SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.


Glycerol-3-phosphate (1)-acyltransferase alignments

These alignments are sequences aligned to the 0039877 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                 10        20        30        40        50        60        70        80        90 
                  |         |         |         |         |         |         |         |         | 
d1k30a_ s-HSRKFLDVRSEEELLSCIKKETEAGKLPPNVAAGMEELYQNYRNAVIESGNPKADEIVLSNMTVALDRILLDVEDPFVFSSHHKAIREPF


              100       110       120       130       140       150       160       170       180   
                |         |         |         |         |         |         |         |         |   
d1k30a_ DYYIFGQNYIRPLIDFGNSFVGNLSLFKDIEEKLQQGHNVVLISNHQTEADPAIISLLLEKTNPYIAENTIFVAGDRVLADPLCKPFSIGRN


            190       200       210       220       230       240       250       260       270     
              |         |         |         |         |         |         |         |         |     
d1k30a_ LICVYSKKHMFDIPELTETKRKANTRSLKEMALLLRGGSQLIWIAPSGGRDRPDPSTGEWYPAPFDASSVDNMRRLIQHSDVPGHLFPLALL


          280       290       300       310       320       330       340       350       360      
            |         |         |         |         |         |         |         |         |      
d1k30a_ CHDIMPPPSQVEIEIGEKRVIAFNGAGLSVAPEISFEEIAATHKNPEEVREAYSKALFDSVAMQYNVLKTAISGKQGLGASTADVSLSQPW


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0039877 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Chlamydia pecorum P787
NoYes   Chlamydia pecorum W73
NoYes   Chlamydia pecorum PV3056/3
NoYes   Chlamydophila pneumoniae LPCoLN
NoYes   Chlamydophila pneumoniae J138
NoYes   Chlamydophila pneumoniae CWL029
NoYes   Chlamydophila pneumoniae AR39
NoYes   Chlamydia psittaci 01DC12
NoYes   Chlamydia psittaci WC
NoYes   Chlamydia psittaci M56
NoYes   Chlamydia psittaci WS/RT/E30
NoYes   Chlamydia psittaci VS225
NoYes   Chlamydia psittaci MN
NoYes   Chlamydia psittaci GR9
NoYes   Chlamydia psittaci 84/55
NoYes   Chlamydia psittaci 08DC60
NoYes   Chlamydia psittaci 02DC15
NoYes   Chlamydia psittaci C19/98
NoYes   Chlamydia psittaci NJ1
NoYes   Chlamydia psittaci CP3
NoYes   Chlamydophila psittaci RD1
NoYes   Chlamydia psittaci Mat116
NoYes   Chlamydophila psittaci 6BC
NoYes   Chlamydophila psittaci 6BC
NoYes   Chlamydia trachomatis C/TW-3
NoYes   Chlamydia trachomatis L2/434/Bu(f)
NoYes   Chlamydia trachomatis L2/434/Bu(i)
NoYes   Chlamydia trachomatis IU888
NoYes   Chlamydia trachomatis IU824
NoYes   Chlamydia trachomatis L2b/Canada2
NoYes   Chlamydia trachomatis L2b/Canada1
NoYes   Chlamydia trachomatis L3/404/LN
NoYes   Chlamydia trachomatis L2b/Ams5
NoYes   Chlamydia trachomatis L2b/Ams4
NoYes   Chlamydia trachomatis L2b/Ams3
NoYes   Chlamydia trachomatis L2b/Ams2
NoYes   Chlamydia trachomatis L2b/Ams1
NoYes   Chlamydia trachomatis L2b/795
NoYes   Chlamydia trachomatis L2b/CV204
NoYes   Chlamydia trachomatis L2b/LST
NoYes   Chlamydia trachomatis L2b/UCH-2
NoYes   Chlamydia trachomatis L2b/8200/07
NoYes   Chlamydia trachomatis L2/25667R
NoYes   Chlamydia trachomatis L1/224
NoYes   Chlamydia trachomatis L1/115
NoYes   Chlamydia trachomatis L1/440/LN
NoYes   Chlamydia trachomatis K/SotonK1
NoYes   Chlamydia trachomatis Ia/SotonIa3
NoYes   Chlamydia trachomatis Ia/SotonIa1
NoYes   Chlamydia trachomatis G/SotonG1
NoYes   Chlamydia trachomatis F/SotonF3
NoYes   Chlamydia trachomatis F/SW5
NoYes   Chlamydia trachomatis F/SW4
NoYes   Chlamydia trachomatis E/SotonE8
NoYes   Chlamydia trachomatis E/SotonE4
NoYes   Chlamydia trachomatis E/SW3
NoYes   Chlamydia trachomatis D/SotonD6
NoYes   Chlamydia trachomatis D/SotonD5
NoYes   Chlamydia trachomatis D/SotonD1
NoYes   Chlamydia trachomatis A/5291
NoYes   Chlamydia trachomatis A/363
NoYes   Chlamydia trachomatis RC-J/971
NoYes   Chlamydia trachomatis RC-L2/55
NoYes   Chlamydia trachomatis J/6276tet1
NoYes   Chlamydia trachomatis RC-J/966
NoYes   Chlamydia trachomatis RC-J(s)/122
NoYes   Chlamydia trachomatis RC-F(s)/342
NoYes   Chlamydia trachomatis RC-L2(s)/3
NoYes   Chlamydia trachomatis RC-J/953
NoYes   Chlamydia trachomatis RC-J943
NoYes   Chlamydia trachomatis RC-Fs852
NoYes   Chlamydia trachomatis RC-L2s46
NoYes   Chlamydia trachomatis RC-F69
NoYes   Chlamydia trachomatis L2c
NoYes   Chlamydia trachomatis D-LC
NoYes   Chlamydia trachomatis D-EC
NoYes   Chlamydia trachomatis G/9301
NoYes   Chlamydia trachomatis G/11074
NoYes   Chlamydia trachomatis G/11222
NoYes   Chlamydia trachomatis G/9768
NoYes   Chlamydia trachomatis E/150
NoYes   Chlamydia trachomatis E/11023
NoYes   Chlamydia trachomatis B/TZ1A828/OT
NoYes   Chlamydia trachomatis Sweden2
NoYes   Chlamydia trachomatis E/Bour
NoYes   Chlamydia trachomatis A2497
NoYes   Chlamydia trachomatis A2497
NoYes   Chlamydia trachomatis L2b/UCH-1/proctitis
NoYes   Chlamydia trachomatis 434/Bu
NoYes   Chlamydia trachomatis A/HAR-13
NoYes   Chlamydia trachomatis D/UW-3/CX
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]