SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from Please contact us if you experience any problems.

E set domains alignments in Tetraodon nigroviridis 76_8

These alignments are sequences aligned to the 0034795 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1a02n1               ..............................................................................
ENSTNIP00000015820  gciidcfmigaimakmarpkkraqtllfshnaviamrdgklclmwrvgnlrkshiveahvraqlikpritdegeyipl
ENSTNIP00000014157  frvfkkaspngkltvylgkrdfvdrvdqvesvdgvvlidpeylkerkvfvtltcafr.....................
ENSTNIP00000001954  hqvfkkaspngkltvylgkrdfvdrvdqvesvdgvvlidpeylkerkvfvtltcaf......................
ENSTNIP00000014574  gciidafmigaimakmarpkkraetllfshnavialhdgklcfmfrvanlrkshiveahvraqllkpryteegeyipl
ENSTNIP00000014544  tpeqlaamaaeikedecqvnykppaqkslqeiqeldkddeslrkyketllgnvstltdpklpnvqvtkmtlvcdtapg
ENSTNIP00000010486  trvfkksspnckvtvylgkdfvdhldhvdpvdgvilvdpeylkdrkvfvtltcafr......................
ENSTNIP00000013758  gciidsfmigtimakmarpkkrnntlmfsknavialrdgklclmwrvgnlrrshiveahvraqlirsyvtaegefipl
ENSTNIP00000012673  gciidafiigavmakmakpkkrnetlvfsyyatvamrdsklclmwrvgnlrkshlveahvraqllk............
ENSTNIP00000022103  gsivdafligcmfikmsqpkkraetlmfsqdavisqrdgklclmfrvgnlrnshmvsaqirckliksrqtpegeflpl
ENSTNIP00000010457  gsivnafmvgcmfvkisqpkkraetlvfstnavismrdgrlclmfrvgdlrnshiveasiraklikskqtkegefipl
ENSTNIP00000017993  gsivdafligcmfikmsqpkkraetlmfsqdavisqrdgklclmfrvgnlrnshmvsaqirckliksrqtpegeflpl
ENSTNIP00000006675  trvfkktspnskltvylgrrdfvdhvscvdpvdgivlvepeylkdrkvfvtlncafrygqedldvlglsfrk......
ENSTNIP00000002599  trvfkktspnskltvylgrrdfvdhvscvdpvdgivlvepeylkdrkvfvtlncafrygqedldvlglsfrk......
ENSTNIP00000007179  gcivdsfmigtimakmvrpkkraqtllfshhavialrdgklclmwrlgnmrkshivehvraqlikphvtaegeylple
ENSTNIP00000019582  gsivdafligcmfikmsqpkkraetlmfsehaaismrdgkltlmfrvgnlrnshmvsaqirckllksrqtpegeflpl
ENSTNIP00000009102  gsmvnafmvgcmfvkisqpnkraetlvfskhavislrddklclmfrvgdlrsshivganmraklikskqtqegefipl
ENSTNIP00000017145  qlaaiaaeneepepvnykppaqksvkeiqdldkddeslckyketllgpgvtsvdpaapnvqvtrmallcessprplil
ENSTNIP00000009422  glvinaimlgcifmktaqanrraetlifskhavisvrnnrlcfmirlgdlrksmiisatvrmqvvrrttteegellpl
ENSTNIP00000009249  gliinavmlgcifmktaqsnrraetlifsrhaviavrnnrlcfmvrigdlrksmiigatvrlqvvrktttpegevipi
ENSTNIP00000005244  gliinavmlgcvfmktaqanrraetlifsrnaviaprngrptfmfrvgdlrksmiisatiqlqvirrtvtaegevipv
ENSTNIP00000005246  gliinavmlgcvfmktaqanrraetlifsrnaviaprngrptfmfrvgdlrksmiisatiqlqvirrtvtaegevipv
ENSTNIP00000014127  mkvfkkvsrdqsltvymdkrdfvdrcdsvqpvdgvivvdpqqlrgrkvyvmlsctfkygr..................
ENSTNIP00000006368  gvfincfmcgvilakislpkkraktvtfsdqaviclkegslcllirvanlrktlligsqiygkllrttstadgetiil
ENSTNIP00000009083  kvfkktsgnggltlylgkrdyvdnvnvvdkvegvvkldpkdfgd..................................
ENSTNIP00000002561  kvfkktsgnggltlylgkrdyvdnvnvvdkvegvvkldpkdfgd..................................
ENSTNIP00000001954  kpgpqptaetsrqflmsdkllhleasldkqiyyhgepi........................................
ENSTNIP00000019946  rvfkktngngnitlylgkrdfvdhvdsvevvegavkvdpsglngrkvyvyla..........................
ENSTNIP00000014157  kpgpqptaetsrqflmsdkllhleasldkqiyyhgepisvnvhvtnntnk............................
ENSTNIP00000010486  kpgpqpmvettrsflmsdrslhleasldkelyyhgepisvnvhvtnnstk............................
ENSTNIP00000010899  gciidafiigavmakiakpkkrnetlvfsdtavvalrdgklcmmwrvgnmrkshlveahvraqllkprvteegeflpl
ENSTNIP00000003800  eifvtgaflaklarpkkrsetikfsqvavicrrqgklclmvrvanmrkslliqcqltgkllhpsvtqegekt......
ENSTNIP00000008976  lmeifitgtflakvarpkkrgetvkfsqhavvtthegqpclmirvanmrkslligcqvtgkllqtsltkesetvwl..
ENSTNIP00000010244  vmeifitgtflakvarpkkrgetvkfsqhavvsdheglpclmirvanmrkslllgcqvtgkllqtsmtkegetvrldq
ENSTNIP00000000824  clldtiiigiiiakmasarkravtvgfsrcavinlrngclclawrlgdlrgnhilegvvkatvvryvrkpqgaivmsy
ENSTNIP00000007048  kpedniynidfirfkirdletstilfeiakpphaeeeeenrdadtsagrfvryqftpaflklrtvgatveftvgnrpl
ENSTNIP00000009940  edrakeilkgfklnwmnlrdaesgkvlwqgtedlsvpgvehearvpkkilkckavsrelnfssseklekfrle.....
ENSTNIP00000019946  gpkaditkqfimsdkpvhleaslekeiyyhgqpitvnvkihnesskvvkkikisveqltnvvlyssdtytktv.....
ENSTNIP00000005358  apsvettrdfvmsdkplhvkasldkevyyhgepvkvhvsvtnsssknik.............................
ENSTNIP00000014413  kaednvynvdftrfkirdletgtvlfeiakppgsapvdseedgldvdasagrfvryqftpaflklctvgatveftvgd
ENSTNIP00000019221  spdenifsidftrfkirdmetgtvlfeitkppttdktgdkrdidpnagrfvryqftpaflrlrqvgatveftvgdlpi
ENSTNIP00000022950  saspednvhmidftrfkirdmetgtvlfeitkpptpagdkkqsdpnagrfvryqftpflqlrqvgatveftvgdtpin
ENSTNIP00000005358  nvvfkkiskdksvgvylgkrdfvdrvdcvdpvdgviiidpealqgrkvfvtlsctfryr...................
ENSTNIP00000002561  gagpkadvcknfmmsdkpvhieaslekdlyfhgeaipikikiqnesnktvkkfkvtvdqttdivlysadkytk.....
ENSTNIP00000009083  gagpkadvcknfmmsdkpvhieaslekdlyfhgeaipikikiqnesnktvkkfkvtvdqttdivlysadkytk.....
ENSTNIP00000006156  tael..........................................................................
ENSTNIP00000004888  gklclmvrvanmrkslliqcqltgkllhpsvtqegektlvhqspvdfymdssgdcpflilpltf..............
ENSTNIP00000014127  ttfeffvmsekplhvrlslaretfyhgepvpvsleinnsssrtvkdislsveqvttvv....................
ENSTNIP00000020787  vrsvdlmksregqnrskhhthlyqtdafiirrgqnfqmwlglsr..................................
ENSTNIP00000002395  gaiincfmcgvilskislpmrktlmgsqiygkllrttntpdgetiimdqvniefmvdagkdnlffvcpltlyhvidks
ENSTNIP00000013223  gaiincfmcgvilskislptqnpddgsqiygkllrttntpdgetiimdqvniefmvdagkdnlffvcpltlyhvidks
ENSTNIP00000005835  rgrtafavassnsdstevpefepfiapgprgfppmtefldilevdmvskfeeinkqehrtefydsnflivrrgqefqv
ENSTNIP00000009178  glmleafitgafvakiarpqmragairfspyavvgqhqsqkclmlratnllqhpivdvkvsavlyeeyeg........
ENSTNIP00000010775  lsvcsvdllssktgrnraehhtdlyhgdeliirrgqtfqiemelsrpfstdadrlhldmktgplptvskgthatiplv
ENSTNIP00000005251  snl...........................................................................
ENSTNIP00000005249  snl...........................................................................
ENSTNIP00000005250  snl...........................................................................
ENSTNIP00000016350  snl...........................................................................
ENSTNIP00000015973  dkaeytfyegmgpvhapvtpv.........................................................
ENSTNIP00000010563  tsqlk.........................................................................
ENSTNIP00000021888  aldidhfdleceynnvehrtdlngidrlivrrgqafsirlylrsgsyqpgvsaldciaetgpq...............
ENSTNIP00000021411  elpvqsaitspadgaavegssqevtvrgyawsgggrevvrvdvsldgg..............................
ENSTNIP00000020537  svifadcgstsgkvamvdivpcpiqpcqlhkgqsysvnvtfnslvesq..............................
ENSTNIP00000005012  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftve..............................
ENSTNIP00000019109  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftve..............................
ENSTNIP00000000464  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftve..............................
ENSTNIP00000007616  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgag.........................
ENSTNIP00000003313  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgag.........................
ENSTNIP00000002488  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrga..........................
ENSTNIP00000003313  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpveftidakdagegllavqitdpegkpkkani...
ENSTNIP00000001789  itvfqpfflelslpysivrgeqfelkatvfnyqtscmmvsvktaksedytltplsaneytsclcgnerkt........
ENSTNIP00000002977  itvfqpfflelslpysivrgeqfelkatvfnyqtscmmvsvktaksedytltplsaneytsclcgnerkt........
ENSTNIP00000001513  itvfqpfflelslpysivrgeqfelkatvfnyqtscmmvsvktaksedytltplsaneytsclcgnerkt........
ENSTNIP00000017397  itvfqpfflelslpysivrgeqfelkatvfnyqtscmmvsvktaksedytltplsaneytsclcgnerkt........
ENSTNIP00000017377  ltvfqpffleltlpysiirgeqfelkatvfsylskcimltvtgeesadyklvplsgdqyssclcggerktvswnlva.
ENSTNIP00000007616  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpveftidakdagegllavqitdpegkpkkani...
ENSTNIP00000008895  evlfdevllpkspfrvlvtegcdpsrvraygpgleeglvnatncftvet.............................
ENSTNIP00000002488  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpveftidakdagegllavqitdpegkpkkani...
ENSTNIP00000006628  vsvdlrcrennrahrtweidrerlivrrgqpfsvtlqghrpltpqhyldlvlhlavpsgpgkrdelvvkvqeg.....
ENSTNIP00000008517  sinkpahmttdyhtellvvrrgfemffkvtfsqplteaddfqmefligkspsstkgsmvtvafnsqsgv.........
ENSTNIP00000017383  ltafqpffvsltlpysvvrgevfplratvfnylsdcimvqltlaesdqyafrscdgcryt..................
ENSTNIP00000008384  ltafqpffvsltlpysvvrgevfplratvfnylsdcimvqltlaesdqyafrscdgcryt..................
ENSTNIP00000009333  vlyddtpvpkspfqvsvregcdptrvvaagpglqkalsqkpnnfnii...............................
ENSTNIP00000007897  aveftfnrglaaapapvtpfpviaglevnggghva...........................................
ENSTNIP00000015072  g.............................................................................
ENSTNIP00000003494  g.............................................................................
ENSTNIP00000006950  nielsyevadrdsiksgspvlvqvqlereeev..............................................
ENSTNIP00000006734  dvsicravklhcdsnnlehhtsqasqdrllvrrgqafrltlelsqafnqhlhp.........................
ENSTNIP00000009333  vkyaeedvprspfrfrvlpthdaskvrasgpgltsgvpasfpvefnidtkdagqgqlsvlitdqdg............
ENSTNIP00000000464  vkyaeqevphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpegkpknati....
ENSTNIP00000007616  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsik..............
ENSTNIP00000003313  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsik..............
ENSTNIP00000002488  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsik..............
ENSTNIP00000003313  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvve.............................
ENSTNIP00000002488  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvve.............................
ENSTNIP00000007616  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvve.............................
ENSTNIP00000014961  mercdlniktnntdhrtdrygdkrlvvrrgqpftlffllkpgstalk...............................
ENSTNIP00000008895  nitfgglpipgspfsvpvrelvdpskvrcfgpgleigvrahvpqtftvdsskaglaplvvqly...............
ENSTNIP00000012789  pqagtkdktlccwfctsgpislsakierkgytpgesiqifaeiencssrmvvpkaaiyqtqtfyakg...........
ENSTNIP00000008895  spfkiktlpahdaskvrasgpglnasgitaslpveftidardageglltvqildpegkpkranir.............
ENSTNIP00000000464  padpskvrafgpglqggivgkpapftidtkgag.............................................
ENSTNIP00000005012  evphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpegkpknatiqdn.......
ENSTNIP00000019109  evphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpegkpknatiqdn.......
ENSTNIP00000005012  padpskvrafgpglqggivgkpapftidtkgag.............................................
ENSTNIP00000019109  padpskvrafgpglqggivgkpapftidtkgag.............................................
ENSTNIP00000009333  ppdpskvkasgpglkgglvgspaeftidtkg...............................................
ENSTNIP00000013084  pqagtkdklarawyrnfgqvsvtakidrkgytpgevipvfaefdnatsrsvvpkafiiqtqtfiargtmkqkravvst
ENSTNIP00000005012  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvk........................
ENSTNIP00000000464  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvk........................
ENSTNIP00000019109  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvk........................
ENSTNIP00000005012  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvg.........................
ENSTNIP00000000464  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvg.........................
ENSTNIP00000019109  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvg.........................
ENSTNIP00000016574  pqtgtkektlccwfcasgpislsakierkgytpgesiqifaevencssrvvvpkaalyqtqtffakgkg.........
ENSTNIP00000009333  gspfrvpvtdvvdpskvkvtgpgvgsgvrakvpqtftvdcrkagvaplavdvtgpkglreavevtdgg..........
ENSTNIP00000009333  gfpakvmahpavdtsgvrafgpgldgqavfreattdftvdarsltqnggahvkaevrnpsgalt..............
ENSTNIP00000009333  siswggtqipkspfevavgeeagpqqirawgpgleggvvgraaifvvesvaaevgvlgfaiegpsqakiecedqddgs
ENSTNIP00000021564  ..............................................................................
ENSTNIP00000015432  ..............................................................................
ENSTNIP00000007616  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhiktlisnpsgsctdalisd........
ENSTNIP00000003313  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhiktlisnpsgsctdalisd........
ENSTNIP00000002488  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhiktlisnpsgsctdalisd........
ENSTNIP00000005012  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskae............................
ENSTNIP00000000464  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskae............................
ENSTNIP00000019109  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskae............................
ENSTNIP00000003313  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadiscv.........................
ENSTNIP00000002488  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadiscv.........................
ENSTNIP00000007616  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadiscv.........................
ENSTNIP00000007616  spyriralptgdask...............................................................
ENSTNIP00000002488  spyriralptgdask...............................................................
ENSTNIP00000003313  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkv.............
ENSTNIP00000002488  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkv.............
ENSTNIP00000007616  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkv.............
ENSTNIP00000006675  qpiethrsylmsdrslhleasldkevth..................................................
ENSTNIP00000008895  pdalkvraygpglqgglvgkpapfaidtkg................................................
ENSTNIP00000021437  ..............................................................................
ENSTNIP00000007616  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgteaevhiqdngdgt.......................
ENSTNIP00000002488  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgteaevhiqdngdgt.......................
ENSTNIP00000003313  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgteaevhiqdngdgt.......................
ENSTNIP00000008895  rhspfevhvgeeagpqkvrawgpgletgmvgksadfvveaigtevgtlgfsiegpsqakiec................
ENSTNIP00000014295  ..............................................................................
ENSTNIP00000005012  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkag...............................
ENSTNIP00000000464  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkag...............................
ENSTNIP00000019109  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkag...............................
ENSTNIP00000014296  ..............................................................................
ENSTNIP00000003313  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqdgegv...............................
ENSTNIP00000002488  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqdgegv...............................
ENSTNIP00000007616  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqdgegv...............................
ENSTNIP00000008895  gdaskvkvfgqglieghtfevaefivdtrnagygglgls.......................................
ENSTNIP00000002599  qpiethrsylmsdrslhleasldkevthtwvfcklqrnknthnaqlqikhkvpv........................
ENSTNIP00000005012  piprspfevevggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddg........
ENSTNIP00000008895  vdainsghvtaygpglthgtvntpatftivtkdtgegglslavegp................................
ENSTNIP00000019109  piprspfevevggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddg........
ENSTNIP00000008895  fdpsmvtvsgpglergkvnedgsftvdcskagdaeltieivsesga................................
ENSTNIP00000005012  itwgevnvpnspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcse..........................
ENSTNIP00000008895  vlfadqqipispfrikvepsh.........................................................
ENSTNIP00000019109  itwgevnvpnspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcse..........................
ENSTNIP00000009333  spyrvravatgdaskctvtgpgldptvaigeelgmvvntkgagkgkvtclv...........................
ENSTNIP00000013288  ptvfrwtgeckevylsgsfnnwankiplirsqn.............................................
ENSTNIP00000005012  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieia.........................
ENSTNIP00000000464  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieia.........................
ENSTNIP00000019109  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieia.........................
ENSTNIP00000009333  lgeggaskvraggqglkgalagepaefsiwtreagagglaiavegpsraeisfddhk.....................
ENSTNIP00000009333  kspfsvdvgpacvpgacralgrglqstgmrvnqdgdfrvdtrnagsgdlrvlikgpsgveepvkqisskdg.......
ENSTNIP00000000464  nspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcseagqalgdisigikcap...................
ENSTNIP00000005012  geasrvkafgkglveahtsemaeffvdtrnagygglalsi......................................
ENSTNIP00000000464  geasrvkafgkglveahtsemaeffvdtrnagygglalsi......................................
ENSTNIP00000005012  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakp..............................
ENSTNIP00000000464  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakp..............................
ENSTNIP00000019109  geasrvkafgkglveahtsemaeffvdtrnagygglalsi......................................
ENSTNIP00000019109  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakp..............................
ENSTNIP00000008895  nspfrvmvgegshpenvkvygpgverlglkaneptyftvdcseagqgdvsigikcapgvvgpa...............
ENSTNIP00000003313  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedr.........................
ENSTNIP00000002488  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedr.........................
ENSTNIP00000007616  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedr.........................
ENSTNIP00000006011  klqefditftnnkvvygpgesisgtvkirtssslpykvikvncqgsc...............................
ENSTNIP00000013084  klkkldvvfdspevdrppvfssgdvvsgrvlldlfgevrvsslklhaegfakvhwtesrsagsstaytqnysdeveyl
ENSTNIP00000009333  gdaskvtvkgpgvepvgnvankptyfdictagagtgdvtavirdp.................................
ENSTNIP00000005012  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifs.................
ENSTNIP00000000464  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifs.................
ENSTNIP00000019109  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifs.................
ENSTNIP00000008895  penvkcsgpgleplgciinkpaeftmdtrgagrgelklyaqdaegfpiniqmtenenrtffcvyvptka.........
ENSTNIP00000009333  vqsevgnasqvraygdgleqgttfnnssfivdtqdagygglalsvegps.............................
ENSTNIP00000009872  aelniqhasletsenlqrhktegfssskalvvrrgapfrvslqlegrpfnpkcdslrvklslgtqtpstfcysfkpss
ENSTNIP00000000464  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakvkpnk......................
ENSTNIP00000005012  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakvkpnk......................
ENSTNIP00000019109  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakvkpnk......................
ENSTNIP00000000464  ipyspyriqslptgdaskclltaanlqklqts..............................................
ENSTNIP00000009333  ltwggvsipkspfrvnvgkgshphmvkvfgpgvetsglkanepthftvdcsgagdggdvsvgikcdanmvgdreadvd
ENSTNIP00000016574  nnlpvfsggdmvsgrvvvevtgdvrvksldvhargvakvrwtesrnagantt..........................
ENSTNIP00000018364  arptvirwag....................................................................
ENSTNIP00000000464  kspytvnvakamgdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelilenkge......
ENSTNIP00000009333  psmtahgpglsygvanrtatftvftedaseggldlaiegpskaeincvdhkd..........................
ENSTNIP00000003313  dsskataqgpglepsgniankttyfdvytagagv............................................
ENSTNIP00000002488  dsskataqgpglepsgniankttyfdvytagagv............................................
ENSTNIP00000007616  dsskataqgpglepsgniankttyfdvytagagv............................................
ENSTNIP00000019109  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisf............................
ENSTNIP00000005012  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisf............................
ENSTNIP00000000464  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisf............................
ENSTNIP00000003313  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdint..........................
ENSTNIP00000002488  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdint..........................
ENSTNIP00000007616  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdint..........................
ENSTNIP00000018732  tvdvskctiegedlrrcregepahflvvcrdsagepmtrggdhvmvsvvhkgkenc......................
ENSTNIP00000003313  spyriralptgdaskctvtvsigghglgagigptiqige.......................................
ENSTNIP00000008895  ggahkvraggtgldrgvagvpgefsiwtreagagglsiavegpskaei..............................
ENSTNIP00000009333  vlftdkevpqspfqvtvdpshdaskvkaegpglartgvesgkpthftvltkgagkaav....................
ENSTNIP00000003313  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgscdvr.......
ENSTNIP00000002488  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgscdvr.......
ENSTNIP00000007616  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgscdvr.......
ENSTNIP00000008895  hvtfagqqiprspfaahiseacnpnacrasgrglqpkgvrvkevadfkvyak..........................
ENSTNIP00000001925  pqheskekkmnlftsgsvsmdvslektgfcqgegisvlaciqnnssreikpkyclyrkhsffaegkrrvhtkdllkev
ENSTNIP00000001568  pqheskekkmnlftsgsvsmdvslektgfcqgegisvlaciqnnssreikpkyclyrkhsffaegkrrvhtkdllkev
ENSTNIP00000014417  rptvfrwsgpakevfvsgsfnnwatkiplnrsqnnfvaivdlp...................................
ENSTNIP00000008895  spycihaiptgdaskclvtvsigghgpgsgigptiqigeetvitvdakaagkgkvtckvt..................
ENSTNIP00000000464  vggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddgsc................
ENSTNIP00000009333  gdpglvsvygtglergttgaqsefiinntkagpgaltvt.......................................
ENSTNIP00000003313  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghreeakvtanndk..................
ENSTNIP00000002488  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghreeakvtanndk..................
ENSTNIP00000007616  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghreeakvtanndk..................
ENSTNIP00000005497  e.............................................................................
ENSTNIP00000012789  vsfdclndtnvpvfssgdcvsgrviievtgeirvkslkihakglakvrwtesrnagsnt...................
ENSTNIP00000008895  dasqvllrgaglskafisqknsftvdcsqagtnmlmvgvhgperp.................................
ENSTNIP00000005012  gdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelilenkgesv................
ENSTNIP00000019109  gdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelilenkgesv................
ENSTNIP00000009333  rlavtglqesglkvnhpasfavhlngaqgkmaakvhspsgaleecvvteleqdky.......................
ENSTNIP00000009333  pdrvqafgpgveksgclvdqraeftvsakdagrgplkitaqdaeglpvevkvtgkg......................
ENSTNIP00000006205  e.............................................................................
ENSTNIP00000009333  pfdpskvvasgaglkrakvgepsvlnvdcsragpgelsleaaldagvqaktevldnqdgt..................
ENSTNIP00000007616  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkmdcvecp........................
ENSTNIP00000002488  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkmdcvecp........................
ENSTNIP00000003313  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkmdcvecp........................
ENSTNIP00000008895  gdpglvsafgsglergttglasdfmvntcnagsgalsvtidgpskvkmdfqecp........................
ENSTNIP00000009333  lnpkkaraygpgieptgnrvmrpavftvdtfsagq...........................................
ENSTNIP00000005012  gdpgmvtahgaglqggitgapsefvvktcnagsgtlsvni......................................
ENSTNIP00000000464  gdpgmvtahgaglqggitgapsefvvktcnagsgtlsvni......................................
ENSTNIP00000019109  gdpgmvtahgaglqggitgapsefvvktcnagsgtlsvni......................................
ENSTNIP00000003313  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecciteidq..........................
ENSTNIP00000002488  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecciteidq..........................
ENSTNIP00000007616  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecciteidq..........................
ENSTNIP00000001133  tfdiffdhdkteyssgd.............................................................
ENSTNIP00000012114  eglkgalrgkpasftvtgydhdgeprlsggdtvsavimsvpdgnlssaevtdhqngsytvsylpkc............
ENSTNIP00000002873  tfdiffdhdkteyssgd.............................................................
ENSTNIP00000008895  lhprrakaygpgvesrgnvvlkpaeflvetveaglgevlvyvedpeghteearvtpnndknrtys.............
ENSTNIP00000009333  naskvqshgpglskafvdqvnrfyvdcsnagnnmllvgvhgpetpcee..............................
ENSTNIP00000005012  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgpht..................................
ENSTNIP00000000464  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgpht..................................
ENSTNIP00000019109  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgpht..................................
ENSTNIP00000008895  gdptrvqargpglqqtgnvagkptyfdiytagagagdvgvilvdsngrrdtveivlenrgd.................
ENSTNIP00000019406  ddedsnnitagsivtvtvtltrkrmaevfekeqestpclpeestteetqadssktk......................
ENSTNIP00000000464  ecgpqtmtaqvtspsgktvdadivdggns.................................................
ENSTNIP00000005012  ecgpqtmtaqvtspsgktvdadivdggns.................................................
ENSTNIP00000002873  vtkefsymlmksgtvvlkaqtdmkgytpgqiiqvkahisnqsgkstghmaaslvqnvsygtkkpthdvrtiaeveggv
ENSTNIP00000019109  cgpqtmtaqvtspsgktvdadivdggns..................................................
ENSTNIP00000008895  vkvygpgveprgvlrevtthfivdaqcfymgggdhikacvsnpsga................................
ENSTNIP00000001133  vtkefsymlmksgtvvlkaqtdmkgytpgqiiqvkahisnqsgkstghmaaslvqnvsygtkkpthdvrtiaeveggv
ENSTNIP00000007616  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndndtf..........
ENSTNIP00000003313  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndndtf..........
ENSTNIP00000002488  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndndtf..........
ENSTNIP00000005680  asqseamgagleeclvghpasvtvvtrdksggack...........................................
ENSTNIP00000005012  spyriqslptgdaskclltv..........................................................
ENSTNIP00000019109  spyriqslptgdaskclltv..........................................................
ENSTNIP00000008895  ggdpipkspfhimvaplldlskvsvqglnskadvgkdedftvrtqgaggqgrldvkilspsrrp..............
ENSTNIP00000000464  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvgvk............................
ENSTNIP00000005012  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvgvk............................
ENSTNIP00000019109  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvgvk............................
ENSTNIP00000007616  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpcee...........................
ENSTNIP00000003313  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpcee...........................
ENSTNIP00000002488  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpcee...........................
ENSTNIP00000009333  rvevnqeqefvvdtkgaggqghlevt....................................................
ENSTNIP00000005012  rltvtslqekdlkvnqeasfmvqrngargvvdakvhtpsgsseecy................................
ENSTNIP00000000464  rltvtslqekdlkvnqeasfmvqrngargvvdakvhtpsgsseecy................................
ENSTNIP00000019109  rltvtslqekdlkvnqeasfmvqrngargvvdakvhtpsgsseecy................................
ENSTNIP00000002488  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntycirfvptetg.........................
ENSTNIP00000007616  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntycirfvptetg.........................
ENSTNIP00000003313  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntycirfvptetg.........................
ENSTNIP00000015515  ..............................................................................
ENSTNIP00000020196  ..............................................................................
ENSTNIP00000019366  svatgeglrhalvnqhtt............................................................
ENSTNIP00000019239  ..............................................................................
ENSTNIP00000009911  setvatgeglrhcvvgvptsvtittkdkd.................................................
ENSTNIP00000018930  ..............................................................................
ENSTNIP00000008895  vgstcdlnlkipgeagmqemvaqvtspggktedaeiikgedstf..................................
ENSTNIP00000008895  ltitslqemslkvgheasfavqlngarglidaktqspsgateecsiteldadqhair.....................
ENSTNIP00000005679  asqseamgvgleeclvghpasvtvvtrdksggac............................................
ENSTNIP00000002488  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpvaskvepglsp.........
ENSTNIP00000007616  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpvaskvepglsp.........
ENSTNIP00000003313  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpvaskvepglsp.........
ENSTNIP00000002618  drppvfssgdvvsgrvlldlfgevrvsslklhaefakv........................................
ENSTNIP00000012827  htsvatgeglrhaatgqhhtitvttkdkd.................................................
ENSTNIP00000004899  vfssgdvvsgrvlldlfgevrvsslklhaefakvhwtersagsstaytqnysdeveylnr..................
ENSTNIP00000007675  ksffcggdvvsgrvevevneatrvsavrllalgrakveyakgkqrcrqeaeylrheellrlesqptdsdgsvllrpgn
ENSTNIP00000001568  dtfsngdsvsgqvtlevakdcqisslsvkfkgkarvlwserhgnttv...............................
ENSTNIP00000018500  dainsrntftngdtingrivvevskettiqalifigqgeaqvcwseq...............................
ENSTNIP00000004388  reagaglsiavegpskaeiafedrkdgssgvsyivqep........................................
ENSTNIP00000009333  lsqfklgtaadfsldinetdlsqltariqapsgreepcllkrmannhtglsfiprevgehrvsi..............
ENSTNIP00000003898  plsgsnsttlcclwcasgpitltataekkafspgetlk........................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000006011  itkkfnylllktgtlmlktrsdlrgyipgqvirlateihnksgkdtgcvlasliqkvsyktrrplfdlrtiaevegag
ENSTNIP00000003313  smrmshlkvgsaadipldigeldltqltaslttpsgreepcllkmlrng.............................
ENSTNIP00000002488  smrmshlkvgsaadipldigeldltqltaslttpsgreepcllkmlrng.............................
ENSTNIP00000006954  qp............................................................................
ENSTNIP00000007616  smrmshlkvgsaadipldigeldltqltaslttpsgreepcllkmlrng.............................
ENSTNIP00000007675  kekkvtcmfipdgqvslnakidrsgfcegedicinakfencsrivvpkaaiiakhiyqangrtkvfrqklssvrgnhi
ENSTNIP00000005012  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlg..............................
ENSTNIP00000000464  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlg..............................
ENSTNIP00000006346  cs............................................................................
ENSTNIP00000019109  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlg..............................
ENSTNIP00000003898  esrsfcsgdrvtgkisfelkketkisairmefrgtahvhwstsggknrrrr...........................
ENSTNIP00000005012  vnflvpftpqqgeitgevrmpsgktarphitdnkdgtiti......................................
ENSTNIP00000000464  vnflvpftpqqgeitgevrmpsgktarphitdnkdgtiti......................................
ENSTNIP00000003313  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemdik.............................
ENSTNIP00000002488  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemdik.............................
ENSTNIP00000007616  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemdik.............................
ENSTNIP00000008895  vgtasdvslkimetdlkslmasirapsgneepcvlkrlpnrhigisftpkevgeh.......................
ENSTNIP00000018500  ksltlssggvfmhiktdrmgymqgetiqvtle..............................................
ENSTNIP00000009333  sfrkgeitgevfmpsgkstqptitdnldgtvtvqysptea......................................
ENSTNIP00000010401  ved...........................................................................
ENSTNIP00000000963  ved...........................................................................
ENSTNIP00000008895  tvqkgqitgevqmpsgrtacpyitdnkdgtvtvkyspterglhem.................................
ENSTNIP00000009333  cvgsscdlnlkipavdlkdvrsevlspsgivrpaelvamgndtycv................................
ENSTNIP00000001925  dtfsngdsvsgqvtlevakdcqisslsvkfkgkarvlwserhgnttvv..............................
ENSTNIP00000019147  fvd...........................................................................
ENSTNIP00000019148  fvd...........................................................................
ENSTNIP00000003258  qp............................................................................
ENSTNIP00000011053  qp............................................................................
ENSTNIP00000007602  cpeh..........................................................................
ENSTNIP00000008163  i.............................................................................
ENSTNIP00000019109  nflvpftpqqgeitgevrmpsgktarphitdnkdgtitikyq....................................
ENSTNIP00000006767  cs............................................................................
ENSTNIP00000006766  cs............................................................................
ENSTNIP00000008162  i.............................................................................
ENSTNIP00000019061  cp............................................................................
ENSTNIP00000007602  yqd...........................................................................
ENSTNIP00000012220  ..............................................................................
ENSTNIP00000008162  t.............................................................................
ENSTNIP00000010401  ct............................................................................
ENSTNIP00000000963  ct............................................................................
ENSTNIP00000002265  fve...........................................................................
ENSTNIP00000017783  fve...........................................................................
ENSTNIP00000006767  ted...........................................................................
ENSTNIP00000006766  ted...........................................................................
ENSTNIP00000021085  cps...........................................................................
ENSTNIP00000013222  etlmfshkavisin................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000006767  fvs...........................................................................
ENSTNIP00000006766  fvs...........................................................................
ENSTNIP00000008162  lt............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008003  cpe...........................................................................
ENSTNIP00000009803  psasntlvwgpgldanvvlparffyiqaadssgrnlttspgektfevkikspgeh.......................
ENSTNIP00000008163  t.............................................................................
ENSTNIP00000010138  fv............................................................................
ENSTNIP00000008162  t.............................................................................
ENSTNIP00000006346  y.............................................................................
ENSTNIP00000021085  ym............................................................................
ENSTNIP00000002265  ca............................................................................
ENSTNIP00000017783  ca............................................................................
ENSTNIP00000008003  yrdpep........................................................................
ENSTNIP00000021085  kn............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019061  yrdpip........................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007472  scpp..........................................................................
ENSTNIP00000009146  scpp..........................................................................
ENSTNIP00000008163  tpalttiapnniset...............................................................
ENSTNIP00000002804  lrtfkpffvdftlpyslirgeqtkvpltvynylptcaevsprtlgvvaskqgqrkkc.....................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000007744  wldvqadqeyvlqvalrrlhpgqqksqrrdgraqaprfpklkdegwflvlgevehrqllalkrlg.............
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007714  itvhicspvlssvglyrlll..........................................................
ENSTNIP00000008162  tpalttiapnniset...............................................................
ENSTNIP00000008163  cst...........................................................................
ENSTNIP00000010138  enpkitavlpdcsfdrncr...........................................................
ENSTNIP00000019147  yct...........................................................................
ENSTNIP00000019148  yct...........................................................................
ENSTNIP00000018520  lrtfkpffvdftlpyslirgeqtk......................................................
ENSTNIP00000020566  kepqevgqtmsfrvqlfykngqpfpahrpvglrvnithielaldipvtqevlqe........................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000009105  rpercfvagpglhpdvvlpvryfviqavdsngenltlspvkmsrrlqvqisplkk.......................
ENSTNIP00000008162  cst...........................................................................
ENSTNIP00000005417  dd............................................................................
ENSTNIP00000004483  adpqktslilnkddircgwpatvvvqtkdqygdvvhvp........................................
ENSTNIP00000001542  adpqktslilnkddircgwpatvvvqtkdqygdvvhvp........................................
ENSTNIP00000018046  adpqktslilnkddircgwpatvvvqtkdqygdvvhvp........................................
ENSTNIP00000010138  scp...........................................................................
ENSTNIP00000002265  kinpvvtsveprcsvqrhr...........................................................
ENSTNIP00000017783  kinpvvtsveprcsvqrhr...........................................................
ENSTNIP00000006346  fvt...........................................................................
ENSTNIP00000008162  n.............................................................................
ENSTNIP00000006857  eplsstgllelkp.................................................................
ENSTNIP00000019147  nrd...........................................................................
ENSTNIP00000019148  nrd...........................................................................
ENSTNIP00000006521  feplsstgllelkp................................................................
ENSTNIP00000019061  ven...........................................................................
ENSTNIP00000004388  rltvaslqesglkvnqpasfa.........................................................
ENSTNIP00000016904  eeqlevlvqmhdfhgrpkryggdfllarlh................................................
ENSTNIP00000022219  slffkewapaaealfltgdfn.........................................................
ENSTNIP00000002960  slffkewapaaealfltgdfn.........................................................
ENSTNIP00000010459  vtldirlkrankvyregevvsgvivmvckeavqhhgiflgmeglvslqlssk..........................
ENSTNIP00000008492  gggqwrvgdrlevliemrdfrgipktsggdvllarlhdsvlgagvagr..............................
ENSTNIP00000011929  e.............................................................................
ENSTNIP00000010401  p.............................................................................
ENSTNIP00000000963  p.............................................................................

                                                                                10            20    
                                                                                 |             |    
d1a02n1               ..................................................LPMVERQDTDSCLVY..GGQ..QMILTG
ENSTNIP00000015820  ...........................dqidinvgfdkgldriflvspit---------------..---..------
ENSTNIP00000014157  ..................................................--------------Y..---..------
ENSTNIP00000001954  ..................................................-------------R-..---..------
ENSTNIP00000014574  ...............................dqidmnvgydkgtdrlflv---------------..---..-----A
ENSTNIP00000014544  ..........plvldlqgdldsfkknpfvlkegveykikisfkvnkeivs---------------..---..------
ENSTNIP00000010486  ..................................................--------------Y..---..------
ENSTNIP00000013758  ..................................eqmdlnvgydegtdrl---------------..---..--F---
ENSTNIP00000012673  ..................................................---------------..---..------
ENSTNIP00000022103  ...dqceldvgfgtgadqlflvsplticheinskspffdlsqrslmneqf---------------..---..------
ENSTNIP00000010457  ..............................................nqtd--------I------..---..------
ENSTNIP00000017993  ...............................dqceldvgfgtgadqlflv---------------..---..------
ENSTNIP00000006675  ..................................................---------------..---..------
ENSTNIP00000002599  ..................................................---------------..---..------
ENSTNIP00000007179  ............................................qtdidv---------------..---..------
ENSTNIP00000019582  ...............................dqleldvgfstgadqlflv---------------..---..-----S
ENSTNIP00000009102  ...........................................dqtdisv-----------G---..---..------
ENSTNIP00000017145  ...................................dlqgdlealkkqafv---------------..---..----L-
ENSTNIP00000009422  ............dqidihmdnpvgtngiflvspliichvidqgsplynls---------------..---..-----A
ENSTNIP00000009249  .....................qqidiqtesaitsnslfllapliichvid---------K-----..---..------
ENSTNIP00000005244  .................................aqldiqvenplrsngif---------------..---..------
ENSTNIP00000005246  .................................aqldiqvenplrsngif---------------..---..------
ENSTNIP00000014127  ..................................................---------------..--Q..------
ENSTNIP00000006368  eqvdidfmvdagkdhlffvcpltlyhvinrsspfyelsadslphqdfelv---------------..---..------
ENSTNIP00000009083  ..................................................---------------..---..------
ENSTNIP00000002561  ..................................................---------------..---..------
ENSTNIP00000001954  ..................................................---------------..---..------
ENSTNIP00000019946  ..................................................---------------..---..------
ENSTNIP00000014157  ..................................................---------------..---..------
ENSTNIP00000010486  ..................................................---------------..---..------
ENSTNIP00000010899  .........................................dnvdinvgf---------------..---..------
ENSTNIP00000003800  ..................................................---------------..---..------
ENSTNIP00000008976  ..................................................---------------..---..------
ENSTNIP00000010244  .................................rnvpfqvdtssdspfli---------------..---..------
ENSTNIP00000000824  ...................................qdldipnreivlatp---------------..---..------
ENSTNIP00000007048  .......................................nhfrmierhyf---------------..---..------
ENSTNIP00000009940  ..................................................---------------..---..------
ENSTNIP00000019946  ..................................................---------------..---..------
ENSTNIP00000005358  ..................................................---------------..---..------
ENSTNIP00000014413  .......................................rpinsfrmier---------------..---..------
ENSTNIP00000019221  ....................enfrmierhyfrerllksfdfefgfcmprs---------------..---..------
ENSTNIP00000022950  ...................................nfrmierhyfrdqll---------------..---..------
ENSTNIP00000005358  ..................................................---------------..---..------
ENSTNIP00000002561  ..................................................---------------..---..------
ENSTNIP00000009083  ..................................................---------------..---..------
ENSTNIP00000006156  ..................................................--KICRVNRNSGSCK..GGD..EIFLLC
ENSTNIP00000004888  ..................................................---------------..---..------
ENSTNIP00000014127  ..................................................---------------..---..------
ENSTNIP00000020787  ..................................................---------------..---..------
ENSTNIP00000002395  ................................spffdmavdtlhkqefel---------------..---..------
ENSTNIP00000013223  ................................spffdmavdtlhkqefel---------------..---..------
ENSTNIP00000005835  ...............................kitfnrpykpkdkfalefv---------------..---..------
ENSTNIP00000009178  ..................................................---------------..---..------
ENSTNIP00000010775  ........................dslkgkrweakiveqsgnkvklsvns---------------..---..------
ENSTNIP00000005251  ..................................................--KIVRMDRTAGCVS..GGE..EVYLLC
ENSTNIP00000005249  ..................................................--KIVRMDRTAGCVS..GGE..EVYLLC
ENSTNIP00000005250  ..................................................--KIVRMDRTAGCVS..GGE..EVYLLC
ENSTNIP00000016350  ..................................................--KISRMDKTCGTVL..GGD..EIFLLC
ENSTNIP00000015973  ..................................................-PVVESLQLN----G..GGDvaMLELTG
ENSTNIP00000010563  ..................................................---ISCLNQYRGSCA..GKT..EVYMLC
ENSTNIP00000021888  ..................................................---------------..---..------
ENSTNIP00000021411  ..................................................---------------..---..------
ENSTNIP00000020537  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------TRGAGT..GGL..GLTIEG
ENSTNIP00000019109  ..................................................---------TRGAGT..GGL..GLTIEG
ENSTNIP00000000464  ..................................................---------TRGAGT..GGL..GLTIEG
ENSTNIP00000007616  ..................................................--------------T..---..------
ENSTNIP00000003313  ..................................................--------------T..---..------
ENSTNIP00000002488  ..................................................-------------G-..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000001789  ..................................................---------------..---..------
ENSTNIP00000002977  ..................................................---------------..---..------
ENSTNIP00000001513  ..................................................---------------..---..------
ENSTNIP00000017397  ..................................................---------------..---..------
ENSTNIP00000017377  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................----------RGAGT..GGL..GLAIEG
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000006628  ..................................................---------------..---..------
ENSTNIP00000008517  ..................................................--------------W..---..------
ENSTNIP00000017383  ..................................................---------------..---..------
ENSTNIP00000008384  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------TRGAGI..GGV..GITVEG
ENSTNIP00000007897  ..................................................---------------..---..MLELHG
ENSTNIP00000015072  ..................................................LPEILKKSLHSCSVR..GGE..EVFIIG
ENSTNIP00000003494  ..................................................LPEILKKSLHSCSVR..GGE..EVFIIG
ENSTNIP00000006950  ..................................................---------------..---..------
ENSTNIP00000006734  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..-----G
ENSTNIP00000003313  ..................................................---------------..---..-----G
ENSTNIP00000002488  ..................................................---------------..---..-----G
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000014961  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000012789  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................--------------A..GGL..GLTVEG
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................--------------A..GGL..GLTVEG
ENSTNIP00000019109  ..................................................--------------A..GGL..GLTVEG
ENSTNIP00000009333  ..................................................------------AGT..GGL..GLTVEG
ENSTNIP00000013084  .................................lcgdvvgakcretwhgr---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..-----G
ENSTNIP00000000464  ..................................................---------------..---..-----G
ENSTNIP00000019109  ..................................................---------------..---..-----G
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000016574  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000009333  ...............................................cnv---------------..---..------
ENSTNIP00000021564  ..................................................LPMVEKQDMDHCSVL..GGQ..QMILTG
ENSTNIP00000015432  ..................................................LPMVEKQDMDHCSVL..GGQ..QMILTG
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..-CTVTG
ENSTNIP00000002488  ..................................................---------------..---..-CTVTG
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000006675  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................------------AGT..GGL..GLTVEG
ENSTNIP00000021437  ..................................................LPSVERQDLDRCSVL..GGQ..QMVLTG
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000014295  ..................................................LPQVDKSSLTSCLVS..GGE..EMVISG
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000014296  ..................................................LPQVDKSSLTSCLVS..GGE..EMVISG
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................-------------IE..GPS..KVDINC
ENSTNIP00000002599  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................----------A----..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................----------A----..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000013288  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................--------------E..GPS..KVDINC
ENSTNIP00000000464  ..................................................--------------E..GPS..KVDINC
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................--------------E..GPS..KVDINC
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000006011  ..................................................---------------..---..------
ENSTNIP00000013084  .............................................nrrev---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000009872  ..........................................arwqayfk---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000016574  ..................................................---------------..---..------
ENSTNIP00000018364  ..................................................---------------..AGK..EVYISG
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000018732  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................-----------GSGS..GEL..KVVVKG
ENSTNIP00000001925  ..............................................gnpi---------------..---..------
ENSTNIP00000001568  ..............................................gnpi---------------..---..------
ENSTNIP00000014417  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................-------------IE..GPS..KVKMEC
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000005497  ..................................................----------MCPAS..GGE..RMLVEG
ENSTNIP00000012789  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000006205  ..................................................LPVIESISLTSCSVE..GGE..ELLLSG
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................--------------D..GPS..KVKLDC
ENSTNIP00000000464  ..................................................--------------D..GPS..KVKLDC
ENSTNIP00000019109  ..................................................--------------D..GPS..KVKLDC
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000001133  ..................................................------------SVS..GSV..KVELSG
ENSTNIP00000012114  ..................................................---------------..---..------
ENSTNIP00000002873  ..................................................------------SVS..GSV..KVELSG
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000019406  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000002873  .............................................vkpgk---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000001133  .............................................vklgk---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000005680  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..--SIGG
ENSTNIP00000019109  ..................................................---------------..---..--SIGG
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000015515  ..................................................--MVTDYSPEWSYPE..GGV..KVLITG
ENSTNIP00000020196  ..................................................-PCIKAISPSEGWTT..GGA..TVILIG
ENSTNIP00000019366  ..................................................---------------..---..------
ENSTNIP00000019239  ..................................................-PCIKAISPSEGWTT..GGA..TVIIIG
ENSTNIP00000009911  ..................................................---------------..---..------
ENSTNIP00000018930  ..................................................-PCIKAISPSEGWTT..GGA..MVIVIG
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000005679  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002618  ..................................................---------------..---..------
ENSTNIP00000012827  ..................................................---------------..---..------
ENSTNIP00000004899  ..................................................---------------..---..------
ENSTNIP00000007675  ...........................................kyeysfg---------------..---..------
ENSTNIP00000001568  ..................................................---------------..---..------
ENSTNIP00000018500  ..................................................---------------..---..------
ENSTNIP00000004388  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000003898  ..................................................---------------..---..------
ENSTNIP00000000963  ..................................................---IINLKPSRGPVS..GGT..IVNITG
ENSTNIP00000010401  ..................................................---IINLKPSRGPVS..GGT..IVNITG
ENSTNIP00000006011  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000006954  ..................................................-PLVTGISPKEGVAW..--T..KVTIRG
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000007675  ...........................................isgmcda---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000006346  ..................................................HPRITKLFPETGPRQ..GGT..RVTILG
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000003898  ..................................................---------------..---..------
ENSTNIP00000005012  ..................................................---------------..---..------
ENSTNIP00000000464  ..................................................---------------..---..------
ENSTNIP00000003313  ..................................................---------------..---..------
ENSTNIP00000002488  ..................................................---------------..---..------
ENSTNIP00000007616  ..................................................---------------..---..------
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000018500  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000010401  ..................................................-PTITKIEPEWSIYS..GHT..AVTVTG
ENSTNIP00000000963  ..................................................-PTITKIEPEWSIYS..GHT..AVTVTG
ENSTNIP00000008895  ..................................................---------------..---..------
ENSTNIP00000009333  ..................................................---------------..---..------
ENSTNIP00000001925  ..................................................---------------..---..------
ENSTNIP00000019147  ..................................................-PVISEIFPTFGPKS..GST..MLTIRG
ENSTNIP00000019148  ..................................................-PVISEIFPTFGPKS..GST..MLTIRG
ENSTNIP00000003258  ..................................................-PLVTGISPKEGVAW..--T..KVTIRG
ENSTNIP00000011053  ..................................................-PLVTGISPKEGVAW..--T..KVTIRG
ENSTNIP00000007602  ..................................................--VIHNIEPLSGLLE..GGT..MLTISG
ENSTNIP00000008163  ..................................................---ITSFSPSSGSIAdiGGT..LLTVGG
ENSTNIP00000019109  ..................................................---------------..---..------
ENSTNIP00000006767  ..................................................HPRITKISPLTGPRE..GGT..RVTIEG
ENSTNIP00000006766  ..................................................HPRITKISPLTGPRE..GGT..RVTIEG
ENSTNIP00000008162  ..................................................---ITSFSPSSGSIAdiGGT..LLTVGG
ENSTNIP00000019061  ..................................................NPQITDIIPRFGPMR..GEI..SITILG
ENSTNIP00000007602  ..................................................-PFVMSVSPNRGPKA..GGT..VLTISG
ENSTNIP00000012220  ..................................................IPEILKKSLHSCSVR..GGE..EVFIIG
ENSTNIP00000008162  ..................................................-PVLSSITPITGSS-..-GA..VVTLAG
ENSTNIP00000010401  ..................................................HPRITKITPLRGPRE..GGT..LVTIRG
ENSTNIP00000000963  ..................................................HPRITKITPLRGPRE..GGT..LVTIRG
ENSTNIP00000002265  ..................................................-PSVTDLKPDSGPVF..GGT..TVTLTG
ENSTNIP00000017783  ..................................................-PSVTDLKPDSGPVF..GGT..TVTLTG
ENSTNIP00000006767  ..................................................-PTITSIEPNWTILN..GST..MITVTG
ENSTNIP00000006766  ..................................................-PTITSIEPNWTILN..GST..MITVTG
ENSTNIP00000021085  ..................................................-PEIHKIFPLRGPVE..GGT..LLTVQG
ENSTNIP00000013222  ..................................................----------IGFDT..GDD..RLFL--
ENSTNIP00000008163  ..................................................---VASLSPLEGSLA..GGT..SLTFTG
ENSTNIP00000006767  ..................................................-PSFSRVHPEKGPVS..GGT..RLTVTG
ENSTNIP00000006766  ..................................................-PSFSRVHPEKGPVS..GGT..RLTVTG
ENSTNIP00000008162  ..................................................-PVITEVSPRRGGTA..GGT..SLTITG
ENSTNIP00000008162  ..................................................---VASLSPLEGSLA..GGT..SLTFTG
ENSTNIP00000008003  ..................................................-PKITAISPRQGPLN..GRI..LVTIKG
ENSTNIP00000009803  ..................................................---------------..---..------
ENSTNIP00000008163  ..................................................-PVVTEINPSQGSIG..LGT..LLTVTG
ENSTNIP00000010138  ..................................................IPNITEIRPNYGPRV..GGT..LITVTG
ENSTNIP00000008162  ..................................................-PVVTEINPSQGSIG..LGT..LLTVTG
ENSTNIP00000006346  ..................................................--------------S..GGT..LLTVSG
ENSTNIP00000021085  ..................................................-------EPNKGYRA..GGT..KVTITG
ENSTNIP00000002265  ..................................................-PIITEVSPKVAPVG..GET..EVTLCG
ENSTNIP00000017783  ..................................................-PIITEVSPKVAPVG..GET..EVTLCG
ENSTNIP00000008003  ..................................................----TAVEPARGPAA..GGT..VITIKG
ENSTNIP00000021085  ..................................................-PTIFFIKPTKSYLS..GGR..TITVTG
ENSTNIP00000008163  ..................................................---VTGVSPSKGSVE..GGT..LLTVDG
ENSTNIP00000019061  ..................................................----EAVEPSRGPKA..GGT..LITITG
ENSTNIP00000008163  ..................................................---VHSVSPLYGSLM..GGT..RLTLSG
ENSTNIP00000007472  ..................................................-PQITQVQPVSGPLE..GGV..LVTITG
ENSTNIP00000009146  ..................................................-PQITQVQPVSGPLE..GGV..LVTITG
ENSTNIP00000008163  ..................................................---------------..--T..DVVIYG
ENSTNIP00000002804  ..................................................---------------..---..------
ENSTNIP00000008162  ..................................................---VTGVSPSKGSVE..GGT..LLTVDG
ENSTNIP00000008162  ..................................................---VHSVSPLYGSLM..GGT..RLTLSG
ENSTNIP00000007744  ..................................................---------------..---..------
ENSTNIP00000008163  ..................................................LPAVDSLAPSIGSPT..GHT..RLHIKG
ENSTNIP00000007714  ..................................................---------------..---..------
ENSTNIP00000008162  ..................................................---------------..--T..DVVIYG
ENSTNIP00000008163  ..................................................-PTVHAISPNQGSYH..--Q..ILHIQG
ENSTNIP00000010138  ..................................................---------------..-GS..KIVIEG
ENSTNIP00000019147  ..................................................-PVITKVFPTSGPIR..GST..TVTICG
ENSTNIP00000019148  ..................................................-PVITKVFPTSGPIR..GST..TVTICG
ENSTNIP00000018520  ..................................................---------------..---..------
ENSTNIP00000020566  ..................................................---------------..---..------
ENSTNIP00000008162  ..................................................LPAVDSLAPSIGSPT..GHT..RLHIKG
ENSTNIP00000009105  ..................................................---------------..---..------
ENSTNIP00000008162  ..................................................-PTVHAISPNQGSYH..--Q..ILHIQG
ENSTNIP00000005417  ..................................................-PVITEASPAESFYA..GGR..VVMVTG
ENSTNIP00000004483  ..................................................---------------..---..------
ENSTNIP00000001542  ..................................................---------------..---..------
ENSTNIP00000018046  ..................................................---------------..---..------
ENSTNIP00000010138  ..................................................-PGIAGFFPRTAPPD..GQT..ELTVFG
ENSTNIP00000002265  ..................................................---------------..-GS..RLVIQG
ENSTNIP00000017783  ..................................................---------------..-GS..RLVIQG
ENSTNIP00000006346  ..................................................-PYFNRIQPSQGPIS..GGT..RITVEG
ENSTNIP00000008162  ..................................................------VQPNEGSFG..GGA..LLTVVG
ENSTNIP00000006857  ..................................................---------------..-GS..PLILKG
ENSTNIP00000019147  ..................................................-PIISSIQPSRSFVS..GGC..TVVAHG
ENSTNIP00000019148  ..................................................-PIISSIQPSRSFVS..GGC..TVVAHG
ENSTNIP00000006521  ..................................................---------------..-GS..PLILKG
ENSTNIP00000019061  ..................................................-PIVLGHNPKESFVC..GGR..NIVVTG
ENSTNIP00000004388  ..................................................---------------..---..------
ENSTNIP00000016904  ..................................................---------------..---..------
ENSTNIP00000022219  ..................................................---------------..G--..------
ENSTNIP00000002960  ..................................................---------------..G--..------
ENSTNIP00000010459  ..................................................---------------..---..------
ENSTNIP00000008492  ..................................................---------------..---..------
ENSTNIP00000011929  ..................................................------ISPYSGSIM..GGT..EFVVLN
ENSTNIP00000010401  ..................................................---------------..-GS..PIILKG
ENSTNIP00000000963  ..................................................---------------..-GS..PIILKG

                              30         40        50                60        70                  8
                               |          |         |                 |         |                   
ENSTNIP00000015820  ---....-----.----------------------........-------I--------.........-------.--
ENSTNIP00000014157  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000001954  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000014574  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000014544  ---....-----.----------------------........----------------.........-----G-.--
ENSTNIP00000010486  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000013758  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000012673  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000022103  ---....-----.----------------E-----........----------------.........-------.--
ENSTNIP00000010457  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000017993  ---....-----.----------------------........---S------------.........-------.--
ENSTNIP00000006675  ---....--D--.----------------------........----------------.........-------.--
ENSTNIP00000002599  ---....--D--.----------------------........----------------.........-------.--
ENSTNIP00000007179  ---....-----.-G--------------------........----------------.........-------.--
ENSTNIP00000019582  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009102  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000017145  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009422  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009249  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005244  ---....-----.----------------------........---------L------.........-------.--
ENSTNIP00000005246  ---....-----.----------------------........---------L------.........-------.--
ENSTNIP00000014127  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000006368  ---....-----.-V--------------------........----------------.........-------.--
ENSTNIP00000009083  ---....-----.----------------------........-----R----------.........-------.--
ENSTNIP00000002561  ---....-----.----------------------........-----R----------.........-------.--
ENSTNIP00000001954  ---....-----.----------------------........----------------.........-------.-S
ENSTNIP00000019946  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000014157  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000010486  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000010899  ---....-----.---------------D------........----------------.........-------.--
ENSTNIP00000003800  ---....-----.-----------L----------........----------------.........-------.--
ENSTNIP00000008976  ---....-----.----D-----------------........----------------.........-------.--
ENSTNIP00000010244  ---....-----.---------------I------........----------------.........-------.--
ENSTNIP00000000824  ---....-----.----------------------........-------------A--.........-------.--
ENSTNIP00000007048  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009940  ---....---QK.VFFKGQCLEEWFFEF-------........----------------.........-------.--
ENSTNIP00000019946  ---....-----.-------------C--------........----------------.........-------.--
ENSTNIP00000005358  ---....-----.---------NIIVSVDQVANVV........LYSNDSYIK-------.........-------.--
ENSTNIP00000014413  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000019221  ---....-----.----------K-----------........----------------.........-------.--
ENSTNIP00000022950  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005358  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000002561  ---....-----.-----------T----------........----------------.........-------.--
ENSTNIP00000009083  ---....-----.-----------T----------........----------------.........-------.--
ENSTNIP00000004888  ---....-----.--------------------Y-........----------------.........-------.--
ENSTNIP00000014127  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000020787  ---....-----.-------------------PFD........PKEDKLHLILKTGPLP.........TVSKGTQ.VN
ENSTNIP00000002395  ---....-----.V---------------------........----------------.........-------.--
ENSTNIP00000013223  ---....-----.V---------------------........----------------.........-------.--
ENSTNIP00000005835  ---....-----.-----------------I----........----------------.........-------.--
ENSTNIP00000009178  ---....-----.----------------------........EVLHQTSVDF------.........-------.--
ENSTNIP00000010775  ---....-----.----------------------........------------P---.........-------.--
ENSTNIP00000021888  ---....-----.----------------------........---------------P.........-------.--
ENSTNIP00000021411  ---....-----.-----------K----------........----------------.........-------.--
ENSTNIP00000020537  ---....-----.----------------------........---K------------.........-------.--
ENSTNIP00000005012  A--....-----.----------------------........----------------.........-------.--
ENSTNIP00000019109  A--....-----.----------------------........----------------.........-------.--
ENSTNIP00000000464  A--....-----.----------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.---------------------R........DNHDGTYLVSYVPD--.........-------.--
ENSTNIP00000001789  ---....-----.----------------------........-------L--------.........-------.--
ENSTNIP00000002977  ---....-----.----------------------........-------L--------.........-------.--
ENSTNIP00000001513  ---....-----.----------------------........-------L--------.........-------.--
ENSTNIP00000017397  ---....-----.----------------------........-------L--------.........-------.--
ENSTNIP00000017377  ---....-----.----------------------........----------------.........--STTGV.VE
ENSTNIP00000007616  ---....-----.---------------------R........DNHDGTYLVSYVPD--.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.---------------------R........DNHDGTYLVSYVPD--.........-------.--
ENSTNIP00000006628  ---....-----.------PAPGGRWW----FSQW........RVQDETVLTLHSPA--.........-------.--
ENSTNIP00000008517  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000017383  ---....-----.----------------A-----........----------------.........-------.--
ENSTNIP00000008384  ---....-----.----------------A-----........----------------.........-------.--
ENSTNIP00000009333  P--....-----.----------------------........----------------.........-------.--
ENSTNIP00000006950  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000006734  ---....-----.----------------------........-----LTITAATGP--.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........----------------.........------P.--
ENSTNIP00000002488  ---....-----.----------------------........----------------.........------P.--
ENSTNIP00000007616  ---....-----.----------------------........----------------.........------P.--
ENSTNIP00000014961  ---....-----.----------------------........--PSETSFTVQTGPLP.........QKKSNTK.VS
ENSTNIP00000008895  ---....-----.----------------------........---------------G.........-------.--
ENSTNIP00000012789  ---....-----.----------------------........----------------.........--K----.--
ENSTNIP00000008895  ---....-----.----------------------........D---------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........--R-------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........--R-------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009333  P--....-----.----------------------........----------------.........-------.--
ENSTNIP00000013084  ---....-----.------------------A---........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000016574  ---....-----.----------------------........-----K----------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........---DGQHLVSYTPT--.........---VEGP.YA
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.-D
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.----------------------........-L--------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........-L--------------.........-------.--
ENSTNIP00000002488  ---....-----.----------------------........-L--------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........-------I--------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........-------I--------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........-------I--------.........-------.--
ENSTNIP00000003313  ---....-----.---------D------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.---------D------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.---------D------------........----------------.........-------.--
ENSTNIP00000007616  AGI....GPTIQ.I---------------------........--GEQTVITVDAKA--.........----AGK.GK
ENSTNIP00000002488  AGI....GPTIQ.I---------------------........--GEQTVITVDAKA--.........----AGK.GK
ENSTNIP00000003313  ---....-----.--------------E-------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.--------------E-------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.--------------E-------........----------------.........-------.--
ENSTNIP00000006675  ---....-----.----------------------........-----TWVFCKLQRNK.........NTHNACS.FL
ENSTNIP00000008895  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000008895  D--....-----.----------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------------.........------G.NH
ENSTNIP00000000464  ---....-----.----------------------........----------------.........------G.NH
ENSTNIP00000019109  ---....-----.----------------------........----------------.........------G.NH
ENSTNIP00000003313  ---....-----.----------------------........----------------.........-------.-P
ENSTNIP00000002488  ---....-----.----------------------........----------------.........-------.-P
ENSTNIP00000007616  ---....-----.----------------------........----------------.........-------.-P
ENSTNIP00000008895  DDVe...DGTCK.VTYCPTEPGNYII---------........----------------.........-------.--
ENSTNIP00000002599  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------------.........------S.--
ENSTNIP00000008895  -S-....-----.----------------------........----------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........----------------.........------S.--
ENSTNIP00000008895  ---....-----.----------------------........----------------.........------K.AE
ENSTNIP00000005012  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........---DAAKVRAEGPGLN.........KTGVEVN.KP
ENSTNIP00000019109  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000013288  ---....-----.----------------------........------T---------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........DKGDGTYLCVYTPV--.........-KPIKH-.--
ENSTNIP00000000464  ---....-----.----------------------........DKGDGTYLCVYTPV--.........-KPIKH-.--
ENSTNIP00000019109  ---....-----.----------------------........DKGDGTYLCVYTPV--.........-KPIKH-.--
ENSTNIP00000009333  ---....-----.-------D--------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.----------G-----------........----------------.........-------.--
ENSTNIP00000005012  EDMe...DRTCK.VTYCPTEPGNYN----------........----------------.........-------.--
ENSTNIP00000000464  EDMe...DRTCK.VTYCPTEPGNYN----------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000019109  EDMe...DRTCK.VTYCPTEPGNYN----------........----------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000008895  ---....-----.----------------E-----........----------------.........-------.--
ENSTNIP00000003313  ---....-----.------K---------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.------K---------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.------K---------------........----------------.........-------.--
ENSTNIP00000006011  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000013084  ---....-----.----------------------........--------L-------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-QGRQNS.VE
ENSTNIP00000005012  ---....-----.-----------------VTYIP........PFHGAHTITIK-----.........-------.--
ENSTNIP00000000464  ---....-----.-----------------VTYIP........PFHGAHTITIK-----.........-------.--
ENSTNIP00000019109  ---....-----.-----------------VTYIP........PFHGAHTITIK-----.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........----------------.........---I---.--
ENSTNIP00000009333  ---....----K.VDIQTE----------------........----------------.........-------.--
ENSTNIP00000009872  ---....-----.-------------------P--........----------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........D---------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........D---------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........D---------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........---EDTVITVDAKA--.........----AGK.GK
ENSTNIP00000009333  ---....-----.---------------------F........----------------.........-------.--
ENSTNIP00000016574  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000018364  SFN....NWSTK.I---------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........-----S----------.........-------.--
ENSTNIP00000009333  ---....-----.-------------G--------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.-------------GEVEVIIMD........PSGKNSTVKCNIEDKG.........N------.--
ENSTNIP00000002488  ---....-----.-------------GEVEVIIMD........PSGKNSTVKCNIEDKG.........N------.--
ENSTNIP00000007616  ---....-----.-------------GEVEVIIMD........PSGKNSTVKCNIEDKG.........N------.--
ENSTNIP00000019109  ---....-----.---E------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.---E------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.---E------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.-----E----------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.-----E----------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.-----E----------------........----------------.........-------.--
ENSTNIP00000018732  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........----QTVITVDAKA--.........----AGK.GK
ENSTNIP00000008895  ---....-----.-T--------------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.-D
ENSTNIP00000003313  ---....-----.--Y-------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.--Y-------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.--Y-------------------........----------------.........-------.--
ENSTNIP00000008895  PRGa...VEPVK.----------------------........----------------.........-------.--
ENSTNIP00000001925  ---....-----.----------------------........------------P---.........-------.--
ENSTNIP00000001568  ---....-----.----------------------........------------P---.........-------.--
ENSTNIP00000014417  ---....-----.----------------------........-------------E--.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000000464  ---....----D.----------------------........----------------.........-------.--
ENSTNIP00000009333  QEV....PEGYK.VHYTPMAPGNYLISVK------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........---N------------.........-------.--
ENSTNIP00000002488  ---....-----.----------------------........---N------------.........-------.--
ENSTNIP00000007616  ---....-----.----------------------........---N------------.........-------.--
ENSTNIP00000012789  ---....-----.------------A---------........----------------.........-------.--
ENSTNIP00000008895  ---....C----.----------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........-------F--------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........-------F--------.........-------.--
ENSTNIP00000009333  ---....----A.----------------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-EGYR.VTY-------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-EGYR.VTY-------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-EGYR.VTY-------------------........----------------.........-------.--
ENSTNIP00000008895  ---....-EGYK.VS--------------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-------.GQ
ENSTNIP00000005012  REC....PEGYK.ITYTPMAPGNYLIAIK------........----------------.........-------.--
ENSTNIP00000000464  REC....PEGYK.ITYTPMAPGNYLIAIK------........----------------.........-------.--
ENSTNIP00000019109  REC....PEGYK.ITYTPMAPGNYLIAIK------........----------------.........-------.--
ENSTNIP00000003313  ---....-D---.----------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-D---.----------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-D---.----------------------........----------------.........-------.--
ENSTNIP00000001133  PLL....CKAIK.INCCGFC---------------........----------------.........-------.--
ENSTNIP00000012114  ---....-----.----------------------........----------------.........----EGE.HL
ENSTNIP00000002873  PLL....CKAIK.INCCGFC---------------........----------------.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........--------V-------.........-------.--
ENSTNIP00000009333  ---....-----.V---------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------PCEEVY........V---------------.........-------.--
ENSTNIP00000000464  ---....-----.----------------PCEEVY........V---------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------PCEEVY........V---------------.........-------.--
ENSTNIP00000008895  ---....-----.---------S------------........----------------.........-------.--
ENSTNIP00000019406  ---....-----.----------T-----------........----------------.........-------.--
ENSTNIP00000000464  ---....--TYS.VRFIPQEMGPHTVNVK------........----------------.........-------.--
ENSTNIP00000005012  ---....--TYS.VRFIPQEMGPHTVNVK------........----------------.........-------.--
ENSTNIP00000002873  ---....-----.----------------------........E---------------.........-------.--
ENSTNIP00000019109  ---....--TYS.VRFIPQEMGPHTVNVK------........----------------.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........----------------.........------T.--
ENSTNIP00000001133  ---....-----.----------------------........E---------------.........-------.--
ENSTNIP00000007616  ---....----T.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....----T.----------------------........----------------.........-------.--
ENSTNIP00000002488  ---....----T.----------------------........----------------.........-------.--
ENSTNIP00000005680  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005012  HGV....SANLQ.---------KLQT---------........--SEDTVITVDAKA--.........----AGK.GK
ENSTNIP00000019109  HGV....SANLQ.---------KLQT---------........--SEDTVITVDAKA--.........----AGK.GK
ENSTNIP00000008895  ---....-----.----------------------........-------I--------.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000019109  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000007616  ---....-----.-----I----------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.-----I----------------........----------------.........-------.--
ENSTNIP00000002488  ---....-----.-----I----------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.---------------------L........LSPNQRTVPCRVEP--.........---QPGR.AD
ENSTNIP00000005012  ---....-----.-------------------V--........----------------.........-------.--
ENSTNIP00000000464  ---....-----.-------------------V--........----------------.........-------.--
ENSTNIP00000019109  ---....-----.-------------------V--........----------------.........-------.--
ENSTNIP00000002488  ---....-----.----------------------........----------------.........------V.--
ENSTNIP00000007616  ---....-----.----------------------........----------------.........------V.--
ENSTNIP00000003313  ---....-----.----------------------........----------------.........------V.--
ENSTNIP00000015515  PWQea..SSN--.----------YSCLFDQISVPA........SLIQPGVLRCYCPA--.........--HDTGL.VT
ENSTNIP00000020196  ENF....FDGLQ.VVFG-----TMLVW-------S........ELITPHAIRVQTPP--.........-RHIPGV.VE
ENSTNIP00000019366  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000019239  DNF....FDGLQ.VIFG-----TMLVW-------S........ELITPHAIRVQTPP--.........-RHIPGV.VE
ENSTNIP00000009911  ---....-----.---------S------------........----------------.........-------.--
ENSTNIP00000018930  ENF....FEGLQ.VVFG-----SMLVW-------S........ELITPHAIRVQTPP--.........-RHIPGV.VE
ENSTNIP00000008895  ---....----S.VRFVPQEMGAHTVNVRY-----........----------------.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........---------F------.........-------.--
ENSTNIP00000005679  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000002488  ---....-ETSQ.VKFIPREAGP------------........----------------.........-------.--
ENSTNIP00000007616  ---....-ETSQ.VKFIPREAGP------------........----------------.........-------.--
ENSTNIP00000003313  ---....-ETSQ.VKFIPREAGP------------........----------------.........-------.--
ENSTNIP00000002618  ---....-----.-HWTERSAGSSTAYTQNYSDEV........EYLNRREVL-------.........-------.--
ENSTNIP00000012827  ---....-----.----------------------........----------------.........G------.--
ENSTNIP00000004899  ---....-----.----------------------........-----R----------.........-------.--
ENSTNIP00000007675  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000001568  ---....-----.------------V---------........----------------.........-------.--
ENSTNIP00000018500  ---....-----.------L---------------........----------------.........-------.--
ENSTNIP00000004388  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------F-----........----------------.........-------.--
ENSTNIP00000003898  ---....-----.----------------------........-------IVCEISNAS.........SRTVT--.--
ENSTNIP00000000963  SHLda..GSNVS.VMFKDQPC------------TY........LRRGGQWLTCRTHA--.........--SLHGY.GN
ENSTNIP00000010401  SHLda..GSNVS.VMFKDQPC------------TY........LRRGGQWLTCRTHA--.........--SLHGY.GN
ENSTNIP00000006011  --V....-----.----------------------........----------------.........-------.--
ENSTNIP00000003313  ---....-----.----------------------........----------------.........------H.--
ENSTNIP00000002488  ---....-----.----------------------........----------------.........------H.--
ENSTNIP00000007616  ---....-----.----------------------........----------------.........------H.--
ENSTNIP00000007675  ---....-----.--------------W-------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.I---------------------........----------------.........-------.--
ENSTNIP00000000464  ---....-----.I---------------------........----------------.........-------.--
ENSTNIP00000019109  ---....-----.I---------------------........----------------.........-------.--
ENSTNIP00000003898  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000005012  ---....-----.----------------------........----------K-----.........-------.--
ENSTNIP00000000464  ---....-----.----------------------........----------K-----.........-------.--
ENSTNIP00000003313  ---....-----.-------YEGIHIPGSPLQFFV........DYIN------------.........-------.--
ENSTNIP00000002488  ---....-----.-------YEGIHIPGSPLQFFV........DYIN------------.........-------.--
ENSTNIP00000007616  ---....-----.-------YEGIHIPGSPLQFFV........DYIN------------.........-------.--
ENSTNIP00000008895  ---....-----.----------------------........----------------.........------V.--
ENSTNIP00000018500  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000009333  ---....-----.----------------------........----------------.........-----G-.--
ENSTNIP00000010401  TNLdiiqTPLIR.AKYNNHETLN----------LC........QVLSPTSMLCQAPEL-.........-------.--
ENSTNIP00000000963  TNLdiiqTPLIR.AKYNNHETLN----------LC........QVLSPTSMLCQAPEL-.........-------.--
ENSTNIP00000008895  ---....-----.----EIKYDGSHIPGSPLQFYV........DAINSGHVTAY-----.........-------.--
ENSTNIP00000009333  -SF....VPEMG.VHSVSVTADGEHVPGSPFQF--........----------------.........-------.--
ENSTNIP00000001925  ---....-----.-------------Y--------........----------------.........-------.--
ENSTNIP00000019147  ASL....DTGNK.----------LEVTVGKAACNI........QSLSPTMLTCKTSPY-.........----AVP.CK
ENSTNIP00000019148  ASL....DTGNK.----------LEVTVGKAACNI........QSLSPTMLTCKTSPY-.........----AVP.CK
ENSTNIP00000008163  FGF....SENAT.VTIGSNEC-KVVHA--------........---TDTELKCRTPA--.........--GTAGS.QT
ENSTNIP00000019109  ---....-----.----------------------........-------------P--.........-------.--
ENSTNIP00000008162  FGF....SENAT.VTIGSNEC-KVVHA--------........---TDTELKCRTPA--.........--GTAGS.QT
ENSTNIP00000007602  RNLltgrLSDIR.ITVGGVS------------CHIv.......KVYHPSNLKCVTGS--.........-SNRTGQ.HG
ENSTNIP00000012220  KNF....LKDTK.VIFQENVA-DEKSWKAEAEIDM........ELFHQ-----------.........-------.--
ENSTNIP00000008162  SGF....GADLQ.---------QISVTINSVPCNV........STVTDTQVYCKTGN--.........--NPGGT.YR
ENSTNIP00000006767  TNLlt..IQEPK.V--------RAKYGGVETSNFC........TLVNDSTMTCLAPG--.........-------.--
ENSTNIP00000006766  TNLlt..IQEPK.V--------RAKYGGVETSNFC........TLVNDSTMTCLAPG--.........-------.--
ENSTNIP00000013222  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000008163  NGF....APG--.---------NTSVLIGGQPCEI........RHVTPSTLHCITPP--.........--HVEGQ.VR
ENSTNIP00000006767  RHL....DAGSS.V--------SCIIN--KEECLF........VKRTNREIICITPA--.........--SLSGS.GP
ENSTNIP00000006766  RHL....DAGSS.V--------SCIIN--KEECLF........VKRTNREIICITPA--.........--SLSGS.GP
ENSTNIP00000008162  NGF....APG--.---------NTSVLIGGQPCEI........RHVTPSTLHCITPP--.........--HVEGQ.VR
ENSTNIP00000009803  ---....-----.----------------------........----------------.........------L.--
ENSTNIP00000008163  TGF....ISEN-.----------ASILVGTAKCHV........EQITNTTQVCRLGS--.........--ATAGT.YP
ENSTNIP00000010138  LHLd...AGRTR.---------KVTLNEVPCPIKRvtq.....PKGNVSSIICLS----.........-QHISEV.RD
ENSTNIP00000008162  TGF....ISEN-.----------ASILVGTAKCHV........EQITNTTQVCRLGS--.........--ATAGT.YP
ENSTNIP00000008003  KYL....NTASK.---------EDISITVGGVPCP........VLSFGDVITCTTGRYS.........E------.--
ENSTNIP00000021085  QGFd...LVQS-.---------ATMQVEGIGRTTC........GVISNNTIHCPSHP--.........-SSESQQ.TA
ENSTNIP00000008163  ---....-----.-RFFDQTDQPARVFVGGLPCEI........ENVSDDRITCRTAKQ-.........--DPA--.--
ENSTNIP00000008163  SGFsnn.ISDNR.VFFGD------------AECEV........KDASENELQCI-----.........-------.--
ENSTNIP00000008163  SGFgn..HADDV.VVFASNTELRITNV--------........---NDGNISARVDALP.........AGDHP--.--
ENSTNIP00000002804  ---....-----.--------------------V-........----------------.........-------.--
ENSTNIP00000008162  ---....-----.-RFFDQTDQPARVFVGGLPCEI........ENVSDDRITCRTAKQ-.........--DPA--.--
ENSTNIP00000008162  SGFsnn.ISDNR.VFFGD------------AECEV........KDASENELQC------.........-------.--
ENSTNIP00000007744  ---....-----.--------------------HV........QARSSTALAFYTPE--.........-------.--
ENSTNIP00000008163  SGF....PEG--.-----------HVTVASEWCAI........VSVNYTSVICDTSP--.........--SQPHG.GD
ENSTNIP00000007714  ---....-----.----------------------........----------H-----.........-------.--
ENSTNIP00000008162  SGFgn..HADDV.VVFASNTELRITNV--------........---NDGNISARVDALP.........AGDHP--.--
ENSTNIP00000008163  NGFgnt.TCA--.----------IEVIVGGQPCEV........INSTNADIMCRLRYDN.........RLPIG--.--
ENSTNIP00000019147  LNFgfvkTESFK.VPLV-----TVEVAGAHCKLLRq.......D---------------.........-------.--
ENSTNIP00000019148  LNFgfvkTESFK.VPLV-----TVEVAGAHCKLLRq.......D---------------.........-------.--
ENSTNIP00000018520  ---....-----.----------------------........-------VPLTVYNYL.........--PTCAE.VH
ENSTNIP00000020566  ---....-----.----------------------........----------------.........--PESNV.VK
ENSTNIP00000008162  SGF....PEG--.-----------HVTVASEWCAI........VSVNYTSVICDTSP--.........--SQPHG.GD
ENSTNIP00000009105  ---....-----.----------------------........----QEHIRIHVPPPL.........-------.--
ENSTNIP00000008162  NGFgnt.TCA--.----------IEVIVGGQPCEV........INSTNADIMCRLRYDN.........RLPIG--.--
ENSTNIP00000005417  RNLd...VVQRP.VL---------AVWVEPV----........---EVQRMTCRTPR--.........-------.--
ENSTNIP00000004483  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000001542  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000018046  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000006346  SYL....NAGSY.V--------SVRFAQRPCFF--........----------------.........-------.--
ENSTNIP00000019061  SGFdfiqTAVMK.VH-------GNNMTAVEAGIEL........EYSSPEY---------.........-------.--
ENSTNIP00000004388  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000016904  ---....-----.----------------------........-------------S--.........-------.--
ENSTNIP00000022219  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000002960  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000010459  ---....-----.----------------------........----------------.........-------.--
ENSTNIP00000008492  ---....-----.-------------------V--........----------------.........-------.--
ENSTNIP00000011929  VTFsn..TSGLM.CRFHNNTVTEGY----------........----------------.........-------.--

                      0           90       100                                                      
                      |            |         |                                                      
d1a02n1               VNFYV..ING.KRKRSQPQHFTYHP-v...................................................
ENSTNIP00000015820  -----..---.---------------lheideesplfgiskqdletsdfeivvilegmveatamttqarssylaseil
ENSTNIP00000014157  -----..---.---------------gredldvlgltfrkdlfvansqmfpsppdleksltrlqerlmkklgehahpf
ENSTNIP00000001954  -----..---.---------------ygredldvlgltfrkdlfvansqmfpsppdleksltrlqerlmkklgehahp
ENSTNIP00000014574  -----..---.---------------pltvvheideesplfgiskqdlessdfeiviileglveatamttqarssylp
ENSTNIP00000014544  -----..---.---------------lkyvqqtfrkgvkvdktdymvgsygprpaeeydylttaeeapkgmlargtyn
ENSTNIP00000010486  -----..---.---------------gredldvlglsfrkdlyistfqafppvpeerkpnsrlqerllkklgqhahpf
ENSTNIP00000013758  -----..---.---------------lvsplvivheidkdsplysinraeleadnfeivvilegmveatamttqfrss
ENSTNIP00000012673  -----..---.-S-------------rttaegeyipldqvdidvgfdsgldriflvspitivheidedspfyemsked
ENSTNIP00000022103  -----..---.---------------ivvilegivettgmtcqartsytedevlwghrflpvmsleegffrvdysqfh
ENSTNIP00000010457  -----..---.---------------nvgystgddrlflvspliicheinekspfwdisqahlakeeleivvilegmv
ENSTNIP00000017993  -----..---.---------------plticheinpkspffdlskrslmneqfeivvilegivettgmtcqartsyte
ENSTNIP00000006675  -----..---.---------------lfaktievfppaekdqkpanlqnrlltklgqnaypftftipqnlpcsvtlqp
ENSTNIP00000002599  -----..---.---------------lfaktievfppaekdqkpanlqnrlltklgqnaypftftipqnlpcsvtlqp
ENSTNIP00000007179  -----..---.---------------yddgldrlflvsplvvvheinrnsplydmsrddlqredfeivvilegmveat
ENSTNIP00000019582  -----..---.---------------pltichvidtkspfydlsqrsmqteqfeivvilegivettgmtcqartsyte
ENSTNIP00000009102  -----..---.---------------fetgddrlflvsplvisheidthspfwdmsqaqlekedfeivvilegmveat
ENSTNIP00000017145  -----..---.---------------kegveykikisfrvnreivsglkyvqqtyrkglridksdymvgsygprdcey
ENSTNIP00000009422  -----..---.---------------sdllhedievivvlegvvettgittqartsyvaeeilwgqrfvptvseeega
ENSTNIP00000009249  -----..---.---------------tsplydlsamelqcsdlevivilegvvettgittqartsyvseeilwghrfv
ENSTNIP00000005244  -----..---.---------------vsplvishtiergsplyelsaqalsaedleiivilegvvettgitmqartsy
ENSTNIP00000005246  -----..---.---------------vsplvishtiergsplyelsaqalsaedleiivilegvvettgitmqartsy
ENSTNIP00000014127  -----..---.---------------dmdvmgvafrrdlfvvtrqvypelqdkeqlthtkvqqrllqklgdnafpfff
ENSTNIP00000006368  -----..---.---------------flegtaestssacqvrtsyipqeiqwgytflpiisciqtgkyrvdfsnfsks
ENSTNIP00000009083  -----..---.---------------kvfvqlacafrygsedldvmglcfrkdiwfeciqlypeshkpslgamhetll
ENSTNIP00000002561  -----..---.---------------kvfvqlacafrygsedldvmglcfrkdiwfeciqlypeshkpslgamhetll
ENSTNIP00000001954  VNVHV..TNN.TNK------------tvkkmkvsvrqladiclfstaqykctvameesddvvppsstfckvftvtpfl
ENSTNIP00000019946  -----..---.-------C-------afrygsedldvmglsfrrdiwiqrvqvypptgdntaktpmqefllgkigeqg
ENSTNIP00000014157  -----..---.---T-----------vkkmkvsvrqladiclfstaqykctvameesddvvppsstfckvftvtpfla
ENSTNIP00000010486  -----..---.---T-----------vkrvkisvrqyadiclfstaqykcpvaqleaddqvsssstfckvytltptld
ENSTNIP00000010899  -----..---.---------------tgtdriflvspvtivheindespffeidrktlekdndlelvvilegmveata
ENSTNIP00000003800  -----..---.---------------vhqspvdfymdssgdcpflilpltfyhvldehsplaglnarnlrrhdfellv
ENSTNIP00000008976  -----..---.---------------qknvsfqvdtssdspflilpltfyhliddnsplrawaakdpelaefellvim
ENSTNIP00000010244  -----..---.---------------pltfyhviddssplrawaakgggwtdpeladfellvimsatveptsatcqvr
ENSTNIP00000000824  -----..---.---------------tvihridpssplyglgpedllgnhfemvvsftytgdstgllhqtrtsytptd
ENSTNIP00000007048  -----..-R-.---------------dhllksfdfdfgfcipnsrntcehiyefpqlseslvrqmvecpyetrsdsfy
ENSTNIP00000009940  -----..---.---------------gfvipnstntwqslieaapesqmmpanvltgnviietkfydddlhvstsrvr
ENSTNIP00000019946  -----..---.---------------leefgetvnsnstleksfqltpllsnnkekrglsvngrlkdgdthlasttls
ENSTNIP00000005358  -----..---.---------------cvaieetgdtvspgaslqktysllpllannrerrgialdgklkhedtnlass
ENSTNIP00000014413  ---H-..---.---------------yfqgrllksfdfdfgfcipnsrntcehiyefpqlpddlirqmvarpyetrsd
ENSTNIP00000019221  -----..---.---------------ntcehiyefpplsedsiqemilhpyetqsdsfyfvdnklvmhnkadysy...
ENSTNIP00000022950  -----..---.---K-----------sfdfefgfcmpsskntcehiyefpalseeimhemilhpyetqsdsfyfvdnk
ENSTNIP00000005358  -----..---.-------------D-dmdvmgvafrrelylstttgvpqplqnsrstprarrrllrklgeeefpyfnr
ENSTNIP00000002561  -----..---.---------------vlnkefgetvepngtyentlsitpmlnenkekrglaldgrlkdedtnlastt
ENSTNIP00000009083  -----..---.---------------vlnkefgetvepngtyentlsitpmlnenkekrglaldgrlkdedtnlastt
ENSTNIP00000006156  VKMQL..RRPsDREVSEPVDFQYLP-aepdeyrltekrkrtgdvfqslkl............................
ENSTNIP00000004888  -----..---.---------------hvldehsplaglnarnlrrhdfellvtlnatmestaatcqsrtsyipqeilf
ENSTNIP00000014127  --L--..---.---------------ysndkyvksvakeetsdqvapgtslkkdyalypllaynrerrgialdgrlrh
ENSTNIP00000020787  VPLV-..---.---------------knledgcwgaavvkqegnrihlsvnssataavgryqltvettctgghavsth
ENSTNIP00000002395  -----..---.---------------vfldgtaestssscqvrtsfipqeimwgynflpiisrskegryrvdfsnfsk
ENSTNIP00000013223  -----..---.---------------vfldgtaestssscqvrtsfipqeimwgynflpiisrskegryrvdfsnfsk
ENSTNIP00000005835  -----..---.---------------gtnpdynkgtyipifpnkdrksrwpgritntsdsvltigitplancivgkyh
ENSTNIP00000009178  -----..---.---------------hldqlgqqpcplfifpltfyhppgpsplyptlcegrnnhfelvvflsalreg
ENSTNIP00000010775  -----..---.---------------asavcgqyrltvtcgsaegeattthdcsknivmlfnpwcee...........
ENSTNIP00000005251  VFVQL..KRKsDNETSEPKPFTYHP-qvigsdkeevqrkrqktlpnfhdflhrg........................
ENSTNIP00000005249  VFVQL..KRKsDNETSEPKPFTYHP-qvigsdkeevqrkrqktlpnfhdflhrg........................
ENSTNIP00000005250  VFVQL..KRKsDNETSEPKPFTYHP-qvigsdkeevqrkrqktlpnfhdfhhrg........................
ENSTNIP00000016350  VFLQL..KRKkAGDSSDPKQFTYIP-hvqdkeevlrkkqkplphyepwfgg...........................
ENSTNIP00000015973  VPVTL..VRNdGIIYSTTLTFTYTP-....................................................
ENSTNIP00000010563  VSVSL..RRIsDQMESEPIGFTYLP-hnpdpyevkrkrkqtappwqsspstsqt........................
ENSTNIP00000021888  -----..---.---------------seqygtravfglsaiinnscwsaavtsppgdtlalsicsapdapigrysltl
ENSTNIP00000021411  -----..---.---------------twqvarleggqdqappppgrawawklwelqaplppgaqeleivckavdssyn
ENSTNIP00000020537  -----..---.---------------skavvygivagipvhfnipsddgcksgihcpilvqhsysyindlpvkseypa
ENSTNIP00000005012  -----..---.---------------seakisckdnkdgscsveyipftpgdydvnitygghpipgspfqvpvkdpvd
ENSTNIP00000019109  -----..---.---------------seakisckdnkdgscsveyipftpgdydvnitygghpipgspfqvpvkdpvd
ENSTNIP00000000464  -----..---.---------------seakisckdnkdgscsveyipftpgdydvnitygghpipgspfqvpvkdpv.
ENSTNIP00000007616  -----..---.---------------gglglamegpseakmscidnkdgscsveyvpyepgtynlnityggqpitgsp
ENSTNIP00000003313  -----..---.---------------gglglamegpseakmscidnkdgscsveyvpyepgtynlnityggqpitgsp
ENSTNIP00000002488  -----..---.---------------tgglglamegpseakmscidnkdgscsveyvpyepgtynlnityggqpitgs
ENSTNIP00000003313  -----..---.---------------mtgrytilikyggdeipyspyriralptgd......................
ENSTNIP00000001789  -----..---.---------------swtmlpsvigvvsvtvtaeavashascdneivsvpergrtdtvtrslivk..
ENSTNIP00000002977  -----..---.---------------swtmlpsvigvvsvtvtaeavashascdneivsvpergrtdtvtrslivk..
ENSTNIP00000001513  -----..---.---------------swtmlpsvigvvsvtvtaeavashascdneivsvpergrtdtvtrslivk..
ENSTNIP00000017397  -----..---.---------------swtmlpsvigvvsvtvtaeavashascdneivsvpergrtdtvtrslivk..
ENSTNIP00000017377  VSVT-..---.---------------aaavasevscnneivtvpmrgrvdkvtrtlivk...................
ENSTNIP00000007616  -----..---.---------------mtgrytilikyggdeipyspyriralpt........................
ENSTNIP00000008895  -----..---.---------------pseakmsckdnkdgsctveyipfnsgeydvnitfgglpipgspfsvpvr...
ENSTNIP00000002488  -----..---.---------------mtgrytilikyggdeipyspyriralp.........................
ENSTNIP00000006628  -----..---.---------------daaighyrlsvsvmsaggnvvelvekvqfhllfnpwckd.............
ENSTNIP00000008517  -----..---.---------------pgqivemqgsvvtvsvtpatdaivgryrvyvniltasgvirspknsntdlyl
ENSTNIP00000017383  -----..---.---------------clcgeesatftwivtpaalgipvklkvsaealktdvlcgnevatvpktgqid
ENSTNIP00000008384  -----..---.---------------clcgeesatftwivtpaalgipvklkvsaealktdvlcgnevatvpktgqid
ENSTNIP00000009333  -----..---.---------------seskmsckdnkdgscsveyvpfspglydinityggehipgspfrvpvtd...
ENSTNIP00000007897  VPLSL..IRAdGLIYRSSFSFTYTP-....................................................
ENSTNIP00000015072  VGIFV..MTN.AGRSNEAQTFTYVPDsvdnsesqavkteepsllepcifdgqpksiss....................
ENSTNIP00000003494  VGIFV..MTN.AGRSNEAQTFTYVPDsvdnsesqavkteepsllepcifdgqpksiss....................
ENSTNIP00000006950  -----..---.---T-----------gpviaplfpqkreegwwvvigdpksnslisikrltlqqkakvkldfvapamg
ENSTNIP00000006734  -----..---.---------------qpsetrgtlsrvripplpasrpakaawkmdldgsssasrgvvplavtppada
ENSTNIP00000009333  -----..---.--K------------akqpsigdngdgtycvsyvpdrtgrytivikyggddipaspyrvrava....
ENSTNIP00000000464  ---Q-..---.---------------dnrdgtytvsyvpdstgpytitikyggdeipyspyriqs.............
ENSTNIP00000007616  -----..---.---------------pkgleepckrkdlgdgvygfeyyptspgtysititwggqhiprspievkisp
ENSTNIP00000003313  -----..---.---------------pkgleepckrkdlgdgvygfeyyptspgtysititwggqhiprspievkisp
ENSTNIP00000002488  -----..---.---------------pkgleepckrkdlgdgvygfeyyptspgtysititwggqhiprspievkisp
ENSTNIP00000003313  -----..---.---------------vevvdngdqthtvnyvptregpysinvlyddeeiprspykvkvlpthdaskv
ENSTNIP00000002488  -----..---.---------------vevvdngdqthtvnyvptregpysinvlyddeeiprspykvkvlpthdaskv
ENSTNIP00000007616  -----..---.---------------vevvdngdqthtvnyvptregpysinvlyddeeiprspykvkvlpthdaskv
ENSTNIP00000014961  -----..---.---------------fglsgstpdtewrasatdgpsektvcvsitsaptapvglyalsvklegqktk
ENSTNIP00000008895  -----..---.---------------ptgvaepitvtdnndgthtanyspandgpytvcvkyadqevpcspfkiktlp
ENSTNIP00000012789  -----..---.---------------mkevkqlvanlrgeslssgktetwsgkmlkippvspsildcsiirveyslmv
ENSTNIP00000008895  -----..---.---------------nwngtytvsyvpdmtgrytitikyggdeipyspycihaiptgd.........
ENSTNIP00000000464  -----..---.---------------pceakiecqdngdgscsvyylptepgeyainilfadqhipgspfkapvr...
ENSTNIP00000005012  -----..---.---------------dgtytvsyvpdstgpytitikyggdeipyspyriqslptgd...........
ENSTNIP00000019109  -----..---.---------------dgtytvsyvpdstgpytitikyggdeipyspyriqslptgd...........
ENSTNIP00000005012  -----..---.---------------pceakiecqdngdgscsvyylptepgeyainilfadqhipgspfkapv....
ENSTNIP00000019109  -----..---.---------------pceakiecqdngdgscsvyylptepgeyainilfadqhipgspfkapv....
ENSTNIP00000009333  -----..---.---------------teakiecsdngdgtcsvsylptepgeylvnilfedvpipgspfradi.....
ENSTNIP00000013084  -----..---.---------------ikippvgpsilhcriikveymlkvcvdvpgtsklflelplvigtiplhpfgs
ENSTNIP00000005012  -----..---.---------------ptgaeeqvkvqdagnavynceyyplkpgkytvsitwgghpiprspfevevgg
ENSTNIP00000000464  -----..---.---------------ptgaeeqvkvqdagnavynceyyplkpgkytvsitwgghpiprspfevevgg
ENSTNIP00000019109  -----..---.---------------ptgaeeqvkvqdagnavynceyyplkpgkytvsitwgghpiprspfevevgg
ENSTNIP00000005012  V----..---.---------------knngdgthtvhytpaqdgpytvavkyaeqevphspfkvmsqpghdaskvras
ENSTNIP00000000464  V----..---.---------------knngdgthtvhytpaqdgpytvavkyaeqevphspfkvmsqpghdaskvras
ENSTNIP00000019109  V----..---.---------------knngdgthtvhytpaqdgpytvavkyaeqevphspfkvmsqpghdaskvras
ENSTNIP00000016574  -----..---.---------------qiqqlvsnlrgeplpqgksqswegkllkippvspsildcpiirveyalvvyv
ENSTNIP00000009333  VAVK-..---.---------------yaeedvprspfrfrvlpth.................................
ENSTNIP00000009333  -----..---.---------------csvtdnadgtysvaytpfenglhsvqvlyddtpvpkspfqvsvregcd....
ENSTNIP00000009333  -T---..---.---------------ywptepgeyavhvtcdnvdiehspfmalivpd....................
ENSTNIP00000021564  VNFCV..ING.KRKRSQPQHFTFTP-....................................................
ENSTNIP00000015432  VNFCV..ING.KRKRSQPQHFTFTP-....................................................
ENSTNIP00000007616  -----..---.---------------gdgtysvaytpyeegphsvevcydgmpvpkspfhvavtegcn..........
ENSTNIP00000003313  -----..---.---------------gdgtysvaytpyeegphsvevcydgmpvpkspfhvavtegcn..........
ENSTNIP00000002488  -----..---.---------------gdgtysvaytpyeegphsvevcydgmpvpkspfhvavtegcn..........
ENSTNIP00000005012  -----..---.---------------tckdnkdgtclvsylptapgdyniivkfdnkhipgspftakitgd.......
ENSTNIP00000000464  -----..---.---------------tckdnkdgtclvsylptapgdyniivkfdnkhipgspftakitgd.......
ENSTNIP00000019109  -----..---.---------------tckdnkdgtclvsylptapgdyniivkfdnkhipgspftakitgd.......
ENSTNIP00000003313  -----..---.---------------nqdgtctvsylpvlpgdysilvkyndkhipgspfsaritgd...........
ENSTNIP00000002488  -----..---.---------------nqdgtctvsylpvlpgdysilvkyndkhipgspfsaritgd...........
ENSTNIP00000007616  -----..---.---------------nqdgtctvsylpvlpgdysilvkyndkhipgspfsaritgd...........
ENSTNIP00000007616  VTCSV..CTP.---------------egaeldvdvvenedgtfdifytapqpgeyvicvrfggehipnspfqvtatd.
ENSTNIP00000002488  VTCSV..CTP.---------------egaeldvdvvenedgtfdifytapqpgeyvicvrfggehipnspfqvtaleg
ENSTNIP00000003313  -----..---.---------------aakdvevinnhdnthtvkytpvqqgplgigvtyggdhvpkspftvtvaptld
ENSTNIP00000002488  -----..---.---------------aakdvevinnhdnthtvkytpvqqgplgigvtyggdhvpkspftvtvaptld
ENSTNIP00000007616  -----..---.---------------aakdvevinnhdnthtvkytpvqqgplgigvtyggdhvpkspftvtvaptld
ENSTNIP00000006675  VPV--..---.---------------rqyadiclfsmaqykcqvahleaddqispsstschiytltpllrnnrekrgl
ENSTNIP00000008895  -----..---.---------------pceakiecqdngdgscsvsylptepgeyainilfaeqhvpgspfkavvq...
ENSTNIP00000021437  VNFFV..ING.KKKRSQPQHFLYTP-....................................................
ENSTNIP00000007616  -----..---.--Y------------tityiplypgsytltiryggqdvpnfparlnvepavdasgvrvfgpgve...
ENSTNIP00000002488  -----..---.--Y------------tityiplypgsytltiryggqdvpnfparlnvepavdasgvrvfgpgve...
ENSTNIP00000003313  -----..---.--Y------------tityiplypgsytltiryggqdvpnfparlnvepavdasgvrvfgpgve...
ENSTNIP00000008895  -----..---.---------------dkgdgscdvrywptepgdyavhvicddedikdspfmahvlsa..........
ENSTNIP00000014295  VQFYV..CNG.KRKRSQSQRFTYL--....................................................
ENSTNIP00000005012  VKVHV..INP.SG-------------tktesyltdkgdgtyrveytafedgihlievlyddvpvpkspfrvsvvegc.
ENSTNIP00000000464  VKVHV..INP.SG-------------tktesyltdkgdgtyrveytafedgihlievlyddvpvpkspfrvsvvegc.
ENSTNIP00000019109  VKVHV..INP.SG-------------tktesyltdkgdgtyrveytafedgihlievlyddvpvpkspfrvsvvegc.
ENSTNIP00000014296  VQFYV..CNG.KRKRSQSQRFTYL--....................................................
ENSTNIP00000003313  VDVQV..KDN.---------------gngtyscsytprkpvkhtamiswggvnipdspfrmnigagchpnkvkvsgpg
ENSTNIP00000002488  VDVQV..KDN.---------------gngtyscsytprkpvkhtamiswggvnipdspfrmnigagchpnkvkvsgpg
ENSTNIP00000007616  VDVQV..KDN.---------------gngtyscsytprkpvkhtamiswggvnipdspfrmnigagchpnkvkvsgpg
ENSTNIP00000008895  -----..---.---------------nikfadqhvpgspftvkvfgeg..............................
ENSTNIP00000002599  -----..---.-R-------------qyadiclfsmaqykcqvahleaddqispsstschiytltpllrnnrekrgla
ENSTNIP00000005012  -----..---.---------------cdvhywptepgdyavhvicddedikdspfiahilpaa...............
ENSTNIP00000008895  -----..---.---------------kaeiackdnkdgtctvsylptacgdynivvkfddkqipgspftakitg....
ENSTNIP00000019109  -----..---.---------------cdvhywptepgdyavhvicddedikdspfiahilpaa...............
ENSTNIP00000008895  VHVQ-..---.---------------nnrdgtysityiplfqglytitikyggcavpnfpsrllvdpavdttgvkvyg
ENSTNIP00000005012  -----..---.---------------gqalgdisigikcapgvvgpgeadidfdiikndndtftvkytppapgrytim
ENSTNIP00000008895  THFTV..YTKgAGKAQPEVHFT----aagkgsvvqdfeiidnhnysytvrytavqqgnmsiavchggdpipkspfhim
ENSTNIP00000019109  -----..---.---------------gqalgdisigikcapgvvgpgeadidfdiikndndtftvkytppapgrytim
ENSTNIP00000009333  -----..V--.---------------qpdgseveaqvlenedgtfdifytapapgnyviyvrfggeniphspfnvvas
ENSTNIP00000013288  -----..---.---------------fvaivdlpegehqykfyvdgqwthdpaepvvtnqmgtvnniiqvk.......
ENSTNIP00000005012  -----..---.---------------tiiitwgevnvpnspfrvlvgegsh...........................
ENSTNIP00000000464  -----..---.---------------tiiitwgevnvpnspfrvlvgegsh...........................
ENSTNIP00000019109  -----..---.---------------tiiitwgevnvpnspfrvlvgegsh...........................
ENSTNIP00000009333  -----..---.---------------gscgvsyvaqepgdyeisvkfneqhipdspflvpvaap..............
ENSTNIP00000009333  -----..---.--------V------fyyeyhpsspgkysvsiswggtqipkspfevavgeea...............
ENSTNIP00000000464  -----..---.---------------vvgpgeadidfdiikndndtftvkytppapgrytimvlfaeqeipispfkvk
ENSTNIP00000005012  -----..---.---------------vnikfaekhipgspftvkvtgeg.............................
ENSTNIP00000000464  -----..---.---------------vnikfaekhipgspftvkvtgeg.............................
ENSTNIP00000005012  -----..---.------E--------vhfaasrpgeavrdfeiidnhdysytvkytalqqgnmsisvthggdpipksp
ENSTNIP00000000464  -----..---.------E--------vhfaasrpgeavrdfeiidnhdysytvkytalqqgnmsisvthggdpipksp
ENSTNIP00000019109  -----..---.---------------vnikfaekhipgspftvkvtgeg.............................
ENSTNIP00000019109  -----..---.------E--------vhfaasrpgeavrdfeiidnhdysytvkytalqqgnmsisvthggdpipksp
ENSTNIP00000008895  -----..---.---------------adidfdiikndndtftvkytppgsgqytimvlfadqqipispfrikvepsh.
ENSTNIP00000003313  -----..---.---------------dgssgvsyivqepgdyevsirfndehipdspfivpvasps............
ENSTNIP00000002488  -----..---.---------------dgssgvsyivqepgdyevsirfndehipdspfivpvasps............
ENSTNIP00000007616  -----..---.---------------dgssgvsyivqepgdyevsirfndehipdspfivpvasps............
ENSTNIP00000006011  -----..---.--G------------isnklndsswameeqyfnstlsvadkgtlaagehcfpfqfvipvavptsfeg
ENSTNIP00000013084  -----..---.---------------lqadngevsvlpagrhefpfsfqlpeetlvtsfegkhgsirywvkvklhrpr
ENSTNIP00000009333  VMMED..KGD.GV-------------yrctyrptqagthgvtvtfggvgipkspfsvdvgpa................
ENSTNIP00000005012  -----..---.---------------ygghmiphfpkvlqvdpsvdtsgvhvygpgve....................
ENSTNIP00000000464  -----..---.---------------ygghmiphfpkvlqvdpsvdtsgvhvygpgve....................
ENSTNIP00000019109  -----..---.---------------ygghmiphfpkvlqvdpsvdtsgvhvygpgve....................
ENSTNIP00000008895  -----..---.---------------khtiiitwagvtvpnspfrvmvgegshpenvkvygpgve.............
ENSTNIP00000009333  -----..---.---------------dmedrickvsycptepgnyfvsirfaeehipgspftvhvtgeg.........
ENSTNIP00000009872  -----..---.---------------egldlhrpsiwifspasasvgsygfqlcvftlgkirrcmmgqfvllcnpwcp
ENSTNIP00000000464  -----..---.---------------ksrtytvtyvpkvegvhkvkvlfagqdidkspytvnvak.............
ENSTNIP00000005012  -----..---.---------------ksrtytvtyvpkvegvhkvkvlfagqdidkspytvnvak.............
ENSTNIP00000019109  -----..---.---------------ksrtytvtyvpkvegvhkvkvlfagqdidkspytvnvak.............
ENSTNIP00000000464  VTCKV..---.---------------qtpqgmeldmdvvenhdgtfdiyytapepgkyvitirfggqnipkspfhvvv
ENSTNIP00000009333  -----..---.---------------diipnandtftvkyippaagkmtvkvlftdkevpqspfqvtvdpsh......
ENSTNIP00000016574  -----..---.-----Y---------tqnyteeveylhhydtligeerdedcpdenvtvlhtglhefafnfnlpqmal
ENSTNIP00000018364  -----..---.---------------plnkshndfvaildlpegehqykffvdgqwvhdiseptvtselgtinnliqv
ENSTNIP00000000464  -----..---.---------------vfrctyrpvlegphtihvlfaeqeipkspytvniaea...............
ENSTNIP00000009333  -----..---.---------------tcsvsylptlpgdysiivkynqdhipgspftaritg................
ENSTNIP00000003313  -----..---.---------------nsyrctykptqegqhiisvtfaggqisrspftvsvgeacn............
ENSTNIP00000002488  -----..---.---------------nsyrctykptqegqhiisvtfaggqisrspftvsvgeacn............
ENSTNIP00000007616  -----..---.---------------nsyrctykptqegqhiisvtfaggqisrspftvsvgeacn............
ENSTNIP00000019109  -----..---.---------------drkdgscgvsyivkepgdyevsikfnnehipdspfivpia............
ENSTNIP00000005012  -----..---.---------------drkdgscgvsyivkepgdyevsikfnnehipdspfivpia............
ENSTNIP00000000464  -----..---.---------------drkdgscgvsyivkepgdyevsikfnnehipdspfivpia............
ENSTNIP00000003313  -----..---.---------------dqedgtckvtycptepgnyiinikfadqhvpagsaftvkvtgeg........
ENSTNIP00000002488  -----..---.---------------dqedgtckvtycptepgnyiinikfadqhvpagsaftvkvtgeg........
ENSTNIP00000007616  -----..---.---------------dqedgtckvtycptepgnyiinikfadqhvpagsaftvkvtgeg........
ENSTNIP00000018732  -----..---.---K-----------aettvvdnsdgtysvsytpdqegaysvwvcvraqhvqgspfaltv.......
ENSTNIP00000003313  VTCSV..CTP.---------------egaeldvdvvenedgtfdifytapqpgeyvicvrfggehipnspfqvtaleg
ENSTNIP00000008895  -----..---.---------------fedrkdgscgvsyvvqgpgdyeisikfndehipdspftvpis..........
ENSTNIP00000009333  -----..---.---------------vsfsspvkdfdiidnydysqtvkytpakqgeltivvtfggdpiskspftvgv
ENSTNIP00000003313  -----..---.---------------wptepgeyavhvlcnnediqhspfmaeivtp.....................
ENSTNIP00000002488  -----..---.---------------wptepgeyavhvlcnnediqhspfmaeivtp.....................
ENSTNIP00000007616  -----..---.---------------wptepgeyavhvlcnnediqhspfmaeivtp.....................
ENSTNIP00000008895  -----..---.---------------vvemgndmfecsyypvsrgkyvvtiswgghnip...................
ENSTNIP00000001925  -----..---.---------------psasekvtrvitipqdiepsifncsiikaehrlrvyldvkyasdpeikfpiv
ENSTNIP00000001568  -----..---.---------------psasekvtrvitipqdiepsifncsiikaehrlrvyldvkyasdpeikfpiv
ENSTNIP00000014417  -----..---.---------------gehqykfsvdghwmldpngavatsrtgvvnntiqvkrtdfe...........
ENSTNIP00000008895  -----..-T-.---------------pdgaeldvdvvenadgtfdvyytapepgkyvitirfggenipnspfhvvvek
ENSTNIP00000000464  -----..---.---------------vhywptepgdyavhvicddedikdspfiahilpaa.................
ENSTNIP00000009333  -----..---.---------------yggpyhvsgspfkakvtgp.................................
ENSTNIP00000003313  -----..---.---------------rtysvfytprvtgmhkvtvlfagqhiskspfevei.................
ENSTNIP00000002488  -----..---.---------------rtysvfytprvtgmhkvtvlfagqhiskspfevei.................
ENSTNIP00000007616  -----..---.---------------rtysvfytprvtgmhkvtvlfagqhiskspfevei.................
ENSTNIP00000005497  VNFYV..CNG.KKKRSQHQHFTFVP-....................................................
ENSTNIP00000012789  -----..---.---------------ytqnyteeveylnhkdiligherdddnseeglttihsgrheyafslelpqtp
ENSTNIP00000008895  -----..---.---------------eevyvkhmgnrmynvtytvkeqgsyilivkwgddnvpgspfhvtv.......
ENSTNIP00000005012  -----..---.---------------rctyrpvlegphtihvlfaeqeipkspytvniaea.................
ENSTNIP00000019109  -----..---.---------------rctyrpvlegphtihvlfaeqeipkspytvniaea.................
ENSTNIP00000009333  -----..---.---------------irfiprenglhtidvkfngshipgspfqvrvgepgq................
ENSTNIP00000009333  -----..--D.---------------glysccytpaapikhtlaltwggvsipkspfrvnvgkgs.............
ENSTNIP00000006205  VSLYV..SNG.KRKRSSTHCFKFLP-s...................................................
ENSTNIP00000009333  -----..---.-------Q-------tvtyvplssgmytlllryggrpvpgfpakvmahpavdtsgvrafgpgld...
ENSTNIP00000007616  -----..---.---------------tpmapgsylisikyggpyhivgspfkaris......................
ENSTNIP00000002488  -----..---.---------------tpmapgsylisikyggpyhivgspfkaris......................
ENSTNIP00000003313  -----..---.---------------tpmapgsylisikyggpyhivgspfkaris......................
ENSTNIP00000008895  -----..---.---------------ytptapgnylisikyggpqhivgspfkakvtgp...................
ENSTNIP00000009333  VTVYL..DHP.DGSREE---------aqlkaepnegkkthsvsyvpqvtgphrvtvlfagqqipkspfevnvdk....
ENSTNIP00000005012  -----..---.---------------yggpqhivgspfkakitg..................................
ENSTNIP00000000464  -----..---.---------------yggpqhivgspfkakitg..................................
ENSTNIP00000019109  -----..---.---------------yggpqhivgspfkakitg..................................
ENSTNIP00000003313  -----..---.---------------kyavrfiprenglylidvkfngshipgspfkirvgetg..............
ENSTNIP00000002488  -----..---.---------------kyavrfiprenglylidvkfngshipgspfkirvgetg..............
ENSTNIP00000007616  -----..---.---------------kyavrfiprenglylidvkfngshipgspfkirvgetg..............
ENSTNIP00000001133  -----..---.---------------gvtnkvndtswnveeqyfnstisvadkgtlkqgkhvfpfkfllpascptsfe
ENSTNIP00000012114  VSVLV..C--.---------------nrhiqgspfkvtvksg....................................
ENSTNIP00000002873  -----..---.---------------gvtnkvndtswnveeqyfnstisvadkgtlkqgkhvfpfkfllpascptsfe
ENSTNIP00000008895  -----..---.---------------vylpkvegfhqvkvlfagqdidrspfrvnvsk....................
ENSTNIP00000009333  -----..---.---------------lvkhegnlrycvsyqlreagsyslvvkwgedhipgspfhvtv..........
ENSTNIP00000005012  -----..---.---------------khmgnklynvtyaikdkgsyqiivkwgddnvpgspykvv.............
ENSTNIP00000000464  -----..---.---------------khmgnklynvtyaikdkgsyqiivkwgddnvpgspykvv.............
ENSTNIP00000019109  -----..---.---------------khmgnklynvtyaikdkgsyqiivkwgddnvpgspykvv.............
ENSTNIP00000008895  -----..---.---------------vfrctyipvleglhmvhvtfagqqiprspfaahiseacn.............
ENSTNIP00000019406  -----..---.---------------kvwqnkskgakktakskkkkltkkkttpapakskqangnvagaeaattaaat
ENSTNIP00000000464  -----..---.---------------yrgqhvpgspfqftvgpmgeggahkvraggpgler.................
ENSTNIP00000005012  -----..---.---------------yrgqhvpgspfqftvgpmgeggahkvraggpgler.................
ENSTNIP00000002873  -----..---.---------------vewkeqiivpplpqsslagcelikveyyvkvrlkfpdvlltlpihignvsld
ENSTNIP00000019109  -----..---.---------------yrgqhvpgspfqftvgpmgeggahkvraggpgler.................
ENSTNIP00000008895  -----..---.---------------tdayitdkgdgtyrveytphedglhlievlfdevllpkspfrvlvtegcdp.
ENSTNIP00000001133  -----..---.---------------vewkeqiivpplpqsslagcelikveyyvkvrlkfpdvlltlpihignvsld
ENSTNIP00000007616  -----..---.---------------vkytppgagsytimvlfadqaipmtpirikvdpah.................
ENSTNIP00000003313  -----..---.---------------vkytppgagsytimvlfadqaipmtpirikvdpah.................
ENSTNIP00000002488  -----..---.---------------vkytppgagsytimvlfadqaipmtpirikvdpah.................
ENSTNIP00000005680  -----..---.----S----------gnavlsaevftpdgsivdgelvdhnngtyefvyvipregdfslalrlydqhi
ENSTNIP00000005012  VTC--..---.---------------kvqtpqgmeldmdvvenhdgtfdiyytapepgkyvitirfggqnipkspfhv
ENSTNIP00000019109  VTC--..---.---------------kvqtpqgmeldmdvvenhdgtfdiyytapepgkyvitirfggqnipkspfhv
ENSTNIP00000008895  -----..---.---------------pcklesgvnnevytvtyippeegayrvdisydgnpvpgspfav.........
ENSTNIP00000000464  --M--..---.---------------tspsgrpipcklesdkakgihsvkyippeeghykvdvsydgnpvmgspfgve
ENSTNIP00000005012  --M--..---.---------------tspsgrpipcklesdkakgihsvkyippeeghykvdvsydgnpvmgspfgve
ENSTNIP00000019109  --M--..---.---------------tspsgrpipcklesdkakgihsvkyippeeghykvdvsydgnpvmgspfgve
ENSTNIP00000007616  -----..---.---------------lvkhlgnrmynvsyqlkekgeyilvvkwgdehipgspyhitv..........
ENSTNIP00000003313  -----..---.---------------lvkhlgnrmynvsyqlkekgeyilvvkwgdehipgspyhitv..........
ENSTNIP00000002488  -----..---.---------------lvkhlgnrmynvsyqlkekgeyilvvkwgdehipgspyhitv..........
ENSTNIP00000009333  VRVV-..---.---------------rytpteegvhainvtydghtvpgspfpvdaqlppdpskvkasgpglk.....
ENSTNIP00000005012  -----..---.---------------teldsdknairfiprengvhsidvkfngchipgspfnvrvgdp.........
ENSTNIP00000000464  -----..---.---------------teldsdknairfiprengvhsidvkfngchipgspfnvrvgdp.........
ENSTNIP00000019109  -----..---.---------------teldsdknairfiprengvhsidvkfngchipgspfnvrvgdp.........
ENSTNIP00000002488  -----..---.---------------htvsvkyqgshvpgspfqftvgplgeggahkvraggpgler...........
ENSTNIP00000007616  -----..---.---------------htvsvkyqgshvpgspfqftvgplgeggahkvraggpgler...........
ENSTNIP00000003313  -----..---.---------------htvsvkyqgshvpgspfqftvgplgeggahkvraggpgler...........
ENSTNIP00000015515  LQVA-..-IS.NQIISNSVVFEY---....................................................
ENSTNIP00000020196  VTLSY..KSK.QFCKGAPGRFVYT--a...................................................
ENSTNIP00000019366  VTVTT..KDK.---------------dgelvktgnaalraeilsadgtcteaevvdnkngtyevgytirsegeftfsl
ENSTNIP00000019239  VTLSY..KSK.QFCKGTPGRFIYT--....................................................
ENSTNIP00000009911  -----..---.---------------elckmgnavitaelsssdgskgegeildnkngtyeylftapkegtfnlslrl
ENSTNIP00000018930  VTLSY..KSK.QFCKGAPGRFIYT--....................................................
ENSTNIP00000008895  -----..---.---------------rdqhvpgspfqftvgplgeggahkvraggtgldr..................
ENSTNIP00000008895  -----..---.---------------iprenglhtidvrfngshipgspfkirvgel.....................
ENSTNIP00000005679  -----..---.---K-----------sgnavlsaevftpdgsivdgelvdhnngtyefvyvipregdflgvrlydqhi
ENSTNIP00000002488  -----..---.---------------yqveltydgvpipgspfsptaysasd..........................
ENSTNIP00000007616  -----..---.---------------yqveltydgvpipgspfsptaysasd..........................
ENSTNIP00000003313  -----..---.---------------yqveltydgvpipgspfsptaysasd..........................
ENSTNIP00000002618  -----..---.---------------lqadngevsvlagrhefpfsfqlpeetlvtsfegkhgsirywvkvklhprat
ENSTNIP00000012827  -----..---.---------------elvrtgnavlkaeitltdgsrgaetevsdnkngtyevgytlhsegeysfslm
ENSTNIP00000004899  -----..---.---------------evllqavkdqwvksgdeitarsrssagrhefpfsfqlpeetlvtsfegkhgs
ENSTNIP00000007675  -----..---.---------F-----elpqngqlvssykgkfgyvhycvkavmerpqqpaleckkafeveepldvntp
ENSTNIP00000001568  -----..---.---------------yhskekyftfknyfirdkkatgdnvvapgchvypftfqipyqimppsfkgad
ENSTNIP00000018500  -----..---.---------------glhhqqqyqqnekyykikhyilkesrqdgtevigkgrhvfpfsfqipdrnip
ENSTNIP00000004388  -----..---.G--------------dyevsirfndehipdspfivpvaspsd.........................
ENSTNIP00000009333  -----..---.---------------kngqhianspitimvvqsevgnasqvraygdgleq.................
ENSTNIP00000003898  -----..---.---------------pkmkllqkqnfythnkvsrrlysqtlasvnghtisphssevhtellltipss
ENSTNIP00000000963  VSVSV..SID.KAHLQKDLRFEYV--....................................................
ENSTNIP00000010401  VSVSV..SID.KAHLQKDLRFEYV--....................................................
ENSTNIP00000006011  -----..---.---------------kagkhaewreqiivpplpqsalagcslidieyfiqvslkspdavvtlpiyig
ENSTNIP00000003313  -----..---.---------------vgisfvpkeigehlvnikkngrhipnspisvmire.................
ENSTNIP00000002488  -----..---.---------------vgisfvpkeigehlvnikkngrhipnspisvmire.................
ENSTNIP00000006954  IIVTT..KSG.GLG------------tstvsfkl............................................
ENSTNIP00000007616  -----..---.---------------vgisfvpkeigehlvnikkngrhipnspisvmire.................
ENSTNIP00000007675  -----..---.---------------qgktirvpkikpsmlscniirveyalmiyvhipgseklilelplvigtaglg
ENSTNIP00000005012  -----..---.---------------sftpkevgehevsvrkngvhvanspfkimvgq....................
ENSTNIP00000000464  -----..---.---------------sftpkevgehevsvrkngvhvanspfkimvgq....................
ENSTNIP00000006346  VCVKD..CIN.DYRALSPRPFTFV--t...................................................
ENSTNIP00000019109  -----..---.---------------sftpkevgehevsvrkngvhvanspfkimvgq....................
ENSTNIP00000003898  -----..---.------N--------ysarldyfhikssiledssgmppprqfapelrfkslkgkysmfppaaavggl
ENSTNIP00000005012  -----..---.---------------yqpterglhemdikyegnqipgsplqffvdavntgvvtaygpgl........
ENSTNIP00000000464  -----..---.---------------yqpterglhemdikyegnqipgsplqffvdavntgvvtaygpgl........
ENSTNIP00000003313  -----..---.---------------sgnvsaygpgl.........................................
ENSTNIP00000002488  -----..---.---------------sgnvsaygpgl.........................................
ENSTNIP00000007616  -----..---.---------------sgnvsaygpgl.........................................
ENSTNIP00000008895  -----..---.---------------vsvkktgkhvsnspfrimvgqseigdaskvkvfgqgl...............
ENSTNIP00000018500  ----I..---.---------------tncscrsvkptfalyerqsffaqgkrtvharnilkvmaeaieggkkkavtql
ENSTNIP00000009333  -----..---.---------------lhemhikyngthipesplqfyvnhanspsmtahgpgl...............
ENSTNIP00000010401  -----..---.---------------pislarqqevlekpdefgfklddvqslmalnntnfiyypn............
ENSTNIP00000000963  -----..---.---------------pislarqqevlekpdefgfklddvqslmalnntnfiyypn............
ENSTNIP00000008895  -----..---.---------------gpglth..............................................
ENSTNIP00000009333  -----..---.---------------tvgplgeggaskvraggqgl................................
ENSTNIP00000001925  -----..---.---------------hskekyftfknyfirdkkatdddaealittetgeyysnvvapgchvypftfq
ENSTNIP00000019147  QPVKL..TVD.SVERQAPLLFTY---nr..................................................
ENSTNIP00000019148  QPVKL..TVD.SVERQAPLLFTY---nr..................................................
ENSTNIP00000003258  IIVTT..KSG.GLG------------tstvsfkl............................................
ENSTNIP00000011053  IIVTT..KSG.GLG------------tstvsfkl............................................
ENSTNIP00000007602  VSVKV..SGG.DLGLSTDL-FTY---qdp.................................................
ENSTNIP00000008163  ITVTV..S--.KMSQAASSSFTY---....................................................
ENSTNIP00000019109  -----..---.---------------terglhemdikyegnqipgsplqffvdavntgvvtaygpgls..........
ENSTNIP00000006767  LCIGV..CSA.EFRTLSSQTYSFV--s...................................................
ENSTNIP00000006766  LCIGV..CSA.EFRTLSSQTYSFV--s...................................................
ENSTNIP00000008162  ITVTV..S--.KMSQAASSSFTY---....................................................
ENSTNIP00000019061  VEVEV..KGE.KRGMSFIN-FTY---rdp.................................................
ENSTNIP00000007602  VTLHY..NSG.QRHLHSSA-YTY---th..................................................
ENSTNIP00000012220  -----..---.---------------....................................................
ENSTNIP00000008162  VMLYH..KE-.KGHAQSDVTFTY---....................................................
ENSTNIP00000010401  VCVGVgeCRP.EFMAKSSKY------yy..................................................
ENSTNIP00000000963  VCVGVgeCRP.EFMAKSSKY------yy..................................................
ENSTNIP00000002265  VPVTV..LID.SFQVTTTKTFHY---k...................................................
ENSTNIP00000017783  VPVTV..LID.SFQVTTTKTFHY---k...................................................
ENSTNIP00000006767  -----..---.---------------lvynklappegalhpeefgfifdqvssllvlnstpfthypn...........
ENSTNIP00000006766  -----..---.---------------lvynklappegalhpeefgfifdqvssllvlnstpfthypn...........
ENSTNIP00000021085  VDV--..-DQ.SGTGTSKESFSY---l...................................................
ENSTNIP00000013222  -----..---.---------------vspliisheinekspfwemslaqmekeefeivvilegmveat..........
ENSTNIP00000008163  TDIWV..LST.---------------qyppltfn............................................
ENSTNIP00000006767  ASIRL..MIDkAEVTSSETKYVYT--e...................................................
ENSTNIP00000006766  ASIRL..MIDkAEVTSSETKYVYT--e...................................................
ENSTNIP00000008162  VRVSI..KDQ.GVAKMDNADFFY---i...................................................
ENSTNIP00000008162  TDIWV..LST.---------------qyppltfn............................................
ENSTNIP00000008003  VLV--..-EG.GRSGMSEFNFTY---rdp.................................................
ENSTNIP00000009803  -----..---.---------------triwlqvldrkdgsflvryrmyatysdlhihvllkneqvanspfll......
ENSTNIP00000008163  VTVSF..---.---------------pslghs..............................................
ENSTNIP00000010138  VPLSV..FID.KSPIPTTKVFYYK--en..................................................
ENSTNIP00000008162  VTVSF..---.---------------pslghs..............................................
ENSTNIP00000006346  IGFYL..DNV.NALVVVNKTFSYYP-d...................................................
ENSTNIP00000021085  VCVEF..---.---------------enltcq..............................................
ENSTNIP00000002265  -----..---.---------------kpgqdlk.............................................
ENSTNIP00000017783  -----..---.---------------kpgqdlk.............................................
ENSTNIP00000008003  -----..---.---------------q...................................................
ENSTNIP00000021085  VQFF-..---.---------------lngvlytd............................................
ENSTNIP00000008163  -----..---.---------------skktvypggrglkieawndtrsnqlsdvf.......................
ENSTNIP00000019061  -----..---.---------------tvkygksttttipnvfqfven...............................
ENSTNIP00000008163  -----..---.---------------lqteqkt.............................................
ENSTNIP00000007472  VRVGA..APP.G---RSLQVFTYQ--dp..................................................
ENSTNIP00000009146  VRVGA..APP.G---RSLQVFTYQ--dp..................................................
ENSTNIP00000008163  -----..---.---------------ikvivrskglas........................................
ENSTNIP00000002804  -----..---.---------------ppgeatptsivfsvtelgpanitaraiaysepsccsdefqa...........
ENSTNIP00000008162  -----..---.---------------skktvypggrglkieawndtrsnqlsdvf.......................
ENSTNIP00000008162  -----..---.---------------ilqteqk.............................................
ENSTNIP00000007744  -----..---.---------------rt..................................................
ENSTNIP00000008163  VIFQ-..---.---------------igniqsschsnc........................................
ENSTNIP00000007714  -----..---.---------------tqtfqsrrtymlgsfvllfnpwlke...........................
ENSTNIP00000008162  -----..---.---------------ikvivrskglas........................................
ENSTNIP00000008163  -----..---.---------------vahavvvrian.........................................
ENSTNIP00000010138  -----..---.---------------eegelsfdmdgdlglwnrefsyhp............................
ENSTNIP00000019147  -----..---.---------------yinrwteiqcspmsagnftpsghtvkvt........................
ENSTNIP00000019148  -----..---.---------------yinrwteiqcspmsagnftpsghtvkvt........................
ENSTNIP00000018520  VKV--..---.---------------svpkgikfv...........................................
ENSTNIP00000020566  VAFTV..R--.---------------kagryevavklgglnvayspyykifqpg........................
ENSTNIP00000008162  VIFQ-..---.---------------igniqsschsnc........................................
ENSTNIP00000009105  -----..---.---------------drqdgsflvryrlygtvqgglkvevhhqgvhvaespysl.............
ENSTNIP00000008162  -----..---.---------------vahavvvrian.........................................
ENSTNIP00000005417  -----..---.---------------vtpdlkikgvwfqmdnvrih................................
ENSTNIP00000004483  --N--..---.---------------mkvevkavpvsqkksvqpdnikklqrlpgnsspsssgpdltfgglptpklea
ENSTNIP00000001542  --N--..---.---------------mkvevkavpvsqkksvqpdnikklqrlpgnsspsssgpdltfgglptpklea
ENSTNIP00000018046  --N--..---.---------------mkvevkavpvsqkksvqpdnikklqrlpgnsspsssgpdltfgglptpklea
ENSTNIP00000010138  VN---..---.---------------itv.................................................
ENSTNIP00000002265  -----..---.---------------pdekesgqisihmedqrevwnssfeyhsn.......................
ENSTNIP00000017783  -----..---.---------------pdekesgqisihmedqrevwnssfeyhsn.......................
ENSTNIP00000006346  -----..---.---------------krkvk...............................................
ENSTNIP00000008162  VVVS-..-NK.LKTVNISNGFTY---....................................................
ENSTNIP00000006857  VRV--..---.---------------ggfeyspgtlqiys......................................
ENSTNIP00000019147  TKVAF..VLD.GYMTEQ---------k...................................................
ENSTNIP00000019148  TKVAF..VLD.GYMTEQ---------k...................................................
ENSTNIP00000006521  VRV--..---.---------------ggfeyspgtlqiys......................................
ENSTNIP00000019061  -----..---.---------------vlhpdyvahekndtviqfrsptvnsslnqhvrtyiqldnwvkelkpfdy...
ENSTNIP00000004388  --V--..---.---------------slngakgmidakvhspsgaleecciteid.......................
ENSTNIP00000016904  -----..---.---------------pelgagvagrvldhrngfysalfpllwvgpaqvevtl...............
ENSTNIP00000022219  -----..---.---------------wdkfshpyskrdfgkweltlppkh............................
ENSTNIP00000002960  -----..---.---------------wdkfshpyskrdfgkweltlppkh............................
ENSTNIP00000010459  -----..-S-.---------------vgvfeafynsvkpiqlissnievakagkvppgkteipfefplntksnkvlye
ENSTNIP00000008492  -----..---.---------------vdhlngsysalfslpwegsaqvevtl..........................
ENSTNIP00000011929  -----..---.---------------vdghgrghcvspllyrtglvsleisyngsaf.....................
ENSTNIP00000010401  -----..---.---------------kvlvs...............................................
ENSTNIP00000000963  -----..---.---------------kvlvs...............................................

d1a02n1               ..............................................................................
ENSTNIP00000015820  wghrfepvlfeeknmykvdyshfhktyevpstprcsakdm......................................
ENSTNIP00000014157  tfkiplnlpcsvtlqpgpedtgkacgvdfevkafcaenpeekihkrnsvrlvirkvqyap..................
ENSTNIP00000001954  ftfkiplnlpcsvtlqpgpedtgkacgvdfevkafcaenpeekihkrnsvrlvirkvqyap.................
ENSTNIP00000014574  seilwghrfepvifeeksqyridyaffhktfevpstprcsakdmeerk..............................
ENSTNIP00000014544  ikskftdddkhdhlswewsltikkdwkd..................................................
ENSTNIP00000010486  yftipqnlpcsvtlqpgpedtgkacgvdfeirafcaksieekihkrnsvrlvirkvqyap..................
ENSTNIP00000013758  ylarevlwghrfesviyedrdsykvdyarfhktyevpstphlsakeldeag...........................
ENSTNIP00000012673  lqtsefeivvilegmveatamttqcrssyvageilwghrfepvlfeeknyykvdysrfdntyevpstpvcsarelaek
ENSTNIP00000022103  ntfevptppysvkeqeeks...........................................................
ENSTNIP00000010457  eatgmtcqarssyvsseikwgyrftpvltledgfyevdynsfhdvyetntppysakeladi.................
ENSTNIP00000017993  devlwghrflpvmsleegffrvdysqfhstfevptpphsvkehaekn...............................
ENSTNIP00000006675  gpqdsgkacgvdyelqafcaksadekihhrnsvhlvirkvqfap..................................
ENSTNIP00000002599  gpqdsgkacgvdyelqafcaksadekihhrnsvhlvirkvqfap..................................
ENSTNIP00000007179  amttqarssylakeilwghrfepvvlekadrfhvdysrfhktyevpstplcsarelnq....................
ENSTNIP00000019582  devlwghrffpvisleegffkvdysqfhatfevptppysvkeqee.................................
ENSTNIP00000009102  agmtcqarssylaeevlwghrfspmmslaegffdvdygafhhtfevdtpscsarelsl....................
ENSTNIP00000017145  dfvtsmeeaptglmargqyaikskftdddkhdhlswewnlnikkdwt...............................
ENSTNIP00000009422  yavdyskfgntvrvptplcsarkldeag..................................................
ENSTNIP00000009249  pivteeegvysvdyskfgntvkvntplcsareldekp.........................................
ENSTNIP00000005244  tpeeilwgrrfvsiiseedgrycvdyskfgntvpvrmpllsakeldqs..............................
ENSTNIP00000005246  tpeeilwgrrfvsiiseedgrycvdyskfgntvpvrmpllsakeldqs..............................
ENSTNIP00000014127  efpdnlpcsvalqpgpsdvgkkcavefevkgfcgqnqddrqdkqssvrlsirkvqfsp....................
ENSTNIP00000006368  vrvstphcvhcceadsdq............................................................
ENSTNIP00000009083  kkagdnaypftfeipnnlpcsvslqpgpddkgkacgvdfevktylakeksnpdekiekkdtarliirkiqyap.....
ENSTNIP00000002561  kkagdnaypftfeipnnlpcsvslqpgpddkgkacgvdfevktylakeksnpdekiekkdtarliirkiqyap.....
ENSTNIP00000001954  annrdkrglaldgklkhedtnlasstllgegaskeilgiivsykvkvklvvsrllgdltmsdvsielpftlmhpkpln
ENSTNIP00000019946  yafsfqmptdlpcsvslqpgpndsgkacgvdfevkaylanaphnvdeviekkdtcrlmirkiqfap............
ENSTNIP00000014157  nnrdkrglaldgklkhedtnlasstllgegaskeilgiivsykvkvklvvsrggdvsielpftlmhpkpledvdaddp
ENSTNIP00000010486  knrekrglaldgklkhedtnlasstivkdvtnkevlgilvsyrvkvklvvsrggdvsvelpfilmhpkpveppasrpq
ENSTNIP00000010899  mttqcrssyvaseilwghrfepvlferkecyqvrkae.........................................
ENSTNIP00000003800  tlnatmestaatcqsrtsyipqeilfgyefrpvlfsttggryvadfnffdkv..........................
ENSTNIP00000008976  satieptsatcqvrtsylpdeilwgyefppvvslsssgkyvanftffdkvskaktmpi....................
ENSTNIP00000010244  tsylpdeilwgyefppvvslspsgkyvadfaffdkvaktktpplfkqtl.............................
ENSTNIP00000000824  ihwgqrfqdvmklhkgrykvdyslfnatvwvpvpllsakefgr...................................
ENSTNIP00000007048  fadnrlvmhnkadyay..............................................................
ENSTNIP00000009940  lfyv..........................................................................
ENSTNIP00000019946  qgekemqgiivsykvkvnlmvsgggllggltgsdvtvelpltlmspkp..............................
ENSTNIP00000005358  smtkagvlkevmgimvsyrvtvklvvagmmgssevglevpfklmhpkpdsvreseveeevefqefkraylkgmmdde.
ENSTNIP00000014413  sfyfvdnklimhnkadyaf...........................................................
ENSTNIP00000019221  ..............................................................................
ENSTNIP00000022950  lvmhnkadysy...................................................................
ENSTNIP00000005358  gfrtltcasgewlwqpaphdvgndrcavefeikafsaesqdakvrkrstvklmirkvqfap.................
ENSTNIP00000002561  mlrqgiekevlgilvsykikinlivagggllggltasdvtvelplmlmhpkpe.........................
ENSTNIP00000009083  mlrqgiekevlgilvsykikinlivagggllggltasdvtvelplmlmhpkpe.........................
ENSTNIP00000006156  ..............................................................................
ENSTNIP00000004888  gyefrpvlfsttggryvadfnffdkv....................................................
ENSTNIP00000014127  edtnlasssivkqevlkevqgmlvsyklvvrmmacgtigssevslelpfrlmhpkpepakdsesgdmvfeefkraylk
ENSTNIP00000020787  hpdndvyilfnpwcee..............................................................
ENSTNIP00000002395  vvpvatahcaycfhnikghhh.........................................................
ENSTNIP00000013223  vvpvatahcaycfhnikghhh.........................................................
ENSTNIP00000005835  myvavmtpfgirrtkkestrdlyilfnpwsp...............................................
ENSTNIP00000009178  tgdicqkrtsylrqeiqfdrrflpalvldeqgryltklqhfd....................................
ENSTNIP00000010775  ..............................................................................
ENSTNIP00000005251  ..............................................................................
ENSTNIP00000005249  ..............................................................................
ENSTNIP00000005250  ..............................................................................
ENSTNIP00000016350  ..............................................................................
ENSTNIP00000015973  ..............................................................................
ENSTNIP00000010563  ..............................................................................
ENSTNIP00000021888  gqltriefillfnpwcp.............................................................
ENSTNIP00000021411  vqpdsvlpiwnlrgvlsnawhrvrvkv...................................................
ENSTNIP00000020537  iklvvkwellddnqkdlfcikfpvqiv...................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  fsvpvsdtvd....................................................................
ENSTNIP00000003313  fsvpvsdtvd....................................................................
ENSTNIP00000002488  pfsvpvsdtv....................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000001789  ..............................................................................
ENSTNIP00000002977  ..............................................................................
ENSTNIP00000001513  ..............................................................................
ENSTNIP00000017397  ..............................................................................
ENSTNIP00000017377  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006628  ..............................................................................
ENSTNIP00000008517  lfnawcpd......................................................................
ENSTNIP00000017383  tvvrtllve.....................................................................
ENSTNIP00000008384  tvvrtllve.....................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007897  ..............................................................................
ENSTNIP00000015072  ..............................................................................
ENSTNIP00000003494  ..............................................................................
ENSTNIP00000006950  ihnytlyfmsdaymgcdqeykfsvdvke..................................................
ENSTNIP00000006734  pvgeysltaafreescllgrltllfnpwcpd...............................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  e.............................................................................
ENSTNIP00000003313  e.............................................................................
ENSTNIP00000002488  e.............................................................................
ENSTNIP00000003313  rasgpgln......................................................................
ENSTNIP00000002488  rasgpgln......................................................................
ENSTNIP00000007616  rasgpgln......................................................................
ENSTNIP00000014961  lgefvllfnawc..................................................................
ENSTNIP00000008895  a.............................................................................
ENSTNIP00000012789  yvdipgainlslnlplvigtiplhpfgsrtssvss...........................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013084  rtssvssqysvnlewlrmaipeqpepp...................................................
ENSTNIP00000005012  ea............................................................................
ENSTNIP00000000464  ea............................................................................
ENSTNIP00000019109  ea............................................................................
ENSTNIP00000005012  gpgl..........................................................................
ENSTNIP00000000464  gpgl..........................................................................
ENSTNIP00000019109  gpgl..........................................................................
ENSTNIP00000016574  dvpgglnlsvslplvigtiplnacasrtssis..............................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000021564  ..............................................................................
ENSTNIP00000015432  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  l.............................................................................
ENSTNIP00000002488  l.............................................................................
ENSTNIP00000007616  l.............................................................................
ENSTNIP00000006675  aldgklkhedtnlasstiikegaskemmgilvsyrvkvklvvsl..................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000021437  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000014295  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000014296  ..............................................................................
ENSTNIP00000003313  v.............................................................................
ENSTNIP00000002488  v.............................................................................
ENSTNIP00000007616  v.............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002599  ldgklkhedtnlasstiikegaskemmgilvsyrvkvklvvsl...................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  pgve..........................................................................
ENSTNIP00000005012  vlfaeqeipispfkvkvdpsh.........................................................
ENSTNIP00000008895  vapll.........................................................................
ENSTNIP00000019109  vlfaeqeipispfkvkvdpsh.........................................................
ENSTNIP00000009333  de............................................................................
ENSTNIP00000013288  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  vdpshd........................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  fhitvappld....................................................................
ENSTNIP00000000464  fhitvappld....................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000019109  fhitvappld....................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006011  pfgkvsyrvkavidtprfskdykaqkpfyllnllnlnevpdiehpnyavi............................
ENSTNIP00000013084  atvkkikkdftviepidintpallap....................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009872  e.............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  gk............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000016574  atsfegkhgsvrywvkaelhrpwlvpvrvkkefivfehidinmplllapqtgtkektlccwfc...............
ENSTNIP00000018364  k.............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000018732  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  aapld.........................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001925  ilraptvsaappfptasapypaaafgfgntalpqpppappnpfd..................................
ENSTNIP00000001568  ilraptvsaappfptasapypaaafgfgntalpqpppappnp....................................
ENSTNIP00000014417  ..............................................................................
ENSTNIP00000008895  g.............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000005497  ..............................................................................
ENSTNIP00000012789  latsfegkhgsvrywvkaelhrpwllpmktkkeftvfehidintpll...............................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000006205  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000001133  gkygriiyrvravidtprfvtdysaekpfyllnllnlnqvpdi...................................
ENSTNIP00000012114  ..............................................................................
ENSTNIP00000002873  gkygriiyrvravidtprfvtdysaekpfyllnllnlnqvpdi...................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019406  akedeeeasdkgsesdegeankdspserdedsdkqsdtevdemagddeeewealqqsiqrreralletkskvthpays
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000002873  kklqpsn.......................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001133  kklqpsn.......................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005680  kgspfrlkv.....................................................................
ENSTNIP00000005012  vvgk..........................................................................
ENSTNIP00000019109  vvgk..........................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  a.............................................................................
ENSTNIP00000005012  a.............................................................................
ENSTNIP00000019109  a.............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000015515  ..............................................................................
ENSTNIP00000020196  ..............................................................................
ENSTNIP00000019366  llyeqpvrgspfrlra..............................................................
ENSTNIP00000019239  ..............................................................................
ENSTNIP00000009911  yeqhikgspfrikv................................................................
ENSTNIP00000018930  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005679  kgspfrlka.....................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002618  vkkikkdftviepidintpallap......................................................
ENSTNIP00000012827  lygqpvrgspfrlra...............................................................
ENSTNIP00000004899  irywvkvklhpratvkkikkdftviepidintpallap........................................
ENSTNIP00000007675  dllsp.........................................................................
ENSTNIP00000001568  gkivyslearlsrsmridqkdltk......................................................
ENSTNIP00000018500  stfkssvgkivhklkaelkqslrltkkarthftfvskanlalltlmep..............................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003898  apcsisncsilevqyvvev...........................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000006011  nipvnlspsrttp.................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006954  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007675  s.............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003898  rlqagthvypftlqipegdfpstfrgihgtvtynltvtidrpwhlsksfvtelmf.......................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000018500  inlpmelpssifncsiikleyrlkayldnkcardpevtipivvlp.................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000001925  ipyqimppsfkgadgkivyslearlsrsmridqkdltk........................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000003258  ..............................................................................
ENSTNIP00000011053  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000012220  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000013222  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000009803  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007472  ..............................................................................
ENSTNIP00000009146  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000002804  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000007744  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007714  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000018520  ..............................................................................
ENSTNIP00000020566  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000009105  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000005417  ..............................................................................
ENSTNIP00000004483  tyepvivkearyiaitmmkayenysfeelrfasptpkrpsenmlirantdgtysanwtpgavglytihvtidgieid.
ENSTNIP00000001542  tyepvivkearyiaitmmkayenysfeelrfasptpkrpsenmlirantdgtysanwtpgavglytihvtidgieid.
ENSTNIP00000018046  tyepvivkearyiaitmmkayenysfeelrfasptpkrpsenmlirantdgtysanwtpgavglytihvtidgieid.
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006857  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000006521  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000016904  ..............................................................................
ENSTNIP00000022219  ..............................................................................
ENSTNIP00000002960  ..............................................................................
ENSTNIP00000010459  tyhgvfvniqytlrcdlkrpllakdlskncefivhcqpq.......................................
ENSTNIP00000008492  ..............................................................................
ENSTNIP00000011929  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................

d1a02n1               ..............................................................................
ENSTNIP00000015820  ..............................................................................
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000014574  ..............................................................................
ENSTNIP00000014544  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000013758  ..............................................................................
ENSTNIP00000012673  ..............................................................................
ENSTNIP00000022103  ..............................................................................
ENSTNIP00000010457  ..............................................................................
ENSTNIP00000017993  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000007179  ..............................................................................
ENSTNIP00000019582  ..............................................................................
ENSTNIP00000009102  ..............................................................................
ENSTNIP00000017145  ..............................................................................
ENSTNIP00000009422  ..............................................................................
ENSTNIP00000009249  ..............................................................................
ENSTNIP00000005244  ..............................................................................
ENSTNIP00000005246  ..............................................................................
ENSTNIP00000014127  ..............................................................................
ENSTNIP00000006368  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000001954  fhllllsdddiifedfarqrltgvvdek..................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000014157  npapgeaqtdrnliefdtnnfhllllsdddiifedfarqrltgvvdek..............................
ENSTNIP00000010486  savpemdppidtnliefdtnsvsqdddfvfedfarlrlkgvvddk.................................
ENSTNIP00000010899  ..............................................................................
ENSTNIP00000003800  ..............................................................................
ENSTNIP00000008976  ..............................................................................
ENSTNIP00000010244  ..............................................................................
ENSTNIP00000000824  ..............................................................................
ENSTNIP00000007048  ..............................................................................
ENSTNIP00000009940  ..............................................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000014413  ..............................................................................
ENSTNIP00000019221  ..............................................................................
ENSTNIP00000022950  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000006156  ..............................................................................
ENSTNIP00000004888  ..............................................................................
ENSTNIP00000014127  gvv...........................................................................
ENSTNIP00000020787  ..............................................................................
ENSTNIP00000002395  ..............................................................................
ENSTNIP00000013223  ..............................................................................
ENSTNIP00000005835  ..............................................................................
ENSTNIP00000009178  ..............................................................................
ENSTNIP00000010775  ..............................................................................
ENSTNIP00000005251  ..............................................................................
ENSTNIP00000005249  ..............................................................................
ENSTNIP00000005250  ..............................................................................
ENSTNIP00000016350  ..............................................................................
ENSTNIP00000015973  ..............................................................................
ENSTNIP00000010563  ..............................................................................
ENSTNIP00000021888  ..............................................................................
ENSTNIP00000021411  ..............................................................................
ENSTNIP00000020537  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000001789  ..............................................................................
ENSTNIP00000002977  ..............................................................................
ENSTNIP00000001513  ..............................................................................
ENSTNIP00000017397  ..............................................................................
ENSTNIP00000017377  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006628  ..............................................................................
ENSTNIP00000008517  ..............................................................................
ENSTNIP00000017383  ..............................................................................
ENSTNIP00000008384  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007897  ..............................................................................
ENSTNIP00000015072  ..............................................................................
ENSTNIP00000003494  ..............................................................................
ENSTNIP00000006950  ..............................................................................
ENSTNIP00000006734  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000014961  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000021564  ..............................................................................
ENSTNIP00000015432  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000021437  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000014295  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000014296  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013288  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009872  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000018364  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000018732  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000014417  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000005497  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000006205  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000012114  ..............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019406  lyfpeekqewwwlyiadrrdqslvsmphhvctlkdteevelkfpapsktgnyqysvilrsdsylgldqikplklevhe
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005680  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000015515  ..............................................................................
ENSTNIP00000020196  ..............................................................................
ENSTNIP00000019366  ..............................................................................
ENSTNIP00000019239  ..............................................................................
ENSTNIP00000009911  ..............................................................................
ENSTNIP00000018930  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005679  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002618  ..............................................................................
ENSTNIP00000012827  ..............................................................................
ENSTNIP00000004899  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006954  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000003258  ..............................................................................
ENSTNIP00000011053  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000012220  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000013222  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000009803  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007472  ..............................................................................
ENSTNIP00000009146  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000002804  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000007744  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007714  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000018520  ..............................................................................
ENSTNIP00000020566  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000009105  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000005417  ..............................................................................
ENSTNIP00000004483  ..............................................................................
ENSTNIP00000001542  ..............................................................................
ENSTNIP00000018046  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006857  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000006521  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000016904  ..............................................................................
ENSTNIP00000022219  ..............................................................................
ENSTNIP00000002960  ..............................................................................
ENSTNIP00000010459  ..............................................................................
ENSTNIP00000008492  ..............................................................................
ENSTNIP00000011929  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0034795 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Atopobium parvulum DSM 20469
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Thermocrinis albus DSM 14484
NoYes   Aquifex aeolicus VF5
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Elusimicrobium minutum Pei191
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter lari RM2100
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia australis str. Cutlack
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella longbeachae NSW150
NoYes   gamma proteobacterium HdN1
NoYes   Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)
NoYes   Candidatus Vesicomyosocius okutanii HA
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22