SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Integrin domains alignments

These alignments are sequences aligned to the 0053612 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1tyeb1             ................................................................................
hsO_ENSP00000364042 laaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhlqwpykynnntllyilhydidg
hsO_ENSP00000404291 laaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhlqwpykynnntllyilhydidg
hsO_ENSP00000261023 laaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhlqwpykynnntllyilhydidg
hsO_ENSP00000367316 aqveirgvshppqivlpihnwepeeephkeeevgplvehiyelhnigpstisdtilevgwpfsardefllyifhiqtlgp
hsO_ENSP00000262407 aeaqvelrgnsfpaslvvaaeegereqnsldswgpkvehtyelhnngpgtvnglhlsihlpgqsqpsdllyildiqpqgg
hsO_ENSP00000386614 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000264107 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000394169 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000341078 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000386896 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000364369 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000264106 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000406694 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefrvinlgkpltnlgtatlniqwpkeisngkwllylvkves
hsO_ENSP00000340536 aeaqvelrgnsfpaslvvaaeegereqnsldswgpkvehtyelhnngpgtvnglhlsihlpgqsqpsdllyildiqpqgg
hsO_ENSP00000293379 qaqvtlngvskpeavlfpvsdwhprdqpqkeedlgpavhhvyelinqgpssisqgvlelscpqalegqqllyvtrvtgln
hsO_ENSP00000393844 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000343009 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000377776 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000377777 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000452120 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000257879 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000257880 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000452387 ielplsiagmaipqqlffsgvvrgeramqserdvgskvkyevtvsnqgqs..............................
hsO_ENSP00000364042 pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvellldklkqkgairralflysrs
hsO_ENSP00000404291 pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvellldklkqkgairralflysrs
hsO_ENSP00000261023 pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvellldklkqkgairralflysrs
hsO_ENSP00000367316 pvvtvdaqlllhpmiinlenktcqvpdsmtsaacfslrvcasvtgqsiantivlmaevqldslkqkgaikrtlfldnhqa
hsO_ENSP00000315190 tlqtslsmvnhrlqsffggtvmgesgmktvedvgsplkyefqvgpmgeglvglgtlvlglewpyevsngkwllypteitv
hsO_ENSP00000007722 tlqtslsmvnhrlqsffggtvmgesgmktvedvgsplkyefqvgpmgeglvglgtlvlglewpyevsngkwllypteitv
hsO_ENSP00000293379 pivsasasltifpamfnpeerscslegnpvacinlsfclnasgkhvadsigftvelql......................
hsO_ENSP00000296585 ydaeihltrstninfyeissdgnvpsivhsfedvgpkfifslkvttgsvpvsmatviihipqytkeknplmyltgvqtdk
hsO_ENSP00000367316 dnlcvpdlklsarpdkhqviigdenhlmliinarnegegayeaelfvmipeeadyvgiernnkgfrplsceykmenvtrm
hsO_ENSP00000404291 dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnnealarlscafktenqtrq
hsO_ENSP00000364042 dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnnealarlscafktenqtrq
hsO_ENSP00000261023 dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnnealarlscafktenqtrq
hsO_ENSP00000340536 ddvcvpqlqltasvtgspllvgadnvlelqmdaanegegayeaelavhlpqgahymralsnvegferlicnqkkenetrv
hsO_ENSP00000262407 ddvcvpqlqltasvtgspllvgadnvlelqmdaanegegayeaelavhlpqgahymralsnvegferlicnqkkenetrv
hsO_ENSP00000340536 pvvkasvqllvqdslnpavkscvlpqtktpvscfniqmcvgatghnipqklslnae........................
hsO_ENSP00000262407 pvvkasvqllvqdslnpavkscvlpqtktpvscfniqmcvgatghnipqklslnae........................
hsO_ENSP00000380227 pvvivdaslshpesvnrtkfdcvengwpsvcidltlcfsykgkevpgyivlfynmsldvnrkaespprfyfssngtsd..
hsO_ENSP00000393844 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvaldyvl........................
hsO_ENSP00000452120 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvaldyvl........................
hsO_ENSP00000257879 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvaldyvl........................
hsO_ENSP00000377776 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvaldyvl........................
hsO_ENSP00000377777 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvaldyvl........................
hsO_ENSP00000452387 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvaldyvl........................
hsO_ENSP00000257880 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvaldyvl........................
hsO_ENSP00000407801 k...............................................................................
hsO_ENSP00000441691 dnicqddlsitfsfmsldclvvggprefnvtvtvrndgedsyr.....................................
hsO_ENSP00000287497 dnicqddlsitfsfmsldclvvggprefnvtvtvrndgedsyr.....................................
hsO_ENSP00000452786 k...............................................................................
hsO_ENSP00000456711 k...............................................................................
hsO_ENSP00000282588 vavvkvtmnfepnkvniqkknchmegketvc.................................................
hsO_ENSP00000233573 pvvivdaslshpesvnrtkfdcvengwpsvcidltlcfsykgkevpgyivlfynmsldvnrkaespprfyfssng.....
hsO_ENSP00000386614 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000264107 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000341078 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000386896 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000394169 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000364369 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000264106 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000406694 pviniqktitvtpnridlrqktacgapsg...................................................
hsO_ENSP00000293379 dnicvpdlqlevfgeqnhvylgdkna......................................................
hsO_ENSP00000388435 elllsvsgvakpsqvyfggtvvgeqamksedevgslieyefreshnsrkkreitekqiddnrkfslfaerkyqtlncsvn
hsO_ENSP00000389442 nctsdmeinplrikisslqttekndtvagqgerdhlitkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvk
hsO_ENSP00000418367 si..............................................................................
hsO_ENSP00000327290 pvvqinaslhfepskinifhrdckrsgrdatclaaflcftpiflaphfqtttvgirynatmderrytprahldeggdrft
hsO_ENSP00000403392 pvvqinaslhfepskinifhrdckrsgrdatclaaflcftpiflaphfqtttvgirynatmderrytprahldeggdrft
hsO_ENSP00000477446 si..............................................................................
hsO_ENSP00000264741 pvitvdvsiflpgsinitapqchdgqqpvnclnvttcfsfhgkhvpgeiglnyvlmadvakkekgqmprvyfvllgetmg
hsO_ENSP00000268296 pvlwvgvsmqfipaeiprsafecreqvvseqtlvqsniclyidkrsknllgsrdlqssvtldlaldpgrlspratfq...
hsO_ENSP00000454623 pvlwvgvsmqfipaeiprsafecreqvvseqtlvqsniclyidkrsknllgsrdlqssvtldlaldpgrlspratfq...
hsO_ENSP00000296181 si..............................................................................
hsO_ENSP00000343009 pilhvshevsiaprsidleqpncagghsvcvdlrvcfsyiavpssysptvda............................
hsO_ENSP00000373854 pvlkvgvamrfspvevakavyrcweekpsaleagdatvcltiqkssldqlgdiqssvrfdlaldpgrltsraifnetknp
hsO_ENSP00000373854 dglcegdlgvtlsfsglqtltvgsslelnvivtvwnagedsygtvvslyypa............................
hsO_ENSP00000441691 pvlrvkaimefnprevarnvfecndqvvkgkeagevrvclhvqkstrdrlregqiqsvvtydlaldsgrphsravfnetk
hsO_ENSP00000287497 pvlrvkaimefnprevarnvfecndqvvkgkeagevrvclhvqkstrdrlregqiqsvvtydlaldsgrphsravfnetk
hsO_ENSP00000268296 dhicqdnlgisfsfpglksllvgsnlelnaevmvwndged........................................
hsO_ENSP00000454623 dhicqdnlgisfsfpglksllvgsnlelnaevmvwndged........................................
hsO_ENSP00000380227 ncsadlqvsakigflkphenktylavgsmktlmlnvslfnagddayettlhvklpvglyfikileleekqincevtdnsg
hsO_ENSP00000263087 fcvaelqlattvsqqelvvgltkeltlninltnsgedsymtsmalnyprnlqlkrmqkp.....................
hsO_ENSP00000397258 pvitvdvsiflpgsinitapqchdgqqpvnclnvttcfsfhgkhvpgeiglnyvlmadvakkekgqmprvyfvllget..
hsO_ENSP00000264741 dcaadlqlqgklllssmdektlylalgavknislnisisnlgddaydanvsfnvsrelffinmwqk..............
hsO_ENSP00000386614 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000264107 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000341078 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000386896 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000394169 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000364369 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000264106 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000406694 dnvcnsnlkleykfctregnqdkfsylpiqkgvpelvlkdqkdialeitvtnspsnprnptkdgd...............
hsO_ENSP00000380227 yevkltvhgfvnptsfvygsndenepetcmvekmnltfhvintgnsmapnvsveimvpnsfspqtdklfnildvqtttge
hsO_ENSP00000467269 nsfpaslvvaaeegereqnsldswgpkvehtyelhnngpgtvnglhls................................
hsO_ENSP00000439894 pivhltpslevtpqaisvvqrdcrrrgqeavcltaalcfqvtsrtpgrwdhqfymrftasldewtagar...........
hsO_ENSP00000462836 pivhltpslevtpqaisvvqrdcrrrgqeavcltaalcfqvtsrtpgrwdhqfymrftasldewtagar...........
hsO_ENSP00000440011 pivhltpslevtpqaisvvqrdcrrrgqeavcltaalcfqvtsrtpgrwdhqfymrftasldewtagar...........
hsO_ENSP00000462258 pivhltpslevtpqaisvvqrdcrrrgqeavcltaalcfqvtsrtpgrwdhqfymrftasldewtagar...........
hsO_ENSP00000358310 pivhltpslevtpqaisvvqrdcrrrgqeavcltaalcfqvtsrtpgrwdhqfymrftasldewtagar...........
hsO_ENSP00000462898 pivhltpslevtpqaisvvqrdcrrrgqeavcltaalcfqvtsrtpgrwdhqfymrftasldewtagar...........
hsO_ENSP00000315190 pvinivhktlvprpavldpalctatscvqvelcfaynqsagnpnyrrnitlaytleadrdrrpp................
hsO_ENSP00000007722 pvinivhktlvprpavldpalctatscvqvelcfaynqsagnpnyrrnitlaytleadrdrrpp................
hsO_ENSP00000422145 dglcisdlvldvrqipaaqeqpfivsnqnkrltfsvtlknkresayntgivvdfsenlffasfslpvdgtevtcqvaasq
hsO_ENSP00000296585 dglcisdlvldvrqipaaqeqpfivsnqnkrltfsvtlknkresayntgivvdfsenlffasfslpvdgtevtcqvaasq
hsO_ENSP00000345501 vqlimdaynslss...................................................................
hsO_ENSP00000455374 vqlimdaynslss...................................................................
hsO_ENSP00000267082 vqlimdaynslss...................................................................
hsO_ENSP00000408741 vqlimdaynslss...................................................................
hsO_ENSP00000350886 dkkceanlrvsfspars...............................................................
hsO_ENSP00000349252 dkkceanlrvsfspars...............................................................
hsO_ENSP00000439894 dnecvtdlvlqvnmdirgsrkapfvvrggrrkvlvsttlenrkenayntslslifsrnlhlaslt...............
hsO_ENSP00000462836 dnecvtdlvlqvnmdirgsrkapfvvrggrrkvlvsttlenrkenayntslslifsrnlhlaslt...............
hsO_ENSP00000440011 dnecvtdlvlqvnmdirgsrkapfvvrggrrkvlvsttlenrkenayntslslifsrnlhlaslt...............
hsO_ENSP00000462258 dnecvtdlvlqvnmdirgsrkapfvvrggrrkvlvsttlenrkenayntslslifsrnlhlaslt...............
hsO_ENSP00000358310 dnecvtdlvlqvnmdirgsrkapfvvrggrrkvlvsttlenrkenayntslslifsrnlhlaslt...............
hsO_ENSP00000462898 dnecvtdlvlqvnmdirgsrkapfvvrggrrkvlvsttlenrkenayntslslifsrnlhlaslt...............
hsO_ENSP00000386828 lrse............................................................................
hsO_ENSP00000393844 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000408024 lrse............................................................................
hsO_ENSP00000283249 lrse............................................................................
hsO_ENSP00000386367 lrse............................................................................
hsO_ENSP00000257879 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000377776 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000377777 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000452120 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000343009 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000257880 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000452387 dkicqsnlqlvrarfctrvsdtefqplpmdvdgttalfalsgqpviglelmvtnlpsdpaqpqadgddaheaqllvmlpd
hsO_ENSP00000282588 kcisdlslhvattekdll..............................................................
hsO_ENSP00000303351 pksavgtlsanssnvi................................................................
hsO_ENSP00000379350 pksavgtlsanssnvi................................................................
hsO_ENSP00000364094 pksavgtlsanssnvi................................................................
hsO_ENSP00000388694 pksavgtlsanssnvi................................................................
hsO_ENSP00000315190 dnkcesnlqmraafvseqqqklsrlqysrdvrklllsinvtntrtsersgedahealltlvvppalllssvrppg.....
hsO_ENSP00000007722 dnkcesnlqmraafvseqqqklsrlqysrdvrklllsinvtntrtsersgedahealltlvvppalllssvrppg.....
hsO_ENSP00000327290 dehcvpdlvldarsdlptameycqrvlrkpaqdcsaytlsfdttvfiiestrqrvaveatlenrgenaystvlnisqsan
hsO_ENSP00000403392 dehcvpdlvldarsdlptameycqrvlrkpaqdcsaytlsfdttvfiiestrqrvaveatlenrgenaystvlnisqsan
hsO_ENSP00000350886 pvvdmvtlmsfspaeipvhevecsystsnkmkegvniticfqikslipqfqgrlvanltytlqldghrtrrr........
hsO_ENSP00000349252 pvvdmvtlmsfspaeipvhevecsystsnkmkegvniticfqikslipqfqgrlvanltytlqldghrtrrrglfpggrh
hsO_ENSP00000441561 ev..............................................................................
hsO_ENSP00000222573 ev..............................................................................
hsO_ENSP00000426142 snlqmraafvseqqqklsrlqysrdvrklllsinvtntrtsersgedahealltlvvppalllssvrppgacqa......
hsO_ENSP00000282588 kyevglqfyssaseyhisiaanetvpevinstedigneinifylirksgsfpmpelklsisfpnmtsngypvlyptglss
hsO_ENSP00000467977 fcvaelqlattvsqqelvvgltkeltlnin..................................................
hsO_ENSP00000424397 advaieasftpekitlvnknaqiilklcfsakfrptkqnnqvaiv...................................
hsO_ENSP00000422145 advaieasftpekitlvnknaqiilklcfsakfrptkqnnqvaiv...................................
hsO_ENSP00000296585 advaieasftpekitlvnknaqiilklcfsakfrptkqnnqvaiv...................................
hsO_ENSP00000380952 pksavgelsedssnvvqliknaynkls.....................................................
hsO_ENSP00000303242 pksavgelsedssnvvqliknaynkls.....................................................
hsO_ENSP00000347279 pksavgelsedssnvvqliknaynkls.....................................................
hsO_ENSP00000380948 pksavgelsedssnvvqliknaynkls.....................................................
hsO_ENSP00000380950 pksavgelsedssnvvqliknaynkls.....................................................
hsO_ENSP00000380955 pksavgelsedssnvvqliknaynkls.....................................................
hsO_ENSP00000420814 ................................................................................
hsO_ENSP00000264741 evdtsitgimsptsfvygesvdaanfiqlddlechfqpinitlqvyntgpstlpgssvsisfpnrlssgg..........
hsO_ENSP00000403392 slshyevkpnsslerydgigppfscifriqnlglfpihgmmmkitipiatrsgnrllklrdfltdevantscniwgnste
hsO_ENSP00000327290 slshyevkpnsslerydgigppfscifriqnlglfpihgmmmkitipiatrsgnrllklrdfltdeantscniwgnstey
hsO_ENSP00000268296 vamhryqvnnlgqrdlpvs.............................................................
hsO_ENSP00000454623 vamhryqvnnlgqrdlpvs.............................................................
hsO_ENSP00000439894 pgpefkttlrvqnlgcyvvsgliisallpavahggnyflslsqvitnnascivqnlteppgppvhpe.............
hsO_ENSP00000462836 pgpefkttlrvqnlgcyvvsgliisallpavahggnyflslsqvitnnascivqnlteppgppvhpe.............
hsO_ENSP00000440011 pgpefkttlrvqnlgcyvvsgliisallpavahggnyflslsqvitnnascivqnlteppgppvhpe.............
hsO_ENSP00000462258 pgpefkttlrvqnlgcyvvsgliisallpavahggnyflslsqvitnnascivqnlteppgppvhpe.............
hsO_ENSP00000358310 pgpefkttlrvqnlgcyvvsgliisallpavahggnyflslsqvitnnascivqnlteppgppvhpe.............
hsO_ENSP00000462898 pgpefkttlrvqnlgcyvvsgliisallpavahggnyflslsqvitnnascivqnlteppgppvhpe.............
hsO_ENSP00000450693 vkdklraivvtlsyslqtprlrrqapg.....................................................
hsO_ENSP00000287497 vmqhqyqvsnlgqrslpislvflvpvrlnqtviwdrpqvt........................................
hsO_ENSP00000441691 vmqhqyqvsnlgqrslpislvflvpvrlnqtviwdrpqvt........................................
hsO_ENSP00000461626 k...............................................................................
hsO_ENSP00000373854 aehryrvnnlsqrdlaisinfwvpvllngvavwdvvmeapsqslpcvserkppqhsdfl.....................
hsO_ENSP00000263087 pvvrlkvsmaftpsal................................................................
hsO_ENSP00000386828 sq..............................................................................
hsO_ENSP00000408024 sq..............................................................................
hsO_ENSP00000283249 sq..............................................................................
hsO_ENSP00000386367 sq..............................................................................
hsO_ENSP00000450267 ehqpfslqceavykalkmpyrilp........................................................


                                                                                                    
                                                                                                    
d1tyeb1             ................................................................................
hsO_ENSP00000364042 pmnctsdmeinplrikisslqttekndtvagqgerdhlitkrdlalsegdihtlgcgv......................
hsO_ENSP00000404291 pmnctsdmeinplrikisslqttekndtvagqgerdhlitkrdlalsegdihtlgcgv......................
hsO_ENSP00000261023 pmnctsdmeinplrikisslqttekndtvagqgerdhlitkrdlalsegdihtlgcgv......................
hsO_ENSP00000367316 lqcqpnpninpqdikpaaspedtpelsaflr.................................................
hsO_ENSP00000262407 lqcfpqppvnplkvdwglpipspspihpa...................................................
hsO_ENSP00000386614 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000264107 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000394169 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000341078 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000386896 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000364369 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000264106 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000406694 kglekvtcepqkeinslnlteshnsrkkreitekqiddnrkfslfaerkyqt............................
hsO_ENSP00000340536 lqcfpqppvnpl....................................................................
hsO_ENSP00000293379 cttnhpinpkgl....................................................................
hsO_ENSP00000393844 ................................................................................
hsO_ENSP00000343009 ................................................................................
hsO_ENSP00000377776 ................................................................................
hsO_ENSP00000377777 ................................................................................
hsO_ENSP00000452120 ................................................................................
hsO_ENSP00000257879 ................................................................................
hsO_ENSP00000257880 ................................................................................
hsO_ENSP00000452387 ................................................................................
hsO_ENSP00000364042 ................................................................................
hsO_ENSP00000404291 ................................................................................
hsO_ENSP00000261023 ................................................................................
hsO_ENSP00000367316 hrvfplvikrq.....................................................................
hsO_ENSP00000315190 hgngswpcrppgdlinplnltlsdpgdrpsspqrrrrqldpgggqgpppvtlaaakkaksetvltcatgrahcvwlecpi
hsO_ENSP00000007722 hgngswpcrppgdlinplnltlsdpgdrpsspqrrrrqldpgggqgpppvtlaaakkaksetvltcatgrahcvwlecpi
hsO_ENSP00000293379 ................................................................................
hsO_ENSP00000296585 agdiscnadinplki.................................................................
hsO_ENSP00000367316 vvcdlgnpmvsgtnyslglrfav.........................................................
hsO_ENSP00000404291 vvc.............................................................................
hsO_ENSP00000364042 vvc.............................................................................
hsO_ENSP00000261023 vvc.............................................................................
hsO_ENSP00000340536 vlcelgnpmkknaqigiamlvsvgnle.....................................................
hsO_ENSP00000262407 vlcelgnpmkknaqigiamlvsvgnle.....................................................
hsO_ENSP00000340536 ................................................................................
hsO_ENSP00000262407 ................................................................................
hsO_ENSP00000380227 ................................................................................
hsO_ENSP00000393844 ................................................................................
hsO_ENSP00000452120 ................................................................................
hsO_ENSP00000257879 ................................................................................
hsO_ENSP00000377776 ................................................................................
hsO_ENSP00000377777 ................................................................................
hsO_ENSP00000452387 ................................................................................
hsO_ENSP00000257880 ................................................................................
hsO_ENSP00000407801 ................................................................................
hsO_ENSP00000441691 ................................................................................
hsO_ENSP00000287497 ................................................................................
hsO_ENSP00000452786 ................................................................................
hsO_ENSP00000456711 ................................................................................
hsO_ENSP00000282588 ................................................................................
hsO_ENSP00000233573 ................................................................................
hsO_ENSP00000386614 ................................................................................
hsO_ENSP00000264107 ................................................................................
hsO_ENSP00000341078 ................................................................................
hsO_ENSP00000386896 ................................................................................
hsO_ENSP00000394169 ................................................................................
hsO_ENSP00000364369 ................................................................................
hsO_ENSP00000264106 ................................................................................
hsO_ENSP00000406694 ................................................................................
hsO_ENSP00000293379 ................................................................................
hsO_ENSP00000388435 vn..............................................................................
hsO_ENSP00000389442 ................................................................................
hsO_ENSP00000418367 ................................................................................
hsO_ENSP00000327290 nravllssgqelcerinfhvl...........................................................
hsO_ENSP00000403392 nravllssgqelcerinfhvl...........................................................
hsO_ENSP00000477446 ................................................................................
hsO_ENSP00000264741 q...............................................................................
hsO_ENSP00000268296 ................................................................................
hsO_ENSP00000454623 ................................................................................
hsO_ENSP00000296181 ................................................................................
hsO_ENSP00000343009 ................................................................................
hsO_ENSP00000373854 tltr............................................................................
hsO_ENSP00000373854 ................................................................................
hsO_ENSP00000441691 nstrrq..........................................................................
hsO_ENSP00000287497 nstrrq..........................................................................
hsO_ENSP00000268296 ................................................................................
hsO_ENSP00000454623 ................................................................................
hsO_ENSP00000380227 vvqldcsigyiyvdhlsridisflldvssl..................................................
hsO_ENSP00000263087 ................................................................................
hsO_ENSP00000397258 ................................................................................
hsO_ENSP00000264741 ................................................................................
hsO_ENSP00000386614 ................................................................................
hsO_ENSP00000264107 ................................................................................
hsO_ENSP00000341078 ................................................................................
hsO_ENSP00000386896 ................................................................................
hsO_ENSP00000394169 ................................................................................
hsO_ENSP00000364369 ................................................................................
hsO_ENSP00000264106 ................................................................................
hsO_ENSP00000406694 ................................................................................
hsO_ENSP00000380227 chfenyqrvcaleqqksamqtlkgivrflsktdkrllycikadphclnflcnfg..........................
hsO_ENSP00000467269 ................................................................................
hsO_ENSP00000439894 ................................................................................
hsO_ENSP00000462836 ................................................................................
hsO_ENSP00000440011 ................................................................................
hsO_ENSP00000462258 ................................................................................
hsO_ENSP00000358310 ................................................................................
hsO_ENSP00000462898 ................................................................................
hsO_ENSP00000315190 ................................................................................
hsO_ENSP00000007722 ................................................................................
hsO_ENSP00000422145 ksvacdvgypa.....................................................................
hsO_ENSP00000296585 ksvacdvgypa.....................................................................
hsO_ENSP00000345501 ................................................................................
hsO_ENSP00000455374 ................................................................................
hsO_ENSP00000267082 ................................................................................
hsO_ENSP00000408741 ................................................................................
hsO_ENSP00000350886 ................................................................................
hsO_ENSP00000349252 ................................................................................
hsO_ENSP00000439894 ................................................................................
hsO_ENSP00000462836 ................................................................................
hsO_ENSP00000440011 ................................................................................
hsO_ENSP00000462258 ................................................................................
hsO_ENSP00000358310 ................................................................................
hsO_ENSP00000462898 ................................................................................
hsO_ENSP00000386828 ................................................................................
hsO_ENSP00000393844 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000408024 ................................................................................
hsO_ENSP00000283249 ................................................................................
hsO_ENSP00000386367 ................................................................................
hsO_ENSP00000257879 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000377776 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000377777 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000452120 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000343009 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000257880 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000452387 slhysgvraldpaekplclsnenashv.....................................................
hsO_ENSP00000282588 ................................................................................
hsO_ENSP00000303351 ................................................................................
hsO_ENSP00000379350 ................................................................................
hsO_ENSP00000364094 ................................................................................
hsO_ENSP00000388694 ................................................................................
hsO_ENSP00000315190 ................................................................................
hsO_ENSP00000007722 ................................................................................
hsO_ENSP00000327290 lqfa............................................................................
hsO_ENSP00000403392 lqfa............................................................................
hsO_ENSP00000350886 ................................................................................
hsO_ENSP00000349252 elrrniav........................................................................
hsO_ENSP00000441561 ................................................................................
hsO_ENSP00000222573 ................................................................................
hsO_ENSP00000426142 ................................................................................
hsO_ENSP00000282588 senancrphife....................................................................
hsO_ENSP00000467977 ................................................................................
hsO_ENSP00000424397 ................................................................................
hsO_ENSP00000422145 ................................................................................
hsO_ENSP00000296585 ................................................................................
hsO_ENSP00000380952 ................................................................................
hsO_ENSP00000303242 ................................................................................
hsO_ENSP00000347279 ................................................................................
hsO_ENSP00000380948 ................................................................................
hsO_ENSP00000380950 ................................................................................
hsO_ENSP00000380955 ................................................................................
hsO_ENSP00000420814 ................................................................................
hsO_ENSP00000264741 ................................................................................
hsO_ENSP00000403392 yrptpveedlrrapqlnhsnsdvvsin.....................................................
hsO_ENSP00000327290 rptpveedlrrapqlnhsnsdvvsinc.....................................................
hsO_ENSP00000268296 ................................................................................
hsO_ENSP00000454623 ................................................................................
hsO_ENSP00000439894 ................................................................................
hsO_ENSP00000462836 ................................................................................
hsO_ENSP00000440011 ................................................................................
hsO_ENSP00000462258 ................................................................................
hsO_ENSP00000358310 ................................................................................
hsO_ENSP00000462898 ................................................................................
hsO_ENSP00000450693 ................................................................................
hsO_ENSP00000287497 ................................................................................
hsO_ENSP00000441691 ................................................................................
hsO_ENSP00000461626 ................................................................................
hsO_ENSP00000373854 ................................................................................
hsO_ENSP00000263087 ................................................................................
hsO_ENSP00000386828 ................................................................................
hsO_ENSP00000408024 ................................................................................
hsO_ENSP00000283249 ................................................................................
hsO_ENSP00000386367 ................................................................................
hsO_ENSP00000450267 ................................................................................


                                  10        20        30        40        50              60        
                                   |         |         |         |         |               |        
d1tyeb1             ......VSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQXVELEVRDLP......EELSLSFNA
hsO_ENSP00000364042 ......-----------------------------------------------A-----------......---------
hsO_ENSP00000404291 ......-----------------------------------------------A-----------......---------
hsO_ENSP00000261023 ......-----------------------------------------------A-----------......---------
hsO_ENSP00000367316 ......------------------------------------------------N----------......---------
hsO_ENSP00000262407 ......---------------H-------------------------------------------......---------
hsO_ENSP00000386614 ......-----------------------------------------------------------......--L------
hsO_ENSP00000264107 ......-----------------------------------------------------------......--L------
hsO_ENSP00000394169 ......-----------------------------------------------------------......--L------
hsO_ENSP00000341078 ......-----------------------------------------------------------......--L------
hsO_ENSP00000386896 ......-----------------------------------------------------------......--L------
hsO_ENSP00000364369 ......-----------------------------------------------------------......--L------
hsO_ENSP00000264106 ......-----------------------------------------------------------......--L------
hsO_ENSP00000406694 ......-----------------------------------------------------------......--L------
hsO_ENSP00000340536 ......-----------------------------K-----------------------------......---------
hsO_ENSP00000293379 ......-----------------------------------------------------------......---------
hsO_ENSP00000393844 ......-----------------------------------------------------------......---------
hsO_ENSP00000343009 ......-----------------------------------------------------------......---------
hsO_ENSP00000377776 ......-----------------------------------------------------------......---------
hsO_ENSP00000377777 ......-----------------------------------------------------------......---------
hsO_ENSP00000452120 ......-----------------------------------------------------------......---------
hsO_ENSP00000257879 ......-----------------------------------------------------------......---------
hsO_ENSP00000257880 ......-----------------------------------------------------------......---------
hsO_ENSP00000452387 ......-----------------------------------------------------------......---------
hsO_ENSP00000364042 ......------------------------------------P----------------------......---------
hsO_ENSP00000404291 ......------------------------------------P----------------------......---------
hsO_ENSP00000261023 ......------------------------------------P----------------------......---------
hsO_ENSP00000367316 ......-----------------------------------KSHQCQDFIVYLRDETEFRDKLSP......INISLNY--
hsO_ENSP00000315190 pdapvv-----------------------------------------------------------......--TNVTVKA
hsO_ENSP00000007722 pdapvv-----------------------------------------------------------......--TNVTVKA
hsO_ENSP00000293379 ......-----------------------------------------------------------......---------
hsO_ENSP00000296585 ......-----------------------------------------------------------......---------
hsO_ENSP00000367316 ......-----------------------------------------------------------......---------
hsO_ENSP00000404291 ......-------------D---------------------------------------------......---------
hsO_ENSP00000364042 ......-------------D---------------------------------------------......---------
hsO_ENSP00000261023 ......-------------D---------------------------------------------......---------
hsO_ENSP00000340536 ......-----------------------------------E-----------------------......---------
hsO_ENSP00000262407 ......-----------------------------------E-----------------------......---------
hsO_ENSP00000340536 ......-----------------------------------------------------------......---------
hsO_ENSP00000262407 ......-----------------------------------------------------------......---------
hsO_ENSP00000380227 ......----------------------V------------------------------------......---------
hsO_ENSP00000393844 ......---------------------------------------------D-------------......---------
hsO_ENSP00000452120 ......---------------------------------------------D-------------......---------
hsO_ENSP00000257879 ......---------------------------------------------D-------------......---------
hsO_ENSP00000377776 ......---------------------------------------------D-------------......---------
hsO_ENSP00000377777 ......---------------------------------------------D-------------......---------
hsO_ENSP00000452387 ......---------------------------------------------D-------------......---------
hsO_ENSP00000257880 ......---------------------------------------------D-------------......---------
hsO_ENSP00000407801 ......----------------------------------------------IRSKVELEVRDLP......EELSLSFNA
hsO_ENSP00000441691 ......--------------------T--------------------------------------......---------
hsO_ENSP00000287497 ......--------------------T--------------------------------------......---------
hsO_ENSP00000452786 ......----------------------------------------------IRSKVELEVRDLP......EELSLSFNA
hsO_ENSP00000456711 ......----------------------------------------------IRSKVELEVRDLP......EELSLSFNA
hsO_ENSP00000282588 ......-----------------------------------------------------------......---------
hsO_ENSP00000233573 ......-------------------T---------------------------------------......---------
hsO_ENSP00000386614 ......-----------------------------------------------------------......---------
hsO_ENSP00000264107 ......-----------------------------------------------------------......---------
hsO_ENSP00000341078 ......-----------------------------------------------------------......---------
hsO_ENSP00000386896 ......-----------------------------------------------------------......---------
hsO_ENSP00000394169 ......-----------------------------------------------------------......---------
hsO_ENSP00000364369 ......-----------------------------------------------------------......---------
hsO_ENSP00000264106 ......-----------------------------------------------------------......---------
hsO_ENSP00000406694 ......-----------------------------------------------------------......---------
hsO_ENSP00000293379 ......-----------------------------------------------------------......---------
hsO_ENSP00000388435 ......-----------------------------------------------------------......---------
hsO_ENSP00000389442 ......-----------------------------------------------------------......---S-----
hsO_ENSP00000418367 ......-----------------------------------------------RSKVELSVWDQP......EDLNLFFTA
hsO_ENSP00000327290 ......-----------------------------------------------------DTADYV......KPVTFSVEY
hsO_ENSP00000403392 ......-----------------------------------------------------DTADYV......KPVTFSVEY
hsO_ENSP00000477446 ......-----------------------------------------------RSKVELSVWDQP......EDLNLFFTA
hsO_ENSP00000264741 ......---------------------------------------------------------V-......---------
hsO_ENSP00000268296 ......--------------------------------------E--------------------......---------
hsO_ENSP00000454623 ......--------------------------------------E--------------------......---------
hsO_ENSP00000296181 ......-----------------------------------------------RSKVELSVWDQP......EDLNLFFTA
hsO_ENSP00000343009 ......-----------------------------------------------------------......---------
hsO_ENSP00000373854 ......-----------------------------------------------R-----------......---------
hsO_ENSP00000373854 ......-----------------------------------------------------------......---------
hsO_ENSP00000441691 ......-----------------------------------------------------------......---------
hsO_ENSP00000287497 ......-----------------------------------------------------------......---------
hsO_ENSP00000268296 ......---------------------------------------SYGTTITFSHPAGLSYRYV-......--------A
hsO_ENSP00000454623 ......---------------------------------------SYGTTITFSHPAGLSYRYV-......--------A
hsO_ENSP00000380227 ......-------------------------------------------------------SRAE......EDLSITVHA
hsO_ENSP00000263087 ......-----------------------------------------------------------......---------
hsO_ENSP00000397258 ......------------------------------------------------------M----......---------
hsO_ENSP00000264741 ......--------------------------------------------------E--------......---------
hsO_ENSP00000386614 ......-----------------------------------------------------------......---------
hsO_ENSP00000264107 ......-----------------------------------------------------------......---------
hsO_ENSP00000341078 ......-----------------------------------------------------------......---------
hsO_ENSP00000386896 ......-----------------------------------------------------------......---------
hsO_ENSP00000394169 ......-----------------------------------------------------------......---------
hsO_ENSP00000364369 ......-----------------------------------------------------------......---------
hsO_ENSP00000264106 ......-----------------------------------------------------------......---------
hsO_ENSP00000406694 ......-----------------------------------------------------------......---------
hsO_ENSP00000380227 ......-----------------------------------------------------------......---------
hsO_ENSP00000467269 ......----------------------------------------------I------------......---------
hsO_ENSP00000439894 ......----------------A------------------------------------------......---------
hsO_ENSP00000462836 ......----------------A------------------------------------------......---------
hsO_ENSP00000440011 ......----------------A------------------------------------------......---------
hsO_ENSP00000462258 ......----------------A------------------------------------------......---------
hsO_ENSP00000358310 ......----------------A------------------------------------------......---------
hsO_ENSP00000462898 ......----------------A------------------------------------------......---------
hsO_ENSP00000315190 ......-----------------------------------------------------------......---------
hsO_ENSP00000007722 ......-----------------------------------------------------------......---------
hsO_ENSP00000422145 ......-----------------------------------------------------------......---------
hsO_ENSP00000296585 ......-----------------------------------------------------------......---------
hsO_ENSP00000345501 ......-------------------------------------------------TVTLEHSSLP......PGVHISYES
hsO_ENSP00000455374 ......-------------------------------------------------TVTLEHSSLP......PGVHISYES
hsO_ENSP00000267082 ......-------------------------------------------------TVTLEHSSLP......PGVHISYES
hsO_ENSP00000408741 ......-------------------------------------------------TVTLEHSSLP......PGVHISYES
hsO_ENSP00000350886 ......-----------------------------------------------------------......---------
hsO_ENSP00000349252 ......-----------------------------------------------------------......---------
hsO_ENSP00000439894 ......-----------------------------------------------------------......---------
hsO_ENSP00000462836 ......-----------------------------------------------------------......---------
hsO_ENSP00000440011 ......-----------------------------------------------------------......---------
hsO_ENSP00000462258 ......-----------------------------------------------------------......---------
hsO_ENSP00000358310 ......-----------------------------------------------------------......---------
hsO_ENSP00000462898 ......-----------------------------------------------------------......---------
hsO_ENSP00000386828 ......--------------------------------------------------VELEVLGDT......EGLNLSFTA
hsO_ENSP00000393844 ......-----------------------------------------------------------......---------
hsO_ENSP00000408024 ......--------------------------------------------------VELEVLGDT......EGLNLSFTA
hsO_ENSP00000283249 ......--------------------------------------------------VELEVLGDT......EGLNLSFTA
hsO_ENSP00000386367 ......--------------------------------------------------VELEVLGDT......EGLNLSFTA
hsO_ENSP00000257879 ......-----------------------------------------------------------......---------
hsO_ENSP00000377776 ......-----------------------------------------------------------......---------
hsO_ENSP00000377777 ......-----------------------------------------------------------......---------
hsO_ENSP00000452120 ......-----------------------------------------------------------......---------
hsO_ENSP00000343009 ......-----------------------------------------------------------......---------
hsO_ENSP00000257880 ......-----------------------------------------------------------......---------
hsO_ENSP00000452387 ......-----------------------------------------------------------......---------
hsO_ENSP00000282588 ......----------------------IVRSQNDKFNVSLTVKNTKDSAYNTRTIVHYSPNLVF......SGIEAIQKD
hsO_ENSP00000303351 ......-------------------------------------------QLIIDAYNSLSSEVILengklsEGVTISYKS
hsO_ENSP00000379350 ......-------------------------------------------QLIIDAYNSLSSEVILengklsEGVTISYKS
hsO_ENSP00000364094 ......-------------------------------------------QLIIDAYNSLSSEVILengklsEGVTISYKS
hsO_ENSP00000388694 ......-------------------------------------------QLIIDAYNSLSSEVILengklsEGVTISYKS
hsO_ENSP00000315190 ......---------------------------------------A-------------------......---------
hsO_ENSP00000007722 ......---------------------------------------A-------------------......---------
hsO_ENSP00000327290 ......--------------------------------------------------------S--......---------
hsO_ENSP00000403392 ......--------------------------------------------------------S--......---------
hsO_ENSP00000350886 ......-------------------------------------G---------------------......---------
hsO_ENSP00000349252 ......-----------------------------------------------------T-----......---------
hsO_ENSP00000441561 ......---------------------------------------------------KVQVENQV......QGIYFNITA
hsO_ENSP00000222573 ......---------------------------------------------------KVQVENQV......QGIYFNITA
hsO_ENSP00000426142 ......-----------------------------------------------------------......---------
hsO_ENSP00000282588 ......--------------------------D--------------------------------......---------
hsO_ENSP00000467977 ......--------------------------------------------L--------------......---------
hsO_ENSP00000424397 ......-----------------------------------------------------------......---------
hsO_ENSP00000422145 ......-----------------------------------------------------------......---------
hsO_ENSP00000296585 ......-----------------------------------------------------------......---------
hsO_ENSP00000380952 ......------------------------------------------------SRVFLDHNALP......DTLKVTYDS
hsO_ENSP00000303242 ......------------------------------------------------SRVFLDHNALP......DTLKVTYDS
hsO_ENSP00000347279 ......------------------------------------------------SRVFLDHNALP......DTLKVTYDS
hsO_ENSP00000380948 ......------------------------------------------------SRVFLDHNALP......DTLKVTYDS
hsO_ENSP00000380950 ......------------------------------------------------SRVFLDHNALP......DTLKVTYDS
hsO_ENSP00000380955 ......------------------------------------------------SRVFLDHNALP......DTLKVTYDS
hsO_ENSP00000420814 ......-----------------------------------------------------------......---------
hsO_ENSP00000264741 ......-----------------------------------------------------------......---------
hsO_ENSP00000403392 ......------------------------------C----------------------------......---------
hsO_ENSP00000327290 ......-------------------------------N---------------------------......---------
hsO_ENSP00000268296 ......--------------------------------------------INFWVPVELNQEAVW......MDVEVSHP-
hsO_ENSP00000454623 ......--------------------------------------------INFWVPVELNQEAVW......MDVEVSHP-
hsO_ENSP00000439894 ......-----------------------------E-----------------------------......---------
hsO_ENSP00000462836 ......-----------------------------E-----------------------------......---------
hsO_ENSP00000440011 ......-----------------------------E-----------------------------......---------
hsO_ENSP00000462258 ......-----------------------------E-----------------------------......---------
hsO_ENSP00000358310 ......-----------------------------E-----------------------------......---------
hsO_ENSP00000462898 ......-----------------------------E-----------------------------......---------
hsO_ENSP00000450693 ......--------------------------------------------------------Q--......---------
hsO_ENSP00000287497 ......-----------------------------------------------------------......--FSENLSS
hsO_ENSP00000441691 ......-----------------------------------------------------------......--FSENLSS
hsO_ENSP00000461626 ......----------------------------------------------IRSKVELEVRDLP......EELSLSFNA
hsO_ENSP00000373854 ......--------------------------------------------T--------------......---------
hsO_ENSP00000263087 ......-----------------------------------------------------------......---------
hsO_ENSP00000386828 ......---VEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYl.....MDLSASMDD
hsO_ENSP00000408024 ......---VEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYl.....MDLSASMDD
hsO_ENSP00000283249 ......---VEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYl.....MDLSASMDD
hsO_ENSP00000386367 ......---VEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYl.....MDLSASMDD
hsO_ENSP00000450267 ......---------------------------------R-------------------------......---------


                    70            80        90       100        110        120       130            
                     |             |         |         |          |          |         |            
d1tyeb1             TCLNNEVIP....GLKSCMGLKIGDTVSFSIEAKVRGCPQE.KEKSF.TIKPVGFKDSLIVQVTFDCDCACQAQ......
hsO_ENSP00000364042 ---------....----------------------------.-----.--------------------------qclkiv
hsO_ENSP00000404291 ---------....----------------------------.-----.--------------------------qclkiv
hsO_ENSP00000261023 ---------....----------------------------.-----.--------------------------qclkiv
hsO_ENSP00000367316 ---------....----------------------------.-----.--------------------------stiphl
hsO_ENSP00000262407 ---------....----------------------------.-----.--------------------------hkrdrr
hsO_ENSP00000386614 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000264107 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000394169 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000341078 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000386896 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000364369 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000264106 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000406694 ---------....----------------------------.-----.--------------------------ncsvnv
hsO_ENSP00000340536 ---------....----------------------------.-----.--------------------------vdwglp
hsO_ENSP00000293379 ---------....----------------------------.-----.-------E------------------ldpegs
hsO_ENSP00000393844 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000343009 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000377776 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000377777 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000452120 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000257879 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000257880 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000452387 ---------....--------------------------L-.-----.--------------------------rtlgsa
hsO_ENSP00000364042 ---------....----------------------------.-----.--------------------------shsknm
hsO_ENSP00000404291 ---------....----------------------------.-----.--------------------------shsknm
hsO_ENSP00000261023 ---------....----------------------------.-----.--------------------------shsknm
hsO_ENSP00000367316 ---------....----------------------------.-----.--------------------------sldest
hsO_ENSP00000315190 RVWNSTFIE....DYRDFDRVRV------------------.-----.--------------------------ngwatl
hsO_ENSP00000007722 RVWNSTFIE....DYRDFDRVRV------------------.-----.--------------------------ngwatl
hsO_ENSP00000293379 ---------....----------------------D-----.-----.--------------------------wqkqkg
hsO_ENSP00000296585 ---------....----------G-----------------.-----.--------------------------qtsssv
hsO_ENSP00000367316 ---------....------P---------------------.-----.--------------------------rlektn
hsO_ENSP00000404291 ---------....----------------------------.-----.--------------------------lgnpmk
hsO_ENSP00000364042 ---------....----------------------------.-----.--------------------------lgnpmk
hsO_ENSP00000261023 ---------....----------------------------.-----.--------------------------lgnpmk
hsO_ENSP00000340536 ---------....----------------------------.-----.--------------------------agesvs
hsO_ENSP00000262407 ---------....----------------------------.-----.--------------------------agesvs
hsO_ENSP00000340536 ---------....-------------------L--------.-----.--------------------------qldrqk
hsO_ENSP00000262407 ---------....-------------------L--------.-----.--------------------------qldrqk
hsO_ENSP00000380227 ---------....----------------------------.-----.--------------------------itgsiq
hsO_ENSP00000393844 ---------....----------------------------.-----.--------------------------adtdrr
hsO_ENSP00000452120 ---------....----------------------------.-----.--------------------------adtdrr
hsO_ENSP00000257879 ---------....----------------------------.-----.--------------------------adtdrr
hsO_ENSP00000377776 ---------....----------------------------.-----.--------------------------adtdrr
hsO_ENSP00000377777 ---------....----------------------------.-----.--------------------------adtdrr
hsO_ENSP00000452387 ---------....----------------------------.-----.--------------------------adtdrr
hsO_ENSP00000257880 ---------....----------------------------.-----.--------------------------adtdrr
hsO_ENSP00000407801 TCLNNEVIP....GLKSCMGLKIGDTVSFSIEAKVRGCPQE.KEKSF.TIKPVGFKDSLIVQVTFDCDCACQAQ......
hsO_ENSP00000441691 ---------....----------------------------.-----.--------------------------qvtfff
hsO_ENSP00000287497 ---------....----------------------------.-----.--------------------------qvtfff
hsO_ENSP00000452786 TCLNNEVIP....GLKSCMGLKIGDTVSFSIEAKVRGCPQE.KEKSF.TIKPVGFKDSLIVQVTFDCDCACQAQ......
hsO_ENSP00000456711 TCLNNEVIP....GLKSCMGLKIGDTVSFSIEAKVRGCPQE.KEKSF.TIKPVGFKDSLIVQVTFDCDCACQAQ......
hsO_ENSP00000282588 ---------....---------INATVCFDVK---------.-----.--------------------------lksked
hsO_ENSP00000233573 ---------....----------------------------.-----.--------------------------sdvitg
hsO_ENSP00000386614 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000264107 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000341078 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000386896 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000394169 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000364369 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000264106 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000406694 ---------....-----------------ICLQVKSCF--.---EY.TANPAGYNPSISI-------------vgtlea
hsO_ENSP00000293379 ---------....---------------LNLTFHAQNV---.-----.--------------------------geggay
hsO_ENSP00000388435 -C-------....----------------------------.-----.--------------------------vnircp
hsO_ENSP00000389442 ---------....----------------------------.-----.--------------------------llwtet
hsO_ENSP00000418367 TCQDGVSYP....GQRKCEGLKIGDTASFEVSLEARSCPSRhTEHVF.ALRPVGFRDSLEVGVTYNCTCGCS--......
hsO_ENSP00000327290 SLEDPD---....----------------------------.-----.--------------------------hgpmld
hsO_ENSP00000403392 SLEDPD---....----------------------------.-----.--------------------------hgpmld
hsO_ENSP00000477446 TCQDGVSYP....GQRKCEGLKIGDTASFEVSLEARSCPSRhTEHVF.ALRPVGFRDSLEVGVTYNCTCGCS--......
hsO_ENSP00000264741 ---------....----------------------------.-----.--------------------------teklql
hsO_ENSP00000268296 ---------....----------------------------.-----.--------------------------tknrsl
hsO_ENSP00000454623 ---------....----------------------------.-----.--------------------------tknrsl
hsO_ENSP00000296181 TCQDGVSYP....GQRKCEGLKIGDTASFEVSLEARSCPSRhTEHVF.ALRPVGFRDSLEVGVTYNCTCGCS--......
hsO_ENSP00000343009 ----D----....----------------------------.-----.--------------------------tdrrlr
hsO_ENSP00000373854 ---------....----------------------------.-----.--------------------------ktlglg
hsO_ENSP00000373854 ---------....----------------------------.-----.-----G--------------------lshrrv
hsO_ENSP00000441691 ----TQVLG....LTQTCETLK----------LQLPNCIE-.-----.--------------------------dpvspi
hsO_ENSP00000287497 ----TQVLG....LTQTCETLK----------LQLPNCIE-.-----.--------------------------dpvspi
hsO_ENSP00000268296 EGQKQGQLRs...LHLTCDSAPVGSQGTWSTSCRIN-----.-----.--------------------------hlifrg
hsO_ENSP00000454623 EGQKQGQLRs...LHLTCDSAPVGSQGTWSTSCRIN-----.-----.--------------------------hlifrg
hsO_ENSP00000380227 TCENEEEMD....NL--------------------------.-----.--------------------------khsrv.
hsO_ENSP00000263087 --------P....----------------------------.-----.--------------------------spniqc
hsO_ENSP00000397258 ---------....----------------------------.-----.--------------------------gqvtek
hsO_ENSP00000264741 ---------....----------------------------.-----.--------------------------emgisc
hsO_ENSP00000386614 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000264107 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000341078 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000386896 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000394169 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000364369 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000264106 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000406694 ---------....---D------------------------.-----.--------------------------aheakl
hsO_ENSP00000380227 ---------....------KMESGKEASVHIQLEGRPS---.-----.--------------------------ilemde
hsO_ENSP00000467269 ---------....----------------------------.-----.--------------------------hlpgqs
hsO_ENSP00000439894 ---------....----------------------------.-----.--------------------------afdgsg
hsO_ENSP00000462836 ---------....----------------------------.-----.--------------------------afdgsg
hsO_ENSP00000440011 ---------....----------------------------.-----.--------------------------afdgsg
hsO_ENSP00000462258 ---------....----------------------------.-----.--------------------------afdgsg
hsO_ENSP00000358310 ---------....----------------------------.-----.--------------------------afdgsg
hsO_ENSP00000462898 ---------....----------------------------.-----.--------------------------afdgsg
hsO_ENSP00000315190 ---------....R---------------------------.-----.--------------------------lrfags
hsO_ENSP00000007722 ---------....R---------------------------.-----.--------------------------lrfags
hsO_ENSP00000422145 ---------....-------LKREQQVTFTIN---------.-----.--------------------------fdfnlq
hsO_ENSP00000296585 ---------....-------LKREQQVTFTIN---------.-----.--------------------------fdfnlq
hsO_ENSP00000345501 QCEGPEKREgkaeDRGQCNHVRINQTVTFWVSLQATHCLPE.P-HLL.RLRALGFSEELIVELHTLCDCNCSDT......
hsO_ENSP00000455374 QCEGPEKREgkaeDRGQCNHVRINQTVTFWVSLQATHCLPE.P-HLL.RLRALGFSEELIVELHTLCDCNCSDT......
hsO_ENSP00000267082 QCEGPEKREgkaeDRGQCNHVRINQTVTFWVSLQATHCLPE.P-HLL.RLRALGFSEELIVELHTLCDCNCSDT......
hsO_ENSP00000408741 QCEGPEKREgkaeDRGQCNHVRINQTVTFWVSLQATHCLPE.P-HLL.RLRALGFSEELIVELHTLCDCNCSDT......
hsO_ENSP00000350886 ---------....-----RALRLTAFASLSVELSLSNLEED.A----.--------------------------ywvqld
hsO_ENSP00000349252 ---------....-----RALRLTAFASLSVELSLSNLEED.A----.--------------------------ywvqld
hsO_ENSP00000439894 --------P....----------------------------.-----.--------------------------qrespi
hsO_ENSP00000462836 --------P....----------------------------.-----.--------------------------qrespi
hsO_ENSP00000440011 --------P....----------------------------.-----.--------------------------qrespi
hsO_ENSP00000462258 --------P....----------------------------.-----.--------------------------qrespi
hsO_ENSP00000358310 --------P....----------------------------.-----.--------------------------qrespi
hsO_ENSP00000462898 --------P....----------------------------.-----.--------------------------qrespi
hsO_ENSP00000386828 ICNNGTLFQ....HQKKCSHMKVGDTASFSVTVNIPHCERR.-SRHI.IIKPVGLGDALELLVSPECNCDCQK-......
hsO_ENSP00000393844 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000408024 ICNNGTLFQ....HQKKCSHMKVGDTASFSVTVNIPHCERR.-SRHI.IIKPVGLGDALELLVSPECNCDCQK-......
hsO_ENSP00000283249 ICNNGTLFQ....HQKKCSHMKVGDTASFSVTVNIPHCERR.-SRHI.IIKPVGLGDALELLVSPECNCDCQK-......
hsO_ENSP00000386367 ICNNGTLFQ....HQKKCSHMKVGDTASFSVTVNIPHCERR.-SRHI.IIKPVGLGDALELLVSPECNCDCQK-......
hsO_ENSP00000257879 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000377776 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000377777 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000452120 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000343009 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000257880 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000452387 ---------....ECELGNPMKRGAQVTFYLILSTSG----.-----.--------------------------isiett
hsO_ENSP00000282588 SCESNHNIT....CKVGYPFLRRGEMVTFKILFQFN-----.-----.--------------------------tsylme
hsO_ENSP00000303351 YCKNGVNGTge..NGRKCSNISIGDEVQFEISITSNKCPKK.DSDSF.KIRPLGFTEEVEVILQYICECECQ--s.....
hsO_ENSP00000379350 YCKNGVNGTge..NGRKCSNISIGDEVQFEISITSNKCPKK.DSDSF.KIRPLGFTEEVEVILQYICECECQ--s.....
hsO_ENSP00000364094 YCKNGVNGTge..NGRKCSNISIGDEVQFEISITSNKCPKK.DSDSF.KIRPLGFTEEVEVILQYICECECQ--s.....
hsO_ENSP00000388694 YCKNGVNGTge..NGRKCSNISIGDEVQFEISITSNKCPKK.DSDSF.KIRPLGFTEEVEVILQYICECECQ--s.....
hsO_ENSP00000315190 ---------....----------------------------.-----.--------------------------cqanet
hsO_ENSP00000007722 ---------....----------------------------.-----.--------------------------cqanet
hsO_ENSP00000327290 ---------....----------------------------.-----.--------------------------liqked
hsO_ENSP00000403392 ---------....----------------------------.-----.--------------------------liqked
hsO_ENSP00000350886 ---------....----------------------------.-----.--------------------------lfpggr
hsO_ENSP00000349252 ---------....----------------------------.-----.--------------------------tsmsct
hsO_ENSP00000441561 ICPDGSRKP....GMEGCRNVTSNDEVLFNVTVTMKKCDVT.GGKNYaIIKPIGFNETAKIHIHRNCSCQCED-......
hsO_ENSP00000222573 ICPDGSRKP....GMEGCRNVTSNDEVLFNVTVTMKKCDVT.GGKNYaIIKPIGFNETAKIHIHRNCSCQCED-......
hsO_ENSP00000426142 ----N----....----------------------------.-----.--------------------------etifce
hsO_ENSP00000282588 ---------....----------------------------.-----.--------------------------pfsins
hsO_ENSP00000467977 ---------....----------------------------.-----.--------------------------tnsged
hsO_ENSP00000424397 ---------....---------------YNITLDADG----.-----.--------------------------fssrvt
hsO_ENSP00000422145 ---------....---------------YNITLDADG----.-----.--------------------------fssrvt
hsO_ENSP00000296585 ---------....---------------YNITLDADG----.-----.--------------------------fssrvt
hsO_ENSP00000380952 FCSNGVTHRnq..PRGDCDGVQINVPITFQVKVTATECIQE.--QSF.VIRALGFTDIVTVQVLPQCECRCRDQ......
hsO_ENSP00000303242 FCSNGVTHRnq..PRGDCDGVQINVPITFQVKVTATECIQE.--QSF.VIRALGFTDIVTVQVLPQCECRCRDQ......
hsO_ENSP00000347279 FCSNGVTHRnq..PRGDCDGVQINVPITFQVKVTATECIQE.--QSF.VIRALGFTDIVTVQVLPQCECRCRDQ......
hsO_ENSP00000380948 FCSNGVTHRnq..PRGDCDGVQINVPITFQVKVTATECIQE.--QSF.VIRALGFTDIVTVQVLPQCECRCRDQ......
hsO_ENSP00000380950 FCSNGVTHRnq..PRGDCDGVQINVPITFQVKVTATECIQE.--QSF.VIRALGFTDIVTVQVLPQCECRCRDQ......
hsO_ENSP00000380955 FCSNGVTHRnq..PRGDCDGVQINVPITFQVKVTATECIQE.--QSF.VIRALGFTDIVTVQVLPQCECRCRDQ......
hsO_ENSP00000420814 ---------....-------------ASFEVSLEARSCPSRhTEHVF.ALRPVGFRDSLEVGVTYNCTCGCS--......
hsO_ENSP00000264741 ------A--....----------------------------.-----.--------------------------emfhvq
hsO_ENSP00000403392 ---------....----------------------------.-----.--------------------------nirlvp
hsO_ENSP00000327290 ---------....----------------------------.-----.--------------------------irlvpn
hsO_ENSP00000268296 ---------....----------------------------.-----.--------------------------qnpslr
hsO_ENSP00000454623 ---------....----------------------------.-----.--------------------------qnpslr
hsO_ENSP00000439894 ---------....----------------------------.-----.--------------------------lqhtnr
hsO_ENSP00000462836 ---------....----------------------------.-----.--------------------------lqhtnr
hsO_ENSP00000440011 ---------....----------------------------.-----.--------------------------lqhtnr
hsO_ENSP00000462258 ---------....----------------------------.-----.--------------------------lqhtnr
hsO_ENSP00000358310 ---------....----------------------------.-----.--------------------------lqhtnr
hsO_ENSP00000462898 ---------....----------------------------.-----.--------------------------lqhtnr
hsO_ENSP00000450693 ---------....----------------------------.-----.--------------------------glppva
hsO_ENSP00000287497 TCHTKERLP....----------------------------.-----.--------------------------shsdfl
hsO_ENSP00000441691 TCHTKERLP....----------------------------.-----.--------------------------shsdfl
hsO_ENSP00000461626 TCLNNEVIP....GLKSCMGLKIGDTVR-------------.-----.--------------------------w.....
hsO_ENSP00000373854 ---------....----------------------------.-----.--------------------------qisrsp
hsO_ENSP00000263087 ---------....----------------------------.-----.---PIGFNGVVNVRLC----------feissv
hsO_ENSP00000386828 DLN------....----------------------------.-----.--------------------------tikel.
hsO_ENSP00000408024 DLN------....----------------------------.-----.--------------------------tikel.
hsO_ENSP00000283249 DLN------....----------------------------.-----.--------------------------tikel.
hsO_ENSP00000386367 DLN------....----------------------------.-----.--------------------------tikel.
hsO_ENSP00000450267 ---------....----------------------------.-----.--------------------------qlpqke


                                                                                                    
                                                                                                    
d1tyeb1             ................................................................................
hsO_ENSP00000364042 cqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiqpapmpvp
hsO_ENSP00000404291 cqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiqpapmpvp
hsO_ENSP00000261023 cqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiqpapmpvp
hsO_ENSP00000367316 vrkrdvhvvefhrqspakilnctnieclqiscavgrleggesavlkvrsrlwahtflqrkndpyalaslvsfevkkmpyt
hsO_ENSP00000262407 qiflpepeqpsrlqdpvlvscdsapctvvqcdlqemargqramvtvlaflwlpslyqrpldqfvlqshawfnvsslpyav
hsO_ENSP00000386614 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000264107 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000394169 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000341078 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000386896 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000364369 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000264106 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000406694 ncvnircplrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysg
hsO_ENSP00000340536 ipspspihpahhkrdrrqiflpepeqpsrlqdpvlvscdsapctvvqcdlqemargqramvtvlaflwlpslyqvwtqll
hsO_ENSP00000293379 lhhqqkreapsrssassgpqilkcpeaecfrlrcelgplhqqesqslqlhfrvwaktflqrehqpfslqceavykalkmp
hsO_ENSP00000393844 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000343009 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000377776 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000377777 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000452120 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000257879 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000257880 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000452387 flnimwpheiangkwllypmqveleggqgpgqkglcsprpnilhldvdsrdrrrreleppeqqepgerqepsmswwpvss
hsO_ENSP00000364042 tisrgglmqceeliaylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcge.......
hsO_ENSP00000404291 tisrgglmqceeliaylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcge.......
hsO_ENSP00000261023 tisrgglmqceeliaylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcge.......
hsO_ENSP00000367316 fkeglevkpilnyyrenivseqahilvdcge.................................................
hsO_ENSP00000315190 flrtsiptinmenkttwfsvdidselveelpaeielwlv.........................................
hsO_ENSP00000007722 flrtsiptinmenkttwfsvdidselveelpaeielwlv.........................................
hsO_ENSP00000293379 gvrralflasrqatltqtlliqngaredcremkiylrnesefrdklspihialnfsldpqapvdshglrpalhyqsksri
hsO_ENSP00000296585 sfksenfrhtkelncrtascsnvtcwlkdvhmkgeyfvnvttriwngtfasstfqtvqltaaaeintynpeiyviedntv
hsO_ENSP00000367316 msinfdlqirssnkdnpdsnfvslq.......................................................
hsO_ENSP00000404291 agtqllaglrfsvhqqsemdtsvkfdlqiqssnlfdkvspvvs.....................................
hsO_ENSP00000364042 agtqllaglrfsvhqqsemdtsvkfdlqiqssnlfdkvspvvs.....................................
hsO_ENSP00000261023 agtqllaglrfsvhqqsemdtsvkfdlqiqssnlfdkvspvvs.....................................
hsO_ENSP00000340536 fqlqirsknsqnpnskivll............................................................
hsO_ENSP00000262407 fqlqirsknsqnpnskivll............................................................
hsO_ENSP00000340536 prqgrrvlllgsqqagttlnldlggkhspichttmaflrdeadfrdklspivlslnvslppteagmapavvlhgdthvqe
hsO_ENSP00000262407 prqgrrvlllgsqqagttlnldlggkhspichttmaflrdeadfrdklspivlslnvslppteagmapavvlhgdthvqe
hsO_ENSP00000380227 vssreancrthqafmrkdvrdiltpiqieaayhlgphviskrsteefpplqpilqqkkekdimkktinfarfc.......
hsO_ENSP00000393844 lrgqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppva
hsO_ENSP00000452120 lrgqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppva
hsO_ENSP00000257879 lrgqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppva
hsO_ENSP00000377776 lrgqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppva
hsO_ENSP00000377777 lrgqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppva
hsO_ENSP00000452387 lrgqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppva
hsO_ENSP00000257880 lrgqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppva
hsO_ENSP00000407801 ................................................................................
hsO_ENSP00000441691 pldlsyrkvstlqnqrsqrswrlacesasstevsgalkstscsinhpifpensevtfnitfdvdskaslgnklllkanvt
hsO_ENSP00000287497 pldlsyrkvstlqnqrsqrswrlacesasstevsgalkstscsinhpifpensevtfnitfdvdskaslgnklllkanvt
hsO_ENSP00000452786 ................................................................................
hsO_ENSP00000456711 ................................................................................
hsO_ENSP00000282588 tiyeadlqyrvtldslrqisrsffsgtqerkvqrnitvrksectkhsfymldkhdfqdsvritldfnltdpengpvldds
hsO_ENSP00000233573 siqvssreancrthqafmrkdvrdiltpiqieaayhlgphviskrsteefpplqpilqqkkek.................
hsO_ENSP00000386614 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000264107 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000341078 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000386896 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000394169 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000364369 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000264106 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000406694 ekerrksglssrvqfrnqgsepkytqeltlkrqkqkvcmeetlwlqdnirdklrpipitasveiqepssrrrvnslpevl
hsO_ENSP00000293379 eaelrvtappeaeysglvrhpgnfsslscdyfavnqsrllvcdlgnpmkagaslwgglrftvphlrdtkktiqfdfqils
hsO_ENSP00000388435 lrgldskaslilrsrlwnstfleeysklnyldilmrafidvtaaaenirlpnagtqvrvtvfpsktvaqysgvpwwii..
hsO_ENSP00000389442 fmnkenqnhsyslkssasfnviefpyknlpieditnstlvsh......................................
hsO_ENSP00000418367 ................................................................................
hsO_ENSP00000327290 dgwpttlrvsvpfwngcne.............................................................
hsO_ENSP00000403392 dgwpttlrvsvpfwngcne.............................................................
hsO_ENSP00000477446 ................................................................................
hsO_ENSP00000264741 tymeetcrhyvahvkrrvqdvispivfeaayslsehvtgeeerelppltpvlrwkkgqkiaqknqtvfernc........
hsO_ENSP00000268296 srvrvlglkahcenfnlllpscvedsvtpitlrlnftlvgkpllafrnlrpmlaadaqryftaslpfekncg........
hsO_ENSP00000454623 srvrvlglkahcenfnlllpscvedsvtpitlrlnftlvgkpllafrnlrpmlaadaqryftaslpfekncg........
hsO_ENSP00000296181 ................................................................................
hsO_ENSP00000343009 gqvprvtflsrnleepkhqasgtvwlkhqhdrvcgdamfqlqenvkdklraivvtlsyslqtprlrrqapgqglppvapi
hsO_ENSP00000373854 ihcetlklllpdcvedvvspiilhlnfslvrepipspqnlrpvlavgsqdlftaslpfekncg.................
hsO_ENSP00000373854 sgaqkqphqsalrlacetvptedeglrssrcsvnhpifhegsngtfivtfdvsykatlgdrmlmrasassennkassska
hsO_ENSP00000441691 vlrlnfslvgtplsafgnlrpvlaedaqrlftalfpfekncgn.....................................
hsO_ENSP00000287497 vlrlnfslvgtplsafgnlrpvlaedaqrlftalfpfekncgn.....................................
hsO_ENSP00000268296 gaqitflatfdvspkavlgdrllltanvssenntprtskttfqlelp.................................
hsO_ENSP00000454623 gaqitflatfdvspkavlgdrllltanvssenntprtskttfqlelp.................................
hsO_ENSP00000380227 ................................................................................
hsO_ENSP00000263087 ddpqpvasvlimncrighpvlkrssahvsvvwqleenafpnrtaditvtvtnsnerrslanethtlq.............
hsO_ENSP00000397258 lqltymeetcrhyvahvkrrvqdvispivfeaayslsehvtgeeerelppltpvlrwkkgq...................
hsO_ENSP00000264741 ellesdflkcsvgfpfmrskskyefsvifdtshlsgeeevlsfivtaqsgnterseslhdntlvlm..............
hsO_ENSP00000386614 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000264107 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000341078 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000386896 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000394169 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000364369 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000264106 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000406694 iatfpdtltysayrelrafpekqlscvanqngsqadcelgnpfkrnsnvtfylvlsttevtfdtpdldinlklettsnqd
hsO_ENSP00000380227 tsalkfeiratgfpepnprvielnkdenva..................................................
hsO_ENSP00000467269 qpsdllyildiqpqgglqcfpqppvnplkvgffkrnrpp.........................................
hsO_ENSP00000439894 qrlsprrlrlsvgnvtceqlhfhvldtsdylrpvaltvtfaldnttkpgpvlnegsptsiqklvpfskdcgp........
hsO_ENSP00000462836 qrlsprrlrlsvgnvtceqlhfhvldtsdylrpvaltvtfaldnttkpgpvlnegsptsiqklvpfskdcgp........
hsO_ENSP00000440011 qrlsprrlrlsvgnvtceqlhfhvldtsdylrpvaltvtfaldnttkpgpvlnegsptsiqklvpfskdcgp........
hsO_ENSP00000462258 qrlsprrlrlsvgnvtceqlhfhvldtsdylrpvaltvtfaldnttkpgpvlnegsptsiqklvpfskdcgp........
hsO_ENSP00000358310 qrlsprrlrlsvgnvtceqlhfhvldtsdylrpvaltvtfaldnttkpgpvlnegsptsiqklvpfskdcgp........
hsO_ENSP00000462898 qrlsprrlrlsvgnvtceqlhfhvldtsdylrpvaltvtfaldnttkpgpvlnegsptsiqklvpfskdcgp........
hsO_ENSP00000315190 esavfhgffsmpemrcqklelllmdnlrdklrpiiismnyslplrmpdrprlglrsldaypilnqaqalenhtevqfqke
hsO_ENSP00000007722 esavfhgffsmpemrcqklelllmdnlrdklrpiiismnyslplrmpdrprlglrsldaypilnqaqalenhtevqfqke
hsO_ENSP00000422145 nlqnqaslsfqalsesqeenkadnlvnlk...................................................
hsO_ENSP00000296585 nlqnqaslsfqalsesqeenkadnlvnlk...................................................
hsO_ENSP00000345501 ................................................................................
hsO_ENSP00000455374 ................................................................................
hsO_ENSP00000267082 ................................................................................
hsO_ENSP00000408741 ................................................................................
hsO_ENSP00000350886 lhfppglsfrkvemlkphsqipvsceelpeesrllsralscnvsspifkaghsvalqmmfntlvnsswgdsvelhanvtc
hsO_ENSP00000349252 lhfppglsfrkvemlkphsqipvsceelpeesrllsralscnvsspifkaghsvalqmmfntlvnsswgdsvelhanvtc
hsO_ENSP00000439894 kvecaapsaharlcsvghpvfqtgakvtfllefefscssllsqvfvkltassdslerngtlqdnta..............
hsO_ENSP00000462836 kvecaapsaharlcsvghpvfqtgakvtfllefefscssllsqvfvkltassdslerngtlqdnta..............
hsO_ENSP00000440011 kvecaapsaharlcsvghpvfqtgakvtfllefefscssllsqvfvkltassdslerngtlqdnta..............
hsO_ENSP00000462258 kvecaapsaharlcsvghpvfqtgakvtfllefefscssllsqvfvkltassdslerngtlqdnta..............
hsO_ENSP00000358310 kvecaapsaharlcsvghpvfqtgakvtfllefefscssllsqvfvkltassdslerngtlqdnta..............
hsO_ENSP00000462898 kvecaapsaharlcsvghpvfqtgakvtfllefefscssllsqvfvkltassdslerngtlqdnta..............
hsO_ENSP00000386828 ................................................................................
hsO_ENSP00000393844 elevelllatiseqel................................................................
hsO_ENSP00000408024 ................................................................................
hsO_ENSP00000283249 ................................................................................
hsO_ENSP00000386367 ................................................................................
hsO_ENSP00000257879 elevelllatiseqel................................................................
hsO_ENSP00000377776 elevelllatiseqel................................................................
hsO_ENSP00000377777 elevelllatiseqel................................................................
hsO_ENSP00000452120 elevelllatiseqel................................................................
hsO_ENSP00000343009 elevelllatiseqel................................................................
hsO_ENSP00000257880 elevelllatiseqel................................................................
hsO_ENSP00000452387 elevelllatiseqel................................................................
hsO_ENSP00000282588 nvtiylsatsdseeppetlsdnvvn.......................................................
hsO_ENSP00000303351 ................................................................................
hsO_ENSP00000379350 ................................................................................
hsO_ENSP00000364094 ................................................................................
hsO_ENSP00000388694 ................................................................................
hsO_ENSP00000315190 ifcelgnpfkrnqrmelliafevigvtlhtrdlqvqlqlstsshqdnlwpmiltl.........................
hsO_ENSP00000007722 ifcelgnpfkrnqrmelliafevigvtlhtrdlqvqlqlstsshqdnlwpmiltl.........................
hsO_ENSP00000327290 sdgsiecvneerrlqkqvcnvsypffrakakvafrldfefsksiflhhleielaagsdsnerdstkednva.........
hsO_ENSP00000403392 sdgsiecvneerrlqkqvcnvsypffrakakvafrldfefsksiflhhleielaagsdsnerdstkednva.........
hsO_ENSP00000350886 helrrniavttsmsctdfsfhfpvcvqdlispinvslnfslweeegtprdqragkdippilrpslhsetweipfekncge
hsO_ENSP00000349252 dfsfhfpvcvqdlispinvslnfslweeegtprdqraqgkdippilrpslhsetweipfekncge...............
hsO_ENSP00000441561 ................................................................................
hsO_ENSP00000222573 ................................................................................
hsO_ENSP00000426142 lgnpfkrnqrmelliafevigvtlhtrdlqvqlqlstsshqdnlwpmiltl.............................
hsO_ENSP00000282588 gkkmttstdhlkrgtildcntckfatitcnltssdisqvnvslilwkptfiksyfsslnltirgelrsenaslvlsssnq
hsO_ENSP00000467977 symtsmalnyprnlqlkrmqkahvsvvwqleenafpnrtaditvtvt.................................
hsO_ENSP00000424397 srglfkennerclqknmvvnqaqscpehiiyiqepsdvvnsldlrvdislenpgtspaleaysetakvfsipfhkdcge.
hsO_ENSP00000422145 srglfkennerclqknmvvnqaqscpehiiyiqepsdvvnsldlrvdislenpgtspaleaysetakvfsipfhkdcge.
hsO_ENSP00000296585 srglfkennerclqknmvvnqaqscpehiiyiqepsdvvnsldlrvdislenpgtspaleaysetakvfsipfhkdcge.
hsO_ENSP00000380952 ................................................................................
hsO_ENSP00000303242 ................................................................................
hsO_ENSP00000347279 ................................................................................
hsO_ENSP00000380948 ................................................................................
hsO_ENSP00000380950 ................................................................................
hsO_ENSP00000380955 ................................................................................
hsO_ENSP00000420814 ................................................................................
hsO_ENSP00000264741 emvvgqekgncsfqknptpciipqeqenifhtifafftksgrkvldcekpgiscltahcnfsalakeesrtidiymllnt
hsO_ENSP00000403392 nqeinfhllgnlwlrslkalkyksmkimvnaalqrqfhspfifreedpsrqivfeiskqedwqvpiwii...........
hsO_ENSP00000327290 qeinfhllgnlwlrslkalkyksmkimvnaalqrqfhspfifreedpsrqivfeiskqedwqvpiwii............
hsO_ENSP00000268296 cssekiappasdflahiqknpvldcsiagclrfrcdvpsfsvqeeldftlkgnlsfgwvrqilqkkvsvvsvaeitfdts
hsO_ENSP00000454623 cssekiappasdflahiqknpvldcsiagclrfrcdvpsfsvqeeldftlkgnlsfgwvrqilqkkvsvvsvaeitfdts
hsO_ENSP00000439894 lngsntqcqvvrchlgqlakgtevsvgllrlvhneffrrakfksltvvstfelgte........................
hsO_ENSP00000462836 lngsntqcqvvrchlgqlakgtevsvgllrlvhneffrrakfksltvvstfelgte........................
hsO_ENSP00000440011 lngsntqcqvvrchlgqlakgtevsvgllrlvhneffrrakfksltvvstfelgte........................
hsO_ENSP00000462258 lngsntqcqvvrchlgqlakgtevsvgllrlvhneffrrakfksltvvstfelgte........................
hsO_ENSP00000358310 lngsntqcqvvrchlgqlakgtevsvgllrlvhneffrrakfksltvvstfelgte........................
hsO_ENSP00000462898 lngsntqcqvvrchlgqlakgtevsvgllrlvhneffrrakfksltvvstfelgte........................
hsO_ENSP00000450693 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000287497 aelrkapvvncsiavcqriqcdipffgiqeefnatlkgnlsfdwyiktshnhllivstaeilfndsvftllpgqgafvr.
hsO_ENSP00000441691 aelrkapvvncsiavcqriqcdipffgiqeefnatlkgnlsfdwyiktshnhllivstaeilfndsvftllpgqgafvr.
hsO_ENSP00000461626 ................................................................................
hsO_ENSP00000373854 mldcsiadclqfrcdvpsfsvqeeldftlkgnlsfgwvretlqkkvlvvsvaeitfdtsvysqlpgqeafmraqm.....
hsO_ENSP00000263087 ttasesglreallnftldvdvgkqrrrlqcsdvrsclgclrewssgsqlcedlllmptegelceedcfsnasvkvsyqlq
hsO_ENSP00000386828 ................................................................................
hsO_ENSP00000408024 ................................................................................
hsO_ENSP00000283249 ................................................................................
hsO_ENSP00000386367 ................................................................................
hsO_ENSP00000450267 rqvatavqwtkaegsygvplwii.........................................................


                                                                                                    
                                                                                                    
d1tyeb1             ................................................................................
hsO_ENSP00000364042 vwvi............................................................................
hsO_ENSP00000404291 vwvi............................................................................
hsO_ENSP00000261023 vwvi............................................................................
hsO_ENSP00000367316 dqpaklpegsiviktsviwatpnvsfsiplwvi...............................................
hsO_ENSP00000262407 pplslprgeaqvwtqllraleeraipiwwv..................................................
hsO_ENSP00000386614 vpwwii..........................................................................
hsO_ENSP00000264107 vpwwii..........................................................................
hsO_ENSP00000394169 vpwwii..........................................................................
hsO_ENSP00000341078 vpwwii..........................................................................
hsO_ENSP00000386896 vpwwii..........................................................................
hsO_ENSP00000364369 vpwwii..........................................................................
hsO_ENSP00000264106 vpwwii..........................................................................
hsO_ENSP00000406694 vpwwii..........................................................................
hsO_ENSP00000340536 raleeraipiwwv...................................................................
hsO_ENSP00000293379 yrilprqlpqkerqvatavqwtkaegsygvplwii.............................................
hsO_ENSP00000393844 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000343009 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000377776 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000377777 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000452120 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000257879 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000257880 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000452387 aekkknitldcargtancvvfscplysfdraavlhvwgrlwnstfleeysavkslevivranitvkssiknlmlrdastv
hsO_ENSP00000364042 ................................................................................
hsO_ENSP00000404291 ................................................................................
hsO_ENSP00000261023 ................................................................................
hsO_ENSP00000367316 ................................................................................
hsO_ENSP00000315190 ................................................................................
hsO_ENSP00000007722 ................................................................................
hsO_ENSP00000293379 edkaqilldcge....................................................................
hsO_ENSP00000296585 tiplmimkpdekaevptgvi............................................................
hsO_ENSP00000367316 ................................................................................
hsO_ENSP00000404291 ................................................................................
hsO_ENSP00000364042 ................................................................................
hsO_ENSP00000261023 ................................................................................
hsO_ENSP00000340536 ................................................................................
hsO_ENSP00000262407 ................................................................................
hsO_ENSP00000340536 qtrivldcge......................................................................
hsO_ENSP00000262407 qtrivldcge......................................................................
hsO_ENSP00000380227 ................................................................................
hsO_ENSP00000393844 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000452120 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000257879 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000377776 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000377777 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000452387 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000257880 pilnahqpstqraeihflkqgcge........................................................
hsO_ENSP00000407801 ................................................................................
hsO_ENSP00000441691 sennmprtnktefqlelp..............................................................
hsO_ENSP00000287497 sennmprtnktefqlelp..............................................................
hsO_ENSP00000452786 ................................................................................
hsO_ENSP00000456711 ................................................................................
hsO_ENSP00000282588 lpnsvheyipfakdcgn...............................................................
hsO_ENSP00000233573 ................................................................................
hsO_ENSP00000386614 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000264107 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000341078 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000386896 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000394169 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000364369 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000264106 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000406694 pilnsdepktahidvhflkegcgd........................................................
hsO_ENSP00000293379 knlnnsqsdvvsf...................................................................
hsO_ENSP00000388435 ................................................................................
hsO_ENSP00000389442 ................................................................................
hsO_ENSP00000418367 ................................................................................
hsO_ENSP00000327290 ................................................................................
hsO_ENSP00000403392 ................................................................................
hsO_ENSP00000477446 ................................................................................
hsO_ENSP00000264741 ................................................................................
hsO_ENSP00000268296 ................................................................................
hsO_ENSP00000454623 ................................................................................
hsO_ENSP00000296181 ................................................................................
hsO_ENSP00000343009 lnahqpstqraeihflkqgcge..........................................................
hsO_ENSP00000373854 ................................................................................
hsO_ENSP00000373854 tfqlelp.........................................................................
hsO_ENSP00000441691 ................................................................................
hsO_ENSP00000287497 ................................................................................
hsO_ENSP00000268296 ................................................................................
hsO_ENSP00000454623 ................................................................................
hsO_ENSP00000380227 ................................................................................
hsO_ENSP00000263087 ................................................................................
hsO_ENSP00000397258 ................................................................................
hsO_ENSP00000264741 ................................................................................
hsO_ENSP00000386614 nlapitakakv.....................................................................
hsO_ENSP00000264107 nlapitakakv.....................................................................
hsO_ENSP00000341078 nlapitakakv.....................................................................
hsO_ENSP00000386896 nlapitakakv.....................................................................
hsO_ENSP00000394169 nlapitakakv.....................................................................
hsO_ENSP00000364369 nlapitakakv.....................................................................
hsO_ENSP00000264106 nlapitakakv.....................................................................
hsO_ENSP00000406694 nlapitakakv.....................................................................
hsO_ENSP00000380227 ................................................................................
hsO_ENSP00000467269 ................................................................................
hsO_ENSP00000439894 ................................................................................
hsO_ENSP00000462836 ................................................................................
hsO_ENSP00000440011 ................................................................................
hsO_ENSP00000462258 ................................................................................
hsO_ENSP00000358310 ................................................................................
hsO_ENSP00000462898 ................................................................................
hsO_ENSP00000315190 cgp.............................................................................
hsO_ENSP00000007722 cgp.............................................................................
hsO_ENSP00000422145 ................................................................................
hsO_ENSP00000296585 ................................................................................
hsO_ENSP00000345501 ................................................................................
hsO_ENSP00000455374 ................................................................................
hsO_ENSP00000267082 ................................................................................
hsO_ENSP00000408741 ................................................................................
hsO_ENSP00000350886 nnedsdllednsat..................................................................
hsO_ENSP00000349252 nnedsdllednsat..................................................................
hsO_ENSP00000439894 ................................................................................
hsO_ENSP00000462836 ................................................................................
hsO_ENSP00000440011 ................................................................................
hsO_ENSP00000462258 ................................................................................
hsO_ENSP00000358310 ................................................................................
hsO_ENSP00000462898 ................................................................................
hsO_ENSP00000386828 ................................................................................
hsO_ENSP00000393844 ................................................................................
hsO_ENSP00000408024 ................................................................................
hsO_ENSP00000283249 ................................................................................
hsO_ENSP00000386367 ................................................................................
hsO_ENSP00000257879 ................................................................................
hsO_ENSP00000377776 ................................................................................
hsO_ENSP00000377777 ................................................................................
hsO_ENSP00000452120 ................................................................................
hsO_ENSP00000343009 ................................................................................
hsO_ENSP00000257880 ................................................................................
hsO_ENSP00000452387 ................................................................................
hsO_ENSP00000282588 ................................................................................
hsO_ENSP00000303351 ................................................................................
hsO_ENSP00000379350 ................................................................................
hsO_ENSP00000364094 ................................................................................
hsO_ENSP00000388694 ................................................................................
hsO_ENSP00000315190 ................................................................................
hsO_ENSP00000007722 ................................................................................
hsO_ENSP00000327290 ................................................................................
hsO_ENSP00000403392 ................................................................................
hsO_ENSP00000350886 ................................................................................
hsO_ENSP00000349252 ................................................................................
hsO_ENSP00000441561 ................................................................................
hsO_ENSP00000222573 ................................................................................
hsO_ENSP00000426142 ................................................................................
hsO_ENSP00000282588 krelaiqiskdglpgrvplwvi..........................................................
hsO_ENSP00000467977 ................................................................................
hsO_ENSP00000424397 ................................................................................
hsO_ENSP00000422145 ................................................................................
hsO_ENSP00000296585 ................................................................................
hsO_ENSP00000380952 ................................................................................
hsO_ENSP00000303242 ................................................................................
hsO_ENSP00000347279 ................................................................................
hsO_ENSP00000380948 ................................................................................
hsO_ENSP00000380950 ................................................................................
hsO_ENSP00000380955 ................................................................................
hsO_ENSP00000420814 ................................................................................
hsO_ENSP00000264741 eilkkdsssviqfmsrakvkvdpalrvveiahgnpeevtvvfealhnleprgyvvgwii.....................
hsO_ENSP00000403392 ................................................................................
hsO_ENSP00000327290 ................................................................................
hsO_ENSP00000268296 vysqlpgqeafmraqt................................................................
hsO_ENSP00000454623 vysqlpgqeafmraqt................................................................
hsO_ENSP00000439894 ................................................................................
hsO_ENSP00000462836 ................................................................................
hsO_ENSP00000440011 ................................................................................
hsO_ENSP00000462258 ................................................................................
hsO_ENSP00000358310 ................................................................................
hsO_ENSP00000462898 ................................................................................
hsO_ENSP00000450693 ................................................................................
hsO_ENSP00000287497 ................................................................................
hsO_ENSP00000441691 ................................................................................
hsO_ENSP00000461626 ................................................................................
hsO_ENSP00000373854 ................................................................................
hsO_ENSP00000263087 tpegqtdhpqpildrytepfaifqlpyekack................................................
hsO_ENSP00000386828 ................................................................................
hsO_ENSP00000408024 ................................................................................
hsO_ENSP00000283249 ................................................................................
hsO_ENSP00000386367 ................................................................................
hsO_ENSP00000450267 ................................................................................


                                          
                                          
d1tyeb1             ......................
hsO_ENSP00000364042 ......................
hsO_ENSP00000404291 ......................
hsO_ENSP00000261023 ......................
hsO_ENSP00000367316 ......................
hsO_ENSP00000262407 ......................
hsO_ENSP00000386614 ......................
hsO_ENSP00000264107 ......................
hsO_ENSP00000394169 ......................
hsO_ENSP00000341078 ......................
hsO_ENSP00000386896 ......................
hsO_ENSP00000364369 ......................
hsO_ENSP00000264106 ......................
hsO_ENSP00000406694 ......................
hsO_ENSP00000340536 ......................
hsO_ENSP00000293379 ......................
hsO_ENSP00000393844 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000343009 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000377776 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000377777 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000452120 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000257879 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000257880 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000452387 ipvmvyldpmavvaegvpwwvi
hsO_ENSP00000364042 ......................
hsO_ENSP00000404291 ......................
hsO_ENSP00000261023 ......................
hsO_ENSP00000367316 ......................
hsO_ENSP00000315190 ......................
hsO_ENSP00000007722 ......................
hsO_ENSP00000293379 ......................
hsO_ENSP00000296585 ......................
hsO_ENSP00000367316 ......................
hsO_ENSP00000404291 ......................
hsO_ENSP00000364042 ......................
hsO_ENSP00000261023 ......................
hsO_ENSP00000340536 ......................
hsO_ENSP00000262407 ......................
hsO_ENSP00000340536 ......................
hsO_ENSP00000262407 ......................
hsO_ENSP00000380227 ......................
hsO_ENSP00000393844 ......................
hsO_ENSP00000452120 ......................
hsO_ENSP00000257879 ......................
hsO_ENSP00000377776 ......................
hsO_ENSP00000377777 ......................
hsO_ENSP00000452387 ......................
hsO_ENSP00000257880 ......................
hsO_ENSP00000407801 ......................
hsO_ENSP00000441691 ......................
hsO_ENSP00000287497 ......................
hsO_ENSP00000452786 ......................
hsO_ENSP00000456711 ......................
hsO_ENSP00000282588 ......................
hsO_ENSP00000233573 ......................
hsO_ENSP00000386614 ......................
hsO_ENSP00000264107 ......................
hsO_ENSP00000341078 ......................
hsO_ENSP00000386896 ......................
hsO_ENSP00000394169 ......................
hsO_ENSP00000364369 ......................
hsO_ENSP00000264106 ......................
hsO_ENSP00000406694 ......................
hsO_ENSP00000293379 ......................
hsO_ENSP00000388435 ......................
hsO_ENSP00000389442 ......................
hsO_ENSP00000418367 ......................
hsO_ENSP00000327290 ......................
hsO_ENSP00000403392 ......................
hsO_ENSP00000477446 ......................
hsO_ENSP00000264741 ......................
hsO_ENSP00000268296 ......................
hsO_ENSP00000454623 ......................
hsO_ENSP00000296181 ......................
hsO_ENSP00000343009 ......................
hsO_ENSP00000373854 ......................
hsO_ENSP00000373854 ......................
hsO_ENSP00000441691 ......................
hsO_ENSP00000287497 ......................
hsO_ENSP00000268296 ......................
hsO_ENSP00000454623 ......................
hsO_ENSP00000380227 ......................
hsO_ENSP00000263087 ......................
hsO_ENSP00000397258 ......................
hsO_ENSP00000264741 ......................
hsO_ENSP00000386614 ......................
hsO_ENSP00000264107 ......................
hsO_ENSP00000341078 ......................
hsO_ENSP00000386896 ......................
hsO_ENSP00000394169 ......................
hsO_ENSP00000364369 ......................
hsO_ENSP00000264106 ......................
hsO_ENSP00000406694 ......................
hsO_ENSP00000380227 ......................
hsO_ENSP00000467269 ......................
hsO_ENSP00000439894 ......................
hsO_ENSP00000462836 ......................
hsO_ENSP00000440011 ......................
hsO_ENSP00000462258 ......................
hsO_ENSP00000358310 ......................
hsO_ENSP00000462898 ......................
hsO_ENSP00000315190 ......................
hsO_ENSP00000007722 ......................
hsO_ENSP00000422145 ......................
hsO_ENSP00000296585 ......................
hsO_ENSP00000345501 ......................
hsO_ENSP00000455374 ......................
hsO_ENSP00000267082 ......................
hsO_ENSP00000408741 ......................
hsO_ENSP00000350886 ......................
hsO_ENSP00000349252 ......................
hsO_ENSP00000439894 ......................
hsO_ENSP00000462836 ......................
hsO_ENSP00000440011 ......................
hsO_ENSP00000462258 ......................
hsO_ENSP00000358310 ......................
hsO_ENSP00000462898 ......................
hsO_ENSP00000386828 ......................
hsO_ENSP00000393844 ......................
hsO_ENSP00000408024 ......................
hsO_ENSP00000283249 ......................
hsO_ENSP00000386367 ......................
hsO_ENSP00000257879 ......................
hsO_ENSP00000377776 ......................
hsO_ENSP00000377777 ......................
hsO_ENSP00000452120 ......................
hsO_ENSP00000343009 ......................
hsO_ENSP00000257880 ......................
hsO_ENSP00000452387 ......................
hsO_ENSP00000282588 ......................
hsO_ENSP00000303351 ......................
hsO_ENSP00000379350 ......................
hsO_ENSP00000364094 ......................
hsO_ENSP00000388694 ......................
hsO_ENSP00000315190 ......................
hsO_ENSP00000007722 ......................
hsO_ENSP00000327290 ......................
hsO_ENSP00000403392 ......................
hsO_ENSP00000350886 ......................
hsO_ENSP00000349252 ......................
hsO_ENSP00000441561 ......................
hsO_ENSP00000222573 ......................
hsO_ENSP00000426142 ......................
hsO_ENSP00000282588 ......................
hsO_ENSP00000467977 ......................
hsO_ENSP00000424397 ......................
hsO_ENSP00000422145 ......................
hsO_ENSP00000296585 ......................
hsO_ENSP00000380952 ......................
hsO_ENSP00000303242 ......................
hsO_ENSP00000347279 ......................
hsO_ENSP00000380948 ......................
hsO_ENSP00000380950 ......................
hsO_ENSP00000380955 ......................
hsO_ENSP00000420814 ......................
hsO_ENSP00000264741 ......................
hsO_ENSP00000403392 ......................
hsO_ENSP00000327290 ......................
hsO_ENSP00000268296 ......................
hsO_ENSP00000454623 ......................
hsO_ENSP00000439894 ......................
hsO_ENSP00000462836 ......................
hsO_ENSP00000440011 ......................
hsO_ENSP00000462258 ......................
hsO_ENSP00000358310 ......................
hsO_ENSP00000462898 ......................
hsO_ENSP00000450693 ......................
hsO_ENSP00000287497 ......................
hsO_ENSP00000441691 ......................
hsO_ENSP00000461626 ......................
hsO_ENSP00000373854 ......................
hsO_ENSP00000263087 ......................
hsO_ENSP00000386828 ......................
hsO_ENSP00000408024 ......................
hsO_ENSP00000283249 ......................
hsO_ENSP00000386367 ......................
hsO_ENSP00000450267 ......................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053612 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]