451  QLPYEK.AC--k..................................................................
ENSGGOP00000009194  ------.----vrqtedypvdlyylmdlsasmdddlntikel....................................


                                                                            
                                                                            
d1jv2a1               ......................................................
ENSGGOP00000004877  fnviefpyknlpieditnstlvttnvtwgiqpapmpvpvwvi............
ENSGGOP00000014812  evkkmpykdqpaklpegsiaiktsviwatpnvsfsiplwvi.............
ENSGGOP00000012548  eraipiwwv.............................................
ENSGGOP00000019684  eraipiwwv.............................................
ENSGGOP00000021655  gtqvrvtvfpsktvaqysgvpwwii.............................
ENSGGOP00000007656  gtqvrvtvfpsktvaqysgvpwwii.............................
ENSGGOP00000000711  pqkerqvatavqwtkaegsygvplwii...........................
ENSGGOP00000022058  lprqlpqkerqvatavqwtkaegsygvplwii......................
ENSGGOP00000003107  slevivranitvkssiknlmlrdasivipvmvyldpvavvaegvpwwvi.....
ENSGGOP00000014812  ......................................................
ENSGGOP00000013236  tlflrtsiptinmenkttwfsvdidselveelpaeielwlv.............
ENSGGOP00000022058  ......................................................
ENSGGOP00000000711  ......................................................
ENSGGOP00000001271  tgvi..................................................
ENSGGOP00000025315  tgvi..................................................
ENSGGOP00000014812  ......................................................
ENSGGOP00000012548  ......................................................
ENSGGOP00000019684  ......................................................
ENSGGOP00000022673  ......................................................
ENSGGOP00000003107  ......................................................
ENSGGOP00000007587  ......................................................
ENSGGOP00000024170  ......................................................
ENSGGOP00000027645  ......................................................
ENSGGOP00000017850  ......................................................
ENSGGOP00000021655  ......................................................
ENSGGOP00000007656  ......................................................
ENSGGOP00000000711  ......................................................
ENSGGOP00000022058  ......................................................
ENSGGOP00000012737  ......................................................
ENSGGOP00000012782  ......................................................
ENSGGOP00000011589  ......................................................
ENSGGOP00000023681  ......................................................
ENSGGOP00000012325  ......................................................
ENSGGOP00000012325  fqlelp................................................
ENSGGOP00000022105  ......................................................
ENSGGOP00000005987  ......................................................
ENSGGOP00000004003  ......................................................
ENSGGOP00000022673  ......................................................
ENSGGOP00000005987  ......................................................
ENSGGOP00000007324  lanethtlq.............................................
ENSGGOP00000017451  lanethtlq.............................................
ENSGGOP00000012737  dntlvlm...............................................
ENSGGOP00000019684  ......................................................
ENSGGOP00000012548  ......................................................
ENSGGOP00000022673  detsalkfeiratgfpepnprvielnkdenva......................
ENSGGOP00000021655  ......................................................
ENSGGOP00000007656  ......................................................
ENSGGOP00000015038  ......................................................
ENSGGOP00000004877  ......................................................
ENSGGOP00000013236  ......................................................
ENSGGOP00000001271  qnlqnqaslsfqalsesqeenkadnlvnlk........................
ENSGGOP00000025315  qnlqnqaslsfqalsesqeenkadnlvnlk........................
ENSGGOP00000006652  ......................................................
ENSGGOP00000004877  ......................................................
ENSGGOP00000002159  nnedsgllednsat........................................
ENSGGOP00000022105  ......................................................
ENSGGOP00000009194  ......................................................
ENSGGOP00000003107  snenashvecelgnpmkrgaqvtfylilstsgisiettelevelllatiseqel
ENSGGOP00000004003  ......................................................
ENSGGOP00000027645  ......................................................
ENSGGOP00000015038  tassdslerngtlqdnta....................................
ENSGGOP00000013236  qrmelliafevigvtlhtrdlqvqlqlstsshqdnlwpmtltl...........
ENSGGOP00000017850  ......................................................
ENSGGOP00000002159  ......................................................
ENSGGOP00000005989  ......................................................
ENSGGOP00000012782  tkednva...............................................
ENSGGOP00000001271  ......................................................
ENSGGOP00000025315  ......................................................
ENSGGOP00000014106  ......................................................
ENSGGOP00000012737  ssviqfmsrakvkvdpalrvveiahgnpeevtvvfealhnleprgyvvgwii..
ENSGGOP00000012782  vpiwii................................................
ENSGGOP00000017933  ......................................................
ENSGGOP00000012325  svasvaeitfdtsvysqlpgqeafmraqm.........................
ENSGGOP00000015038  ......................................................
ENSGGOP00000017850  ......................................................
ENSGGOP00000005987  eafmraqm..............................................
ENSGGOP00000004003  gafv..................................................
ENSGGOP00000027645  ......................................................
ENSGGOP00000007324  ......................................................
ENSGGOP00000017451  ......................................................
ENSGGOP00000009194  ......................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0047690 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]