SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

E set domains alignments in Tetraodon nigroviridis 76_8

These alignments are sequences aligned to the 0046127 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1cf1a2               ..............................................................................
ENSTNIP00000015820  gciidcfmigaimakmarpkkraqtllfshnaviamrdgklclmwrvgnlrkshiveahvraqlikpritdegeyipl
ENSTNIP00000014157  frvfkkaspngkltvylgkrdfvdrvdqvesvdgvvlidpeylkerkvfvtltcafrygredldvlgltfrkdlfvan
ENSTNIP00000001954  hqvfkkaspngkltvylgkrdfvdrvdqvesvdgvvlidpeylkerkvfvtltcafrygredldvlgltfrkdlfvan
ENSTNIP00000014574  gciidafmigaimakmarpkkraetllfshnavialhdgklcfmfrvanlrkshiveahvraqllkpryteegeyipl
ENSTNIP00000014544  tpeqlaamaaeikedecqvnykppaqkslqeiqeldkddeslrkyketllgnvstltdpklpnvqvtkmtlvcdtapg
ENSTNIP00000010486  trvfkksspnckvtvylgkdfvdhldhvdpvdgvilvdpeylkdrkvfvtltcafrygredldvlglsfrkdlyistf
ENSTNIP00000013758  gciidsfmigtimakmarpkkrnntlmfsknavialrdgklclmwrvgnlrrshiveahvraqlirsyvtaegefipl
ENSTNIP00000012673  gciidafiigavmakmakpkkrnetlvfsyyatvamrdsklclmwrvgnlrkshlveahvraqllksrttaegeyipl
ENSTNIP00000022103  gsivdafligcmfikmsqpkkraetlmfsqdavisqrdgklclmfrvgnlrnshmvsaqirckliksrqtpegeflpl
ENSTNIP00000010457  gsivnafmvgcmfvkisqpkkraetlvfstnavismrdgrlclmfrvgdlrnshiveasiraklikskqtkegefipl
ENSTNIP00000017993  gsivdafligcmfikmsqpkkraetlmfsqdavisqrdgklclmfrvgnlrnshmvsaqirckliksrqtpegeflpl
ENSTNIP00000006675  trvfkktspnskltvylgrrdfvdhvscvdpvdgivlvepeylkdrkvfvtlncafrygqedldvlglsfrkdlfakt
ENSTNIP00000002599  trvfkktspnskltvylgrrdfvdhvscvdpvdgivlvepeylkdrkvfvtlncafrygqedldvlglsfrkdlfakt
ENSTNIP00000007179  gcivdsfmigtimakmvrpkkraqtllfshhavialrdgklclmwrlgnmrkshivehvraqlikphvtaegeylple
ENSTNIP00000019582  gsivdafligcmfikmsqpkkraetlmfsehaaismrdgkltlmfrvgnlrnshmvsaqirckllksrqtpegeflpl
ENSTNIP00000009102  gsmvnafmvgcmfvkisqpnkraetlvfskhavislrddklclmfrvgdlrsshivganmraklikskqtqegefipl
ENSTNIP00000017145  qlaaiaaeneepepvnykppaqksvkeiqdldkddeslckyketllgpgvtsvdpaapnvqvtrmallcessprplil
ENSTNIP00000009422  glvinaimlgcifmktaqanrraetlifskhavisvrnnrlcfmirlgdlrksmiisatvrmqvvrrttteegellpl
ENSTNIP00000009249  gliinavmlgcifmktaqsnrraetlifsrhaviavrnnrlcfmvrigdlrksmiigatvrlqvvrktttpegevipi
ENSTNIP00000005244  gliinavmlgcvfmktaqanrraetlifsrnaviaprngrptfmfrvgdlrksmiisatiqlqvirrtvtaegevipv
ENSTNIP00000005246  gliinavmlgcvfmktaqanrraetlifsrnaviaprngrptfmfrvgdlrksmiisatiqlqvirrtvtaegevipv
ENSTNIP00000014127  mkvfkkvsrdqsltvymdkrdfvdrcdsvqpvdgvivvdpqqlrgrkvyvmlsctfkygrqdmdvmgvafrrdlfvvt
ENSTNIP00000006368  gvfincfmcgvilakislpkkraktvtfsdqaviclkegslcllirvanlrktlligsqiygkllrttstadgetiil
ENSTNIP00000009083  kvfkktsgnggltlylgkrdyvdnvnvvdkvegvvkldpkdfgdrkvfvqlacafrygsedldvmglcfrkdiwfeci
ENSTNIP00000002561  kvfkktsgnggltlylgkrdyvdnvnvvdkvegvvkldpkdfgdrkvfvqlacafrygsedldvmglcfrkdiwfeci
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000019946  rvfkktngngnitlylgkrdfvdhvdsvevvegavkvdpsglngrkvyvylacafrygsedldvmglsfrrdiwiqrv
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000010899  gciidafiigavmakiakpkkrnetlvfsdtavvalrdgklcmmwrvgnmrkshlveahvraqllkprvteegeflpl
ENSTNIP00000003800  eifvtgaflaklarpkkrsetikfsqvavicrrqgklclmvrvanmrkslliqcqltgkllhpsvtqegektlvhqsp
ENSTNIP00000008976  lmeifitgtflakvarpkkrgetvkfsqhavvtthegqpclmirvanmrkslligcqvtgkllqtsltkesetvwldq
ENSTNIP00000010244  vmeifitgtflakvarpkkrgetvkfsqhavvsdheglpclmirvanmrkslllgcqvtgkllqtsmtkegetvrldq
ENSTNIP00000000824  clldtiiigiiiakmasarkravtvgfsrcavinlrngclclawrlgdlrgnhilegvvkatvvryvrkpqgaivmsy
ENSTNIP00000007048  kpedniynidfirfkirdletstilfeiakpphaeeeeenrdadtsagrfvryqftpaflklrtvgat..........
ENSTNIP00000009940  edrakeilkgfklnwmnlrdaesgkvlwqgtedlsvpgvehearvpkkilkckavsrelnfssseklekfrleqkvff
ENSTNIP00000019946  g.............................................................................
ENSTNIP00000005358  a.............................................................................
ENSTNIP00000014413  kaednvynvdftrfkirdletgtvlfeiakppgsapvdseedgldvdasagrfvryqftpaflklctvgatve.....
ENSTNIP00000019221  spdenifsidftrfkirdmetgtvlfeitkppttdktgdkrdidpnagrfvryqftpaflrlrqv.............
ENSTNIP00000022950  saspednvhmidftrfkirdmetgtvlfeitkpptpagdkkqsdpnagrfvryqftpflqlrq...............
ENSTNIP00000005358  nvvfkkiskdksvgvylgkrdfvdrvdcvdpvdgviiidpealqgrkvfvtlsctfryrddmdvmgvafrrelylstt
ENSTNIP00000002561  ga............................................................................
ENSTNIP00000009083  ga............................................................................
ENSTNIP00000006156  taelkicrvnrnsgsckggdeifllcdkvqkedievrffqdsweakgtfsqa..........................
ENSTNIP00000004888  gklclmvrvanmrkslliqcqltgkllhpsvtqegektlvhqspvdfymdssgdcpflilpltfyhvldeh.......
ENSTNIP00000014127  t.............................................................................
ENSTNIP00000020787  vrsvdlmksregqnrskhhthlyqtdafiirrgqnfqmwlglsrpfdpkedklhlilktgplptvskgtqvnvplv..
ENSTNIP00000002395  gaiincfmcgvilskislpmrktlmgsqiygkllrttntpdgetiimdqvniefmvda....................
ENSTNIP00000013223  gaiincfmcgvilskislptqnpddgsqiygkllrttntpdgetiimdqvniefmvda....................
ENSTNIP00000005835  rgrtafavassnsdstevpefepfiapgprgfppmtefldilevdmvskfeeinkqehrtefydsnflivrrgqe...
ENSTNIP00000009178  glmleafitgafvakiarpqmragairfspyavvgqhqsqkclmlratnllqhpivdvkvsavlyeeyegevlhqtsv
ENSTNIP00000010775  lsvcsvdllssktgrnra............................................................
ENSTNIP00000005251  snlkivrmdrtagcvsggeevyllcdkvqkddiqvrfyeeddsgltwealgdfsptd.....................
ENSTNIP00000005249  snlkivrmdrtagcvsggeevyllcdkvqkddiqvrfyeeddsgltwealgdfsptd.....................
ENSTNIP00000005250  snlkivrmdrtagcvsggeevyllcdkvqkddiqvrfyeeddsgltwealgdfsptd.....................
ENSTNIP00000016350  snlkisrmdktcgtvlggdeifllcdkvqkddieirfyeedeggweafgdfsptdvhkqyaivfktppyhs.......
ENSTNIP00000015973  dkaeytfyegmgpvhapvtpvpvveslqlngggdvamleltgqnftpnlrvwfgdveaetmyrcaesmlcvvpdisaf
ENSTNIP00000010563  tsqlkisclnqyrgscagktevymlcdkvqkddieiifrkgswkangefaqt..........................
ENSTNIP00000021888  aldidhfdleceynnvehrtdlngidrlivrrgqafsirlylrsgsyqpgvsaldciaetgpqpse............
ENSTNIP00000021411  elpvqsaitspadgaavegssqevtvrgyawsgggrevvrvdvsldggktwqvarl......................
ENSTNIP00000020537  svifadcgstsgkvamvdivpcpiqpcqlhkgqsysvnvtfnslvesqkskavvygivagi.................
ENSTNIP00000005012  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftvetrgagtgglgltiegaseakisckdnkdgs
ENSTNIP00000019109  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftvetrgagtgglgltiegaseakisckdnkdgs
ENSTNIP00000000464  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftvetrgagtgglgltiegaseakisckdnkdgs
ENSTNIP00000007616  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgagtgglglamegpseakmscidnkdgs
ENSTNIP00000003313  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgagtgglglamegpseakmscidnkdgs
ENSTNIP00000002488  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgagtgglglamegpseakmscidnkdgs
ENSTNIP00000003313  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpvefti.............................
ENSTNIP00000001789  itvfqpfflelslpysivrgeqfelkatvfnyqtscmm........................................
ENSTNIP00000002977  itvfqpfflelslpysivrgeqfelkatvfnyqtscmm........................................
ENSTNIP00000001513  itvfqpfflelslpysivrgeqfelkatvfnyqtscmm........................................
ENSTNIP00000017397  itvfqpfflelslpysivrgeqfelkatvfnyqtscmm........................................
ENSTNIP00000017377  ltvfqpffleltlpysiirgeqfelkatvfsylskcimltvtgeesadyk............................
ENSTNIP00000007616  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpveft..............................
ENSTNIP00000008895  evlfdevllpkspfrvlvtegcdpsrvraygpgleeglvnatncftvetrgagtgglglaiegpseakmsckdnk...
ENSTNIP00000002488  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpvef...............................
ENSTNIP00000006628  vsvdlrcrennrahrtweidrerlivrrgqpfsvtlqghrpltpqhyldlvlhlavpsgpgkrdelvv..........
ENSTNIP00000008517  sinkpahmttdyhtellvvrrgfemffkvtfsqplteaddfqmefligkspsstkgsmvt..................
ENSTNIP00000017383  ltafqpffvsltlpysvvrgevfplratvfnylsdcimvqltlaesdqyafrscdgcrytac................
ENSTNIP00000008384  ltafqpffvsltlpysvvrgevfplratvfnylsdcimvqltlaesdqyafrscdgcrytac................
ENSTNIP00000009333  vlyddtpvpkspfqvsvregcdptrvvaagpglqkalsqkpnnfniitrgagiggvgitvegpseskmsckdnkdgsc
ENSTNIP00000007897  aveftfnrglaaapapvtpfpviaglevnggghvamlelhgenfsphlkvwfgntetdtmfrsprsllcvvp......
ENSTNIP00000015072  glpeilkkslhscsvrggeevfiigknflkgtkvifqeniaddnswqgeakidmdyfhqnhlivtvp...........
ENSTNIP00000003494  glpeilkkslhscsvrggeevfiigknflkgtkvifqeniaddnswqgeakidmdyfhqnhlivtvp...........
ENSTNIP00000006950  nielsyevadrdsiksgspvlvqvqlereeevt.............................................
ENSTNIP00000006734  dvsicravklhcdsnnlehhtsqasqdrllvrrgqafrltlelsqafnqhlh..........................
ENSTNIP00000009333  vkyaeedvprspfrfrvlpthdaskvrasgpgltsgvpasfpvefnidtkdagqgqlsv...................
ENSTNIP00000000464  vkyaeqevphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidard..........................
ENSTNIP00000007616  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsikg.............
ENSTNIP00000003313  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsikg.............
ENSTNIP00000002488  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsikg.............
ENSTNIP00000003313  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvvepvevv........................
ENSTNIP00000002488  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvvepvevv........................
ENSTNIP00000007616  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvvepvevv........................
ENSTNIP00000014961  mercdlniktnntdhrtdrygdkrlvvrrgqpftlffllkpgstalkps.............................
ENSTNIP00000008895  nitfgglpipgspfsvpvrelvdpskvrcfgpgleigvrahvpqtftvdsskaglaplvvqlygptg...........
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  spfkiktlpahdaskvrasgpglnasgitaslpveftidardageglltvqildpegkpkranirdnwng........
ENSTNIP00000000464  padpskvrafgpglqggivgkpapftidtkgagagglgltvegpceaki.............................
ENSTNIP00000005012  evphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpe..................
ENSTNIP00000019109  evphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpe..................
ENSTNIP00000005012  padpskvrafgpglqggivgkpapftidtkgagagglgltvegpceak..............................
ENSTNIP00000019109  padpskvrafgpglqggivgkpapftidtkgagagglgltvegpceak..............................
ENSTNIP00000009333  ppdpskvkasgpglkgglvgspaeftidtkgagtgglgltvegpteakiec...........................
ENSTNIP00000013084  pqa...........................................................................
ENSTNIP00000005012  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvkgptgaeeqvkv.............
ENSTNIP00000000464  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvkgptgaeeqvkv.............
ENSTNIP00000019109  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvkgptgaeeqvkv.............
ENSTNIP00000005012  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvgvknngdgthtvhytp..........
ENSTNIP00000000464  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvgvknngdgthtvhytp..........
ENSTNIP00000019109  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvgvknngdgthtvhytp..........
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000009333  gspfrvpvtdvvdpskvkvtgpgvgsgvrakvpqtft.........................................
ENSTNIP00000009333  gfpakvmahpavdtsgvrafgpgldgqavfreattdftvdarsltqnggahvkaevrnpsgaltdc............
ENSTNIP00000009333  siswggtqipkspfevavgeeagpqqirawgpgleggvvgraaifvvesvaaevgvlgfaiegpsqakiecedqddgs
ENSTNIP00000021564  lpmvekqdmdhcsvlggqqmiltgqnfssdskvvfmeksqegqhtwemeasvdkdksqpnmlf...............
ENSTNIP00000015432  lpmvekqdmdhcsvlggqqmiltgqnfssdskvvfmeksqegqhtwemeasvdkdksqpnmlf...............
ENSTNIP00000007616  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhikt........................
ENSTNIP00000003313  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhikt........................
ENSTNIP00000002488  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhikt........................
ENSTNIP00000005012  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskaeitck........................
ENSTNIP00000000464  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskaeitck........................
ENSTNIP00000019109  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskaeitck........................
ENSTNIP00000003313  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadisc..........................
ENSTNIP00000002488  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadisc..........................
ENSTNIP00000007616  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadisc..........................
ENSTNIP00000007616  spyriralptgdaskctvtgagigptiqigeqtvitvdakaagkgkvtcsvctpegaeldvdvvene...........
ENSTNIP00000002488  spyriralptgdaskctvtgagigptiqigeqtvitvdakaagkgkvtcsvctpegaeldvdvvene...........
ENSTNIP00000003313  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkveaakdvevinnhd
ENSTNIP00000002488  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkveaakdvevinnhd
ENSTNIP00000007616  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkveaakdvevinnhd
ENSTNIP00000006675  qp............................................................................
ENSTNIP00000008895  pdalkvraygpglqgglvgkpapfaidtkgagtgglgltvegpceakiec............................
ENSTNIP00000021437  lpsverqdldrcsvlggqqmvltglnftadskvifsektqdgkqiweveatvdrd.......................
ENSTNIP00000007616  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgtea..................................
ENSTNIP00000002488  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgtea..................................
ENSTNIP00000003313  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgtea..................................
ENSTNIP00000008895  rhspfevhvgeeagpqkvrawgpgletgmvgksadfvveaigtevgtlgfsiegpsqakiecddkgdgscdvrywpte
ENSTNIP00000014295  lpqvdkssltsclvsggeemvisgsnffpeskviflekgpdgrpqweveakiireksqgsc.................
ENSTNIP00000005012  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkaggnh............................
ENSTNIP00000000464  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkaggnh............................
ENSTNIP00000019109  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkaggnh............................
ENSTNIP00000014296  lpqvdkssltsclvsggeemvisgsnffpeskviflekgpdgrpqweveakiireksqgsc.................
ENSTNIP00000003313  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqd...................................
ENSTNIP00000002488  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqd...................................
ENSTNIP00000007616  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqd...................................
ENSTNIP00000008895  gdaskvkvfgqglieghtfevaefivdtrnagygglglsiegpskvdincddvedgtc....................
ENSTNIP00000002599  qp............................................................................
ENSTNIP00000005012  piprspfevevggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddgscdvhywp
ENSTNIP00000008895  vdainsghvtaygpglthgtvntpatftivtkdtgegglslavegpsk..............................
ENSTNIP00000019109  piprspfevevggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddgscdvhywp
ENSTNIP00000008895  fdpsmvtvsgpglergkvnedgsftvdcskagdaeltieivsesgakaevhvqnn.......................
ENSTNIP00000005012  itwgevnvpnspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcseagqalgdisigikcapgvvgpgeadi
ENSTNIP00000008895  vlfadqqipispfrikvepshdaakvraegpglnktgvevnkpthftvytkgagkaqpevhftaagkgsvvqdfeiid
ENSTNIP00000019109  itwgevnvpnspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcseagqalgdisigikcapgvvgpgeadi
ENSTNIP00000009333  spyrvravatgdaskctvtgpgldptvaigeelgmvvntkgagkgkvtclvvqpdgseveaqv...............
ENSTNIP00000013288  ptvfrwtgeckevylsgsfnnwankiplirsqntfvai........................................
ENSTNIP00000005012  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieiadkgdgtyl.................
ENSTNIP00000000464  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieiadkgdgtyl.................
ENSTNIP00000019109  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieiadkgdgtyl.................
ENSTNIP00000009333  lgeggaskvraggqglkgalagepaefsiwtreagagglaiavegpsraeisfddhkdgscgvsy.............
ENSTNIP00000009333  kspfsvdvgpacvpgacralgrglqstgmrvnqdgdfrvdtrnagsgdlrvlikgpsgveepvkqisskdgvfyye..
ENSTNIP00000000464  nspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcseagqalgdisigikcapgvvgpgeadidfdiikndn
ENSTNIP00000005012  geasrvkafgkglveahtsemaeffvdtrnagygglalsiegpskvdincedmedrtckv..................
ENSTNIP00000000464  geasrvkafgkglveahtsemaeffvdtrnagygglalsiegpskvdincedmedrtckv..................
ENSTNIP00000005012  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakpevhfaasrpgeavrdfeiidnhdy......
ENSTNIP00000000464  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakpevhfaasrpgeavrdfeiidnhdy......
ENSTNIP00000019109  geasrvkafgkglveahtsemaeffvdtrnagygglalsiegpskvdincedmedrtckv..................
ENSTNIP00000019109  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakpevhfaasrpgeavrdfeiidnhdy......
ENSTNIP00000008895  nspfrvmvgegshpenvkvygpgverlglkaneptyftvdcseagqgdvsigikcapgvvgpaeadidfdiikndndt
ENSTNIP00000003313  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedrkdgssg...................
ENSTNIP00000002488  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedrkdgssg...................
ENSTNIP00000007616  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedrkdgssg...................
ENSTNIP00000006011  klqefditf.....................................................................
ENSTNIP00000013084  klkkldvvfdspevdrpp............................................................
ENSTNIP00000009333  gdaskvtvkgpgvepvgnvankptyfdictagagtgdvtavirdpqgrqnsvevm.......................
ENSTNIP00000005012  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifsv................
ENSTNIP00000000464  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifsv................
ENSTNIP00000019109  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifsv................
ENSTNIP00000008895  penvkcsgpgleplgciinkpaeftmdtrgagrgelklyaqdaegfpiniqmtenenrtffcvyv.............
ENSTNIP00000009333  vqsevgnasqvra.................................................................
ENSTNIP00000009872  aelniqhasletsenlqrhktegfssskalvvrrgapfrvslqlegrpfnpkcdslrvklslgt..............
ENSTNIP00000000464  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakv..........................
ENSTNIP00000005012  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakv..........................
ENSTNIP00000019109  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakv..........................
ENSTNIP00000000464  ipyspyriqslptgdaskclltaanlqklqtsedtvitvdakaagk................................
ENSTNIP00000009333  ltwggvsipkspfrvnvgkgshphmvkvfgpgvetsglkanepthftvdcsgagdggdvsvgikcdanmvgdreadvd
ENSTNIP00000016574  nnlp..........................................................................
ENSTNIP00000018364  arptvirwagagkevyisgsfnnwstkipln...............................................
ENSTNIP00000000464  kspytvnvakamgdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelilenkge......
ENSTNIP00000009333  psmtahgpglsygvanrtatftvftedaseggldlaiegpskaeincv..............................
ENSTNIP00000003313  dsskataqgpglepsgniankttyfdvytagagvgeveviimdpsgknstvkcnie......................
ENSTNIP00000002488  dsskataqgpglepsgniankttyfdvytagagvgeveviimdpsgknstvkcnie......................
ENSTNIP00000007616  dsskataqgpglepsgniankttyfdvytagagvgeveviimdpsgknstvkcnie......................
ENSTNIP00000019109  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisfedrkdgscg...................
ENSTNIP00000005012  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisfedrkdgscg...................
ENSTNIP00000000464  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisfedrkdgscg...................
ENSTNIP00000003313  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdintedqedgtck.................
ENSTNIP00000002488  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdintedqedgtck.................
ENSTNIP00000007616  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdintedqedgtck.................
ENSTNIP00000018732  tvdvskctiegedlrrcregepahflvvcrdsagepmtrggdhvmvsvvhkgkenckaett.................
ENSTNIP00000003313  spyriralptgdaskctvtvsigghglgagigptiqigeqtvitvdakaagkgkvtcsvctpeg..............
ENSTNIP00000008895  ggahkvraggtgldrgvagvpgefsiwtreagagglsiavegpskaeitfe...........................
ENSTNIP00000009333  vlftdkevpqspfqvtvdpshdaskvkaegpglartgvesgkpthftvltkgagkaavdvsfsspvkdfdiidnydys
ENSTNIP00000003313  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgscdvry......
ENSTNIP00000002488  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgscdvry......
ENSTNIP00000007616  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgscdvry......
ENSTNIP00000008895  hvtfagqqiprspfaahiseacnpnacrasgrglqpkgvrvkevadfkvyakgsgsgelkvv................
ENSTNIP00000001925  p.............................................................................
ENSTNIP00000001568  p.............................................................................
ENSTNIP00000014417  rptvfrwsgpakevfvsgsfnnwatkipln................................................
ENSTNIP00000008895  spycihaiptgdaskclvtvsigghgpgsgigptiqigeetvitvdakaagkgk........................
ENSTNIP00000000464  vggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddgscdvhywptepg......
ENSTNIP00000009333  gdpglvsvygtglergttgaqsefiinntkagpgaltvtiegpskvkmec............................
ENSTNIP00000003313  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghr.............................
ENSTNIP00000002488  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghr.............................
ENSTNIP00000007616  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghr.............................
ENSTNIP00000005497  emcpasggermlveghnfqldskvvfvekaqdghhlweteakvvqeaskstsllveippyr.................
ENSTNIP00000012789  vsfdclndtn....................................................................
ENSTNIP00000008895  dasqvllrgaglskafisqknsftvdcsqagtnmlmvgvhgperpceevyvkhmgnrmy...................
ENSTNIP00000005012  gdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelilenkgesvf...............
ENSTNIP00000019109  gdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelilenkgesvf...............
ENSTNIP00000009333  rlavtglqesglkvnhpasfavhlngaqgkmaakvhspsgalee..................................
ENSTNIP00000009333  pdrvqafgpgveksgclvdqraeftvsakdagrgplkitaqdaeglpv..............................
ENSTNIP00000006205  elpviesisltscsveggeelllsgsnflpisrvlftergtdgkfqweeeahvdrdnsnecllcvr............
ENSTNIP00000009333  pfdpskvvasgaglkrakvgeps.......................................................
ENSTNIP00000007616  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkm..............................
ENSTNIP00000002488  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkm..............................
ENSTNIP00000003313  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkm..............................
ENSTNIP00000008895  gdpglvsafgsglergttglasdfmvntcnagsgalsvtidgpskv................................
ENSTNIP00000009333  lnpkkaraygpgieptgnrvmrpavftvdtfsagqgqvtvyldhpdgsreea..........................
ENSTNIP00000005012  gdpgmvtahgaglqggitgapsefvvktcnag..............................................
ENSTNIP00000000464  gdpgmvtahgaglqggitgapsefvvktcnag..............................................
ENSTNIP00000019109  gdpgmvtahgaglqggitgapsefvvktcnag..............................................
ENSTNIP00000003313  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecciteid...........................
ENSTNIP00000002488  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecciteid...........................
ENSTNIP00000007616  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecciteid...........................
ENSTNIP00000001133  tfdiffdh......................................................................
ENSTNIP00000012114  eglkgalrgkpasftvtgydhdgeprlsggdtvsavimsvpdgnlssaevtd..........................
ENSTNIP00000002873  tfdiffdh......................................................................
ENSTNIP00000008895  lhprrakaygpgvesrgnvvlkpaeflvetveaglgevlvyvedpeghteearvt.......................
ENSTNIP00000009333  naskvqshgpglskafvdqvnrfyvdcsnagnnmllvgvhgpetpceevlvkhegnlryc..................
ENSTNIP00000005012  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgphtpceevy............................
ENSTNIP00000000464  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgphtpceevy............................
ENSTNIP00000019109  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgphtpceevy............................
ENSTNIP00000008895  gdptrvqargpglqqtgnvagkptyfdiytagagagdvgvilvdsngrrdtveivlenrg..................
ENSTNIP00000019406  ddedsnnitagsivtvtvtltrkrmaevfekeqestpclpeestteetqadssktktk....................
ENSTNIP00000000464  ecgpqtmtaqvtspsgktvdadivdggnstysvrfipq........................................
ENSTNIP00000005012  ecgpqtmtaqvtspsgktvdadivdggnstysvrfipq........................................
ENSTNIP00000002873  v.............................................................................
ENSTNIP00000019109  cgpqtmtaqvtspsgktvdadivdggnstysvrfipq.........................................
ENSTNIP00000008895  vkvygpgveprgvlrevtthfivdaqcfymgggdhika........................................
ENSTNIP00000001133  v.............................................................................
ENSTNIP00000007616  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndnd............
ENSTNIP00000003313  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndnd............
ENSTNIP00000002488  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndnd............
ENSTNIP00000005680  asqseamgagleeclvghpasvtvvtrdksggacksgnavlsaevftpdgsivd........................
ENSTNIP00000005012  spyriqslptgdaskclltvsigghgvsanlqklqtsedtvitvdakaagk...........................
ENSTNIP00000019109  spyriqslptgdaskclltvsigghgvsanlqklqtsedtvitvdakaagk...........................
ENSTNIP00000008895  ggdpipkspfhimvaplldlskvsvqglnskadvgkdedftvr...................................
ENSTNIP00000000464  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvg..............................
ENSTNIP00000005012  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvg..............................
ENSTNIP00000019109  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvg..............................
ENSTNIP00000007616  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpceeilvkhlgnrmyn...............
ENSTNIP00000003313  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpceeilvkhlgnrmyn...............
ENSTNIP00000002488  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpceeilvkhlgnrmyn...............
ENSTNIP00000009333  rvevnqeqefvvdtkgaggqghlevtllspnqrtvpcrvepqpgradvrvvrytp.......................
ENSTNIP00000005012  rltvtslqekd...................................................................
ENSTNIP00000000464  rltvtslqekd...................................................................
ENSTNIP00000019109  rltvtslqekd...................................................................
ENSTNIP00000002488  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntyc..................................
ENSTNIP00000007616  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntyc..................................
ENSTNIP00000003313  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntyc..................................
ENSTNIP00000015515  mvtdyspewsypeggvkvlitgpwqeassnysclfdqisvpasliqpgvl............................
ENSTNIP00000020196  pcikaispsegwttggatviligenffdglqvvfgtmlvwselitphairvqtppr......................
ENSTNIP00000019366  svatgeglrhalvnqhttvtvttkdkdgelvktgna..........................................
ENSTNIP00000019239  pcikaispsegwttggatviiigdnffdglqvifgtmlvwselitphairvqtpprh.....................
ENSTNIP00000009911  setvatgeglrhcvvgvptsvtittkdkdselckmgnavitaelsssdgskge.........................
ENSTNIP00000018930  pcikaispsegwttggamvivigenffeglqvvfgsmlvwselitphairvqtppr......................
ENSTNIP00000008895  vgstcdlnlkipgeagmqemvaqvtspggktedaeiikgedstfsvrfvpq...........................
ENSTNIP00000008895  ltitslqemslkvgheasfavqlngarglidaktqspsgateecsiteldadq.........................
ENSTNIP00000005679  asqseamgvgleeclvghpasvtvvtrdksggacksgnavlsaevftpdg............................
ENSTNIP00000002488  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpv...................
ENSTNIP00000007616  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpv...................
ENSTNIP00000003313  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpv...................
ENSTNIP00000002618  drpp..........................................................................
ENSTNIP00000012827  htsvatgeglrhaatgqhhtitvttkdkdgelvrtgnavlkaeitltdgsrgaet.......................
ENSTNIP00000004899  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000001568  d.............................................................................
ENSTNIP00000018500  da............................................................................
ENSTNIP00000004388  reagaglsiavegpskaeiafedrkdgssgvsyivqepgd......................................
ENSTNIP00000009333  lsqfklgtaadfsldinetdlsqltariqapsgreepcllkrmannhtglsfiprevgehrvsifkn...........
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000000963  iinlkpsrgpvsggtivnitgshldagsnvsvmfkdqpctylrrggqwltcrthas......................
ENSTNIP00000010401  iinlkpsrgpvsggtivnitgshldagsnvsvmfkdqpctylrrggqwltcrthas......................
ENSTNIP00000006011  i.............................................................................
ENSTNIP00000003313  smrmshlkvgsa..................................................................
ENSTNIP00000002488  smrmshlkvgsa..................................................................
ENSTNIP00000006954  qpplvtgispkegvawtkvtirgenlgtgpadliglsicghncvltaewmsask........................
ENSTNIP00000007616  smrmshlkvgsa..................................................................
ENSTNIP00000007675  ke............................................................................
ENSTNIP00000005012  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlgis............................
ENSTNIP00000000464  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlgis............................
ENSTNIP00000006346  cshpritklfpetgprqggtrvtilgenlglqfrdiqmgvrvgkipcmpveeeyvsaer...................
ENSTNIP00000019109  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlgis............................
ENSTNIP00000003898  es............................................................................
ENSTNIP00000005012  vnflvpftpqqgeitgevrmpsgktarphitdnkdg..........................................
ENSTNIP00000000464  vnflvpftpqqgeitgevrmpsgktarphitdnkdg..........................................
ENSTNIP00000003313  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemd...............................
ENSTNIP00000002488  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemd...............................
ENSTNIP00000007616  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemd...............................
ENSTNIP00000008895  vgtasdvslkimetdlkslmasirapsgneepcvlkrlpnrhigisftpkevgeh.......................
ENSTNIP00000018500  k.............................................................................
ENSTNIP00000009333  sfrkgeitgevfmpsgkstqptitdnldgtvtvq............................................
ENSTNIP00000010401  vedptitkiepewsiysght..........................................................
ENSTNIP00000000963  vedptitkiepewsiysght..........................................................
ENSTNIP00000008895  tvqkgqitgevqmpsgrtacpyitdnkdgtvt..............................................
ENSTNIP00000009333  cvgsscdlnlkipavdlkdvrsevlspsgivrpaelvamgn.....................................
ENSTNIP00000001925  d.............................................................................
ENSTNIP00000019147  fvdpviseifptfgpksgstmltirgasldtgnklevtvgkaacniqsls............................
ENSTNIP00000019148  fvdpviseifptfgpksgstmltirgasldtgnklevtvgkaacniqsls............................
ENSTNIP00000003258  qpplvtgispkegvawtkvtirgenlgtgpadliglsicghnclltaewmsask........................
ENSTNIP00000011053  qpplvtgispkegvawtkvtirgenlgtgpadliglsicghnclltaewmsask........................
ENSTNIP00000007602  cpehvihnieplsglleggtmltisgsnlgqkvedvlysvsvagvpcsviaslyeissri..................
ENSTNIP00000008163  iitsfspssgsiadiggtlltvggfgfsenat..............................................
ENSTNIP00000019109  nflvpftpqqgeitgevrmpsgktarphitdnkdgt..........................................
ENSTNIP00000006767  cshpritkispltgpreggtrvtiegenlglqvkeiayvqvagvrcssvpsqyvsaervvc.................
ENSTNIP00000006766  cshpritkispltgpreggtrvtiegenlglqvkeiayvqvagvrcssvpsqyvsaervvc.................
ENSTNIP00000008162  iitsfspssgsiadiggtlltvggfgfsenat..............................................
ENSTNIP00000019061  cpnpqitdiiprfgpmrgeisitilgsnlgihrddiksitvagepcthhaek..........................
ENSTNIP00000007602  yqdpfvmsvspnrgpkaggtvltisgrnlltgrlsdiritvggvschivkvyhps.......................
ENSTNIP00000012220  ipeilkkslhscsvrggeevfiigknfl..................................................
ENSTNIP00000008162  tpvlssitpitgssgavvtlagsgfgadlqqisvtinsvpcnvstv................................
ENSTNIP00000010401  cthpritkitplrgpreggtlvtirgenlgldfreiqgnvkvaevdctpiregyipaeqiv.................
ENSTNIP00000000963  cthpritkitplrgpreggtlvtirgenlgldfreiqgnvkvaevdctpiregyipaeqiv.................
ENSTNIP00000002265  fvepsvtdlkpdsgpvfggttvtltgryldsgsqrdvlfgdercsilsvsggpepsssiicrtaaaedvgs.......
ENSTNIP00000017783  fvepsvtdlkpdsgpvfggttvtltgryldsgsqrdvlfgdercsilsvsggpepsssiicrtaaaedvgs.......
ENSTNIP00000006767  tedptitsiepnwtilngstmitvtgtnlltiqepkvrakygg...................................
ENSTNIP00000006766  tedptitsiepnwtilngstmitvtgtnlltiqepkvrakygg...................................
ENSTNIP00000021085  cpspeihkifplrgpveggtlltvqgrnlgrraeavkvsigdvpcslqpdr...........................
ENSTNIP00000013222  etlmfshkavisinigfdtgddrlflvspli...............................................
ENSTNIP00000008163  vaslsplegslaggtsltftgngfapgntsvliggqpceirhvtpstlhcitpp........................
ENSTNIP00000006767  fvspsfsrvhpekgpvsggtrltvtgrhldagssvsciinkeeclfvkrtnre.........................
ENSTNIP00000006766  fvspsfsrvhpekgpvsggtrltvtgrhldagssvsciinkeeclfvkrtnre.........................
ENSTNIP00000008162  ltpvitevsprrggtaggtsltitgsgfstnthevnvtiagsvcdvqs..............................
ENSTNIP00000008162  vaslsplegslaggtsltftgngfapgntsvliggqpceirhvtpstlhcitpp........................
ENSTNIP00000008003  cpepkitaisprqgplngrilvtikgsnmgvrkedikritvagvdcvhqedrysvstsvvceig..............
ENSTNIP00000009803  psasntlvwgpgldanvvlparffyiqaadssgrnlttspgektfevkikspgehltriwlqvld.............
ENSTNIP00000008163  tpvvteinpsqgsiglgtllt.........................................................
ENSTNIP00000010138  fvipniteirpnygprvggtlitvtglhldagrtrkvtlnevpcpikr..............................
ENSTNIP00000008162  tpvvteinpsqgsiglgtllt.........................................................
ENSTNIP00000006346  ysggtlltvsgtnlatiqepkirakygqvesfhnctvyn.......................................
ENSTNIP00000021085  ymepnkgyraggtkvtitgehldigsqvrvmvnnthkcvi......................................
ENSTNIP00000002265  capiitevspkvapvggetevtlcgwefqsplrpaiingkth....................................
ENSTNIP00000017783  capiitevspkvapvggetevtlcgwefqsplrpaiingkth....................................
ENSTNIP00000008003  yrdpeptavepargpaaggtvitikgkylntasked..........................................
ENSTNIP00000021085  knptiffikptksylsggrtitvtgqgfdlvqsatmqvegig....................................
ENSTNIP00000008163  vtgvspskgsveggtlltvdgrffdqtdqparvfvgglpceienvsddritcrtakqd....................
ENSTNIP00000019061  yrdpipeavepsrgpkaggtlititghflitgskedvqvtiggvgctvesfg..........................
ENSTNIP00000008163  vhsvsplygslmggtrltlsgsgfsnnisd................................................
ENSTNIP00000007472  scpppqitqvqpvsgpleggvlvtitgsnlgmryqdvvggitvagiwcppfrpk........................
ENSTNIP00000009146  scpppqitqvqpvsgpleggvlvtitgsnlgmryqdvvggitvagiwcppfrpk........................
ENSTNIP00000008163  tpalttiapnnise................................................................
ENSTNIP00000002804  lrtfkpffvdftlpyslirgeq........................................................
ENSTNIP00000008162  vtgvspskgsveggtlltvdgrffdqtdqparvfvgglpceienvsddritcrtakqd....................
ENSTNIP00000008162  vhsvsplygslmggtrltlsgsgfsnnis.................................................
ENSTNIP00000007744  wldvqadqeyvlqvalrrlhpgqqksqrrdgraqaprf........................................
ENSTNIP00000008163  lpavdslapsigsptghtrlhikgsgfpeghvtvasew........................................
ENSTNIP00000007714  itvhicspvlssvglyrlllhtqt......................................................
ENSTNIP00000008162  tpalttiapnnise................................................................
ENSTNIP00000008163  cstptvhaispnqgsyhqilhiqgngfgntt...............................................
ENSTNIP00000010138  enpkitavlpdcsfdrncrgskiviegenldsvyrtivrfkpneshlkpvtre.........................
ENSTNIP00000019147  yctpvitkvfptsgpirgsttvticglnfgfvktesf.........................................
ENSTNIP00000019148  yctpvitkvfptsgpirgsttvticglnfgfvktesf.........................................
ENSTNIP00000018520  lrtfkpffvdftlpyslirgeqtkvpl...................................................
ENSTNIP00000020566  kepqevgqtmsfrvqlfykngqpfpahrpvglrvnithielaldipv...............................
ENSTNIP00000008162  lpavdslapsigsptghtrlhikgsgfpeghvtvasew........................................
ENSTNIP00000009105  rpercfvagpglhpdvvlpvryfviqavdsngenltlspvkmsrrlqvqisplkkqeh....................
ENSTNIP00000008162  cstptvhaispnqgsyhqilhiqgngfgntt...............................................
ENSTNIP00000005417  ddpviteaspaesfyaggrvvmvtgrnldvvqrpvlavw.......................................
ENSTNIP00000004483  adpqktslilnkddircgwpatvvvqtkdqygdvvhvpnmkvevkavpvsqkksvqpdnikklqrlpgnsspsssgpd
ENSTNIP00000001542  adpqktslilnkddircgwpatvvvqtkdqygdvvhvpnmkvevkavpvsqkksvqpdnikklqrlpgnsspsssgpd
ENSTNIP00000018046  adpqktslilnkddircgwpatvvvqtkdqygdvvhvpnmkvevkavpvsqkksvqpdnikklqrlpgnsspsssgpd
ENSTNIP00000010138  scppgiagffprtappdgqteltvfg....................................................
ENSTNIP00000002265  kinpvvtsveprcsvqrhrgsrlviqgqnldsahktvvkyvskntnlhqlq...........................
ENSTNIP00000017783  kinpvvtsveprcsvqrhrgsrlviqgqnldsahktvvkyvskntnlhqlq...........................
ENSTNIP00000006346  fvtpyfnriqpsqgpisggtritv......................................................
ENSTNIP00000008162  nvqpnegsfgggalltvvgsgfepsnstvtvcdeeckvhrdmssss................................
ENSTNIP00000006857  eplsstgllelkpgsplilkgrnlipsapgntklnytvligetpcvlt..............................
ENSTNIP00000019147  nrdpiissiqpsrsfvsggctvvahglflqsglqpqmilttgqdaevfhv............................
ENSTNIP00000019148  nrdpiissiqpsrsfvsggctvvahglflqsglqpqmilttgqdaevfhv............................
ENSTNIP00000006521  feplsstgllelkpgsplilkgrnlipsapgntklnytvligetpcvlt.............................
ENSTNIP00000019061  venpivlghnpkesfvcggrniv.......................................................
ENSTNIP00000004388  rltvaslqesglkvnqpasfavs.......................................................
ENSTNIP00000016904  eeqlevlvqmhdfhgrpkryggdfllarlhsp..............................................
ENSTNIP00000022219  slffkewapaaealfltgdfngwdkfsh..................................................
ENSTNIP00000002960  slffkewapaaealfltgdfngwdkfsh..................................................
ENSTNIP00000010459  vtl...........................................................................
ENSTNIP00000008492  gggqwrvgdrlevliemrdfrgipktsggdvllarlh.........................................
ENSTNIP00000011929  eispysgsimggte................................................................
ENSTNIP00000010401  pgspiilkgrnflpptssgngrlnyt....................................................
ENSTNIP00000000963  pgspiilkgrnflpptssgngrlnyt....................................................


                                                                                      10        20  
                                                                                       |         |  
d1cf1a2               ........................................................DMGPQPRAEASWQFFMSDKPLR
ENSTNIP00000015820  .....dqidinvgfdkgldriflvspitilheideesplfgiskqdletsdfeivv----------------------
ENSTNIP00000014157  .............................................sqmfpsppdle----------------------
ENSTNIP00000001954  .............................................sqmfpsppdle----------------------
ENSTNIP00000014574  ........dqidmnvgydkgtdrlflvapltvvheideesplfgiskqdlessdfe----------------------
ENSTNIP00000014544  .................................plvldlqgdldsfkknpfvlkeg----------------------
ENSTNIP00000010486  .............................................qafppvpeerk----------------------
ENSTNIP00000013758  .......eqmdlnvgydegtdrlflvsplvivheidkdsplysinraeleadnfei----------------------
ENSTNIP00000012673  dqvdidvgfdsgldriflvspitivheidedspfyemskedlqtsefeivvilegm----------------------
ENSTNIP00000022103  .......dqceldvgfgtgadqlflvsplticheinskspffdlsqrslmneqfei----------------------
ENSTNIP00000010457  .....................nqtdinvgystgddrlflvspliicheinekspfw----------------------
ENSTNIP00000017993  .......dqceldvgfgtgadqlflvsplticheinpkspffdlskrslmneqfei----------------------
ENSTNIP00000006675  .........................................ievfppaekdqkpan----------------------
ENSTNIP00000002599  .........................................ievfppaekdqkpan----------------------
ENSTNIP00000007179  ...........qtdidvgyddgldrlflvsplvvvheinrnsplydmsrddlqred----------------------
ENSTNIP00000019582  .......dqleldvgfstgadqlflvspltichvidtkspfydlsqrsmqteqfei----------------------
ENSTNIP00000009102  ........dqtdisvgfetgddrlflvsplvisheidthspfwdmsqaqlekedfe----------------------
ENSTNIP00000017145  .....................................dlqgdlealkkqafvlkeg----------------------
ENSTNIP00000009422  ........dqidihmdnpvgtngiflvspliichvidqgsplynlsasdllhedie----------------------
ENSTNIP00000009249  .........qqidiqtesaitsnslfllapliichvidktsplydlsamelqcsdl----------------------
ENSTNIP00000005244  ............................aqldiqvenplrsngiflvsplvishti----------------------
ENSTNIP00000005246  ............................aqldiqvenplrsngiflvsplvishti----------------------
ENSTNIP00000014127  .............................................rqvypelqdke----------------------
ENSTNIP00000006368  .......................................eqvdidfmvdagkdhlf----------------------
ENSTNIP00000009083  .....................................qlypeshkpslgamhetll----------------------
ENSTNIP00000002561  .....................................qlypeshkpslgamhetll----------------------
ENSTNIP00000001954  ........................................................KPGPQPTAETSRQFLMSDKLLH
ENSTNIP00000019946  .........................................qvypptgdntaktpm----------------------
ENSTNIP00000014157  ........................................................KPGPQPTAETSRQFLMSDKLLH
ENSTNIP00000010486  ........................................................KPGPQPMVETTRSFLMSDRSLH
ENSTNIP00000010899  ........dnvdinvgfdtgtdriflvspvtivheindespffeidrktlekdndl----------------------
ENSTNIP00000003800  ....................................vdfymdssgdcpflilpltf----------------------
ENSTNIP00000008976  ...........................................knvsfqvdtssds----------------------
ENSTNIP00000010244  ......................................rnvpfqvdtssdspflii----------------------
ENSTNIP00000000824  .........qdldipnreivlatpatvihridpssplyglgpedllgnhfemvvsf----------------------
ENSTNIP00000007048  ........................................................----------------------
ENSTNIP00000009940  ...............................................kgqcleewf----------------------
ENSTNIP00000019946  ........................................................-----PKADITKQFIMSDKPVH
ENSTNIP00000005358  ........................................................-----PSVETTRDFVMSDKPLH
ENSTNIP00000014413  ........................................................----------------------
ENSTNIP00000019221  ........................................................----------------------
ENSTNIP00000022950  ........................................................----------------------
ENSTNIP00000005358  ...................................................tgvpq----------------------
ENSTNIP00000002561  ........................................................----GPKADVCKNFMMSDKPVH
ENSTNIP00000009083  ........................................................----GPKADVCKNFMMSDKPVH
ENSTNIP00000006156  ........................................................----------------------
ENSTNIP00000004888  ........................................................----------------------
ENSTNIP00000014127  ........................................................---------TFEFFVMSEKPLH
ENSTNIP00000020787  ........................................................--------K-------------
ENSTNIP00000002395  ........................................................----------------------
ENSTNIP00000013223  ........................................................----------------------
ENSTNIP00000005835  ........................................................----------------------
ENSTNIP00000009178  ...........................................dfhldqlgqqpcp----------------------
ENSTNIP00000010775  ........................................................----------------------
ENSTNIP00000005251  ........................................................----------------------
ENSTNIP00000005249  ........................................................----------------------
ENSTNIP00000005250  ........................................................----------------------
ENSTNIP00000016350  ........................................................----------------------
ENSTNIP00000015973  ....................................................regw----------------------
ENSTNIP00000010563  ........................................................----------------------
ENSTNIP00000021888  ........................................................----------------------
ENSTNIP00000021411  ........................................................----------------------
ENSTNIP00000020537  ........................................................----------------------
ENSTNIP00000005012  ....................................................csve----------------------
ENSTNIP00000019109  ....................................................csve----------------------
ENSTNIP00000000464  ......................................................cs----------------------
ENSTNIP00000007616  ....................................................csve----------------------
ENSTNIP00000003313  ....................................................csve----------------------
ENSTNIP00000002488  ....................................................csve----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000001789  ........................................................----------------------
ENSTNIP00000002977  ........................................................----------------------
ENSTNIP00000001513  ........................................................----------------------
ENSTNIP00000017397  ........................................................----------------------
ENSTNIP00000017377  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000006628  ........................................................----------------------
ENSTNIP00000008517  ........................................................----------------------
ENSTNIP00000017383  ........................................................----------------------
ENSTNIP00000008384  ........................................................----------------------
ENSTNIP00000009333  ...................................................sveyv----------------------
ENSTNIP00000007897  ........................................................----------------------
ENSTNIP00000015072  ........................................................----------------------
ENSTNIP00000003494  ........................................................----------------------
ENSTNIP00000006950  ........................................................----------------------
ENSTNIP00000006734  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000014961  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000012789  ........................................................-PQAGTKDKTLCCWFCTSGPIS
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000013084  ........................................................----GTKDKLARAWYRNFGQVS
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000016574  ........................................................-PQTGTKEKTLCCWFCASGPIS
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000009333  ...................................................cnvty----------------------
ENSTNIP00000021564  ........................................................----------------------
ENSTNIP00000015432  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000003313  ....................................nthtvkytpvqqgplgigvt----------------------
ENSTNIP00000002488  ....................................nthtvkytpvqqgplgigvt----------------------
ENSTNIP00000007616  ....................................nthtvkytpvqqgplgigvt----------------------
ENSTNIP00000006675  ........................................................-------IETHRSYLMSDRSLH
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000021437  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000008895  ......................................................pg----------------------
ENSTNIP00000014295  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000014296  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000002599  ........................................................-------IETHRSYLMSDRSLH
ENSTNIP00000005012  ....................................................tepg----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000019109  ....................................................tepg----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000005012  ...........................................dfdiikndndtft----------------------
ENSTNIP00000008895  ................................................nhnysytv----------------------
ENSTNIP00000019109  ...........................................dfdiikndndtft----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000013288  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000000464  ...................................................dtftv----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000008895  .......................................................f----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000006011  ........................................................----------------------
ENSTNIP00000013084  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000009872  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000000464  ........................................................------------------GKVT
ENSTNIP00000009333  ......................................................fd----------------------
ENSTNIP00000016574  ........................................................----------------------
ENSTNIP00000018364  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000018732  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000009333  ...........................................qtvkytpakqgel----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000001925  ........................................................----QHESKEKKMNLFTSGSVS
ENSTNIP00000001568  ........................................................----QHESKEKKMNLFTSGSVS
ENSTNIP00000014417  ........................................................----------------------
ENSTNIP00000008895  ........................................................--------------------VT
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000005497  ........................................................----------------------
ENSTNIP00000012789  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000006205  ........................................................----------------------
ENSTNIP00000009333  ........................................................-------VLNVDCSRAGPGELS
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000005012  ........................................................-----------------SGTLS
ENSTNIP00000000464  ........................................................-----------------SGTLS
ENSTNIP00000019109  ........................................................-----------------SGTLS
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000001133  ........................................................----------------------
ENSTNIP00000012114  ........................................................----------------------
ENSTNIP00000002873  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000019406  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000002873  ........................................................-------TKEFSYMLMKSGTVV
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000001133  ........................................................-------TKEFSYMLMKSGTVV
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000005680  ........................................................----------------------
ENSTNIP00000005012  ........................................................------------------GKVT
ENSTNIP00000019109  ........................................................------------------GKVT
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000015515  ........................................................---------RCYCPAHDTGLVT
ENSTNIP00000020196  ........................................................----------------------
ENSTNIP00000019366  ........................................................----------------------
ENSTNIP00000019239  ........................................................----------------------
ENSTNIP00000009911  ........................................................----------------------
ENSTNIP00000018930  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000005679  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002618  ........................................................----------------------
ENSTNIP00000012827  ........................................................----------------------
ENSTNIP00000004899  ........................................................----------------------
ENSTNIP00000007675  ........................................................----------------------
ENSTNIP00000001568  ........................................................----------------------
ENSTNIP00000018500  ........................................................----------------------
ENSTNIP00000004388  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000003898  ........................................................-PLSGSNSTTLCCLWCASGPIT
ENSTNIP00000000963  ........................................................--------------LHGYGN--
ENSTNIP00000010401  ........................................................--------------LHGYGN--
ENSTNIP00000006011  ........................................................-------TKKFNYLLLKTGTLM
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000006954  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000007675  ........................................................--------KKVTCMFIPDGQVS
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000006346  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000003898  ........................................................----------------------
ENSTNIP00000005012  ........................................................----------------------
ENSTNIP00000000464  ........................................................----------------------
ENSTNIP00000003313  ........................................................----------------------
ENSTNIP00000002488  ........................................................----------------------
ENSTNIP00000007616  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000018500  ........................................................------------SLTLSSGGVF
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000010401  ........................................................----------------------
ENSTNIP00000000963  ........................................................----------------------
ENSTNIP00000008895  ........................................................----------------------
ENSTNIP00000009333  ........................................................----------------------
ENSTNIP00000001925  ........................................................----------------------
ENSTNIP00000019147  ........................................................----------------------
ENSTNIP00000019148  ........................................................----------------------
ENSTNIP00000003258  ........................................................----------------------
ENSTNIP00000011053  ........................................................----------------------
ENSTNIP00000007602  ........................................................------V---------------
ENSTNIP00000008163  ........................................................----------------------
ENSTNIP00000019109  ........................................................----------------------
ENSTNIP00000006767  ........................................................----------------------
ENSTNIP00000006766  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000019061  ........................................................----------------------
ENSTNIP00000007602  ........................................................----------------------
ENSTNIP00000012220  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000010401  ........................................................----------------------
ENSTNIP00000000963  ........................................................----------------------
ENSTNIP00000002265  ........................................................----------------------
ENSTNIP00000017783  ........................................................----------------------
ENSTNIP00000006767  ........................................................----------------------
ENSTNIP00000006766  ........................................................----------------------
ENSTNIP00000021085  ........................................................----------------------
ENSTNIP00000013222  ........................................................----------------------
ENSTNIP00000008163  ........................................................----------------------
ENSTNIP00000006767  ........................................................----------------------
ENSTNIP00000006766  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000008003  ........................................................----------------------
ENSTNIP00000009803  ........................................................----------------------
ENSTNIP00000008163  ........................................................----------------------
ENSTNIP00000010138  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000006346  ........................................................----------------------
ENSTNIP00000021085  ........................................................----------------------
ENSTNIP00000002265  ........................................................----------------------
ENSTNIP00000017783  ........................................................----------------------
ENSTNIP00000008003  ........................................................----------------------
ENSTNIP00000021085  ........................................................----------------------
ENSTNIP00000008163  ........................................................-------P--------------
ENSTNIP00000019061  ........................................................----------------------
ENSTNIP00000008163  ........................................................----------------------
ENSTNIP00000007472  ........................................................----------------------
ENSTNIP00000009146  ........................................................----------------------
ENSTNIP00000008163  ........................................................----------------------
ENSTNIP00000002804  ........................................................----------------------
ENSTNIP00000008162  ........................................................-------P--------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000007744  ........................................................----------------------
ENSTNIP00000008163  ........................................................----------------------
ENSTNIP00000007714  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000008163  ........................................................----------------------
ENSTNIP00000010138  ........................................................----------------------
ENSTNIP00000019147  ........................................................----------------------
ENSTNIP00000019148  ........................................................----------------------
ENSTNIP00000018520  ........................................................----------------------
ENSTNIP00000020566  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000009105  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000005417  ........................................................----------------------
ENSTNIP00000004483  ......................................ltfgglptpkleatyepv----------------------
ENSTNIP00000001542  ......................................ltfgglptpkleatyepv----------------------
ENSTNIP00000018046  ......................................ltfgglptpkleatyepv----------------------
ENSTNIP00000010138  ........................................................----------------------
ENSTNIP00000002265  ........................................................----------------------
ENSTNIP00000017783  ........................................................----------------------
ENSTNIP00000006346  ........................................................----------------------
ENSTNIP00000008162  ........................................................----------------------
ENSTNIP00000006857  ........................................................----------------------
ENSTNIP00000019147  ........................................................----------------------
ENSTNIP00000019148  ........................................................----------------------
ENSTNIP00000006521  ........................................................----------------------
ENSTNIP00000019061  ........................................................----------------------
ENSTNIP00000004388  ........................................................----------------------
ENSTNIP00000016904  ........................................................----------------------
ENSTNIP00000022219  ........................................................----------------------
ENSTNIP00000002960  ........................................................----------------------
ENSTNIP00000010459  ........................................................---------------------D
ENSTNIP00000008492  ........................................................----------------------
ENSTNIP00000011929  ........................................................----------------------
ENSTNIP00000010401  ........................................................----------------------
ENSTNIP00000000963  ........................................................----------------------


                            30        40        50                 60                  70        80 
                             |         |         |                  |                   |         | 
d1cf1a2               LAVSLSKEIYYHGEPIPVTVAVTNSTEKTVKKI...KVL......VEQVTNVVL..........YSSDYYIKTVAAEE
ENSTNIP00000015820  ---------------------------------...--I......---------..........--------------
ENSTNIP00000014157  ---------------------------------...---......---------..........--------------
ENSTNIP00000001954  ---------------------------------...---......---------..........--------------
ENSTNIP00000014574  --------------------------------I...---......---------..........--------------
ENSTNIP00000014544  ---------------------------------...---......---------..........--------------
ENSTNIP00000010486  ---------------------------------...---......---------..........--------------
ENSTNIP00000013758  ---------------------------------...VVI......LEGMVEATA..........--------------
ENSTNIP00000012673  ---------------------------------...---......----VEAT-..........--------------
ENSTNIP00000022103  ---------------------------------...VVI......LEGIVETTG..........-----MTCQARTSY
ENSTNIP00000010457  ---------------------------------...---......---------..........--------------
ENSTNIP00000017993  ---------------------------------...VVI......LEGIVETTG..........-----MTCQARTSY
ENSTNIP00000006675  ---------------------------------...---......---------..........--------------
ENSTNIP00000002599  ---------------------------------...---......---------..........--------------
ENSTNIP00000007179  ---------------------------------...---......---------..........--------------
ENSTNIP00000019582  ---------------------------------...V--......---------..........--------------
ENSTNIP00000009102  --------------------------------I...---......---------..........--------------
ENSTNIP00000017145  ---------------------------------...---......---------..........--------------
ENSTNIP00000009422  --------------------------------V...IVV......LEGVVETTG..........--------------
ENSTNIP00000009249  -------------------------------E-...---......---------..........--------------
ENSTNIP00000005244  ---------------------------------...---......---------..........--------------
ENSTNIP00000005246  ---------------------------------...---......---------..........--------------
ENSTNIP00000014127  ---------------------------------...---......---------..........--------------
ENSTNIP00000006368  ---------------------------------...---......---------..........--------------
ENSTNIP00000009083  ---------------------------------...---......---------..........--------------
ENSTNIP00000002561  ---------------------------------...---......---------..........--------------
ENSTNIP00000001954  LEASLDKQIYYHGEPISVNVHVTNNTNKTVKKM...KVS......VRQLADICL..........FSTAQYKCTVAMEE
ENSTNIP00000019946  ---------------------------------...---......---------..........--------------
ENSTNIP00000014157  LEASLDKQIYYHGEPISVNVHVTNNTNKTVKKM...KVS......VRQLADICL..........FSTAQYKCTVAMEE
ENSTNIP00000010486  LEASLDKELYYHGEPISVNVHVTNNSTKTVKRV...KIS......VRQYADICL..........FSTAQYKCPVAQLE
ENSTNIP00000010899  -------------------------------E-...---......---------..........--------------
ENSTNIP00000003800  ---------------------------------...---......---------..........--------------
ENSTNIP00000008976  ---------------------------------...---......---------..........--------------
ENSTNIP00000010244  ---------------------------------...---......---------..........--------------
ENSTNIP00000000824  ---------------------------------...---......---------..........------------T-
ENSTNIP00000007048  ---------------------------------...---......---------..........--------------
ENSTNIP00000009940  ---------------------------------...---......---------..........--------------
ENSTNIP00000019946  LEASLEKEIYYHGQPITVNVKIHNESSKVVKKI...KIS......VEQLTNVVL..........YSSDTYTKTVCLEE
ENSTNIP00000005358  VKASLDKEVYYHGEPVKVHVSVTNSSSKNIKNI...IVS......VDQVANVVL..........YSNDSYIKCVAIEE
ENSTNIP00000014413  ---------------------------------...---......---------..........--------------
ENSTNIP00000019221  ---------------------------------...---......---------..........--------------
ENSTNIP00000022950  ---------------------------------...---......---------..........--------------
ENSTNIP00000005358  ---------------------------------...---......---------..........--------------
ENSTNIP00000002561  IEASLEKDLYFHGEAIPIKIKIQNESNKTVKKF...KVT......VDQTTDIVL..........YSADKYTKTVLNKE
ENSTNIP00000009083  IEASLEKDLYFHGEAIPIKIKIQNESNKTVKKF...KVT......VDQTTDIVL..........YSADKYTKTVLNKE
ENSTNIP00000006156  ---------------------------------...---......---------..........--------------
ENSTNIP00000004888  ---------------------------------...---......---------..........--------------
ENSTNIP00000014127  VRLSLARETFYHGEPVPVSLEINNSSSRTVKDI...SLS......VEQVTTVVL..........YSNDKYVKSVAKEE
ENSTNIP00000020787  ---------------------------------...---......---------..........--------------
ENSTNIP00000002395  ---------------------------------...---......---------..........--------------
ENSTNIP00000013223  ---------------------------------...---......---------..........--------------
ENSTNIP00000005835  ---------------------------------...---......---------..........--------------
ENSTNIP00000009178  ---------------------------------...---......---------..........--------------
ENSTNIP00000010775  ---------------------------------...---......---------..........-----EHHTDLYHG
ENSTNIP00000005251  ---------------------------------...---......---------..........--------------
ENSTNIP00000005249  ---------------------------------...---......---------..........--------------
ENSTNIP00000005250  ---------------------------------...---......---------..........--------------
ENSTNIP00000016350  ---------------------------------...---......---------..........--------------
ENSTNIP00000015973  ---------------------------------...---......---------..........--------------
ENSTNIP00000010563  ---------------------------------...---......---------..........--------------
ENSTNIP00000021888  ---------------------------------...---......---------..........--------------
ENSTNIP00000021411  ---------------------------------...E--......---------..........--------------
ENSTNIP00000020537  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000001789  ---------------------------------...---......---------..........--------------
ENSTNIP00000002977  ---------------------------------...---......---------..........--------------
ENSTNIP00000001513  ---------------------------------...---......---------..........--------------
ENSTNIP00000017397  ---------------------------------...---......---------..........--------------
ENSTNIP00000017377  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000006628  ---------------------------------...---......---------..........--------------
ENSTNIP00000008517  ---------------------------------...---......---------..........--------------
ENSTNIP00000017383  ---------------------------------...---......---------..........--------------
ENSTNIP00000008384  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000007897  ---------------------------------...---......---------..........--------------
ENSTNIP00000015072  ---------------------------------...---......--------P..........FHNQSVTSPVSVGI
ENSTNIP00000003494  ---------------------------------...---......--------P..........FHNQSVTSPVSVGI
ENSTNIP00000006950  ------------G--------------------...---......---------..........--------------
ENSTNIP00000006734  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000014961  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000012789  LSAKIERKGYTPGESIQIFAEIENCSSRMVVP-...KAA......IYQTQTFYA..........KGKMKEVKQLVANL
ENSTNIP00000008895  ---------------------------------...---......----T----..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000013084  VTAKIDRKGYTPGEVIPVFAEFDNATSRSVVP-...KAF......IIQTQTFIA..........RGTMKQKRAVVSTL
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........A-------------
ENSTNIP00000000464  ---------------------------------...---......---------..........A-------------
ENSTNIP00000019109  ---------------------------------...---......---------..........A-------------
ENSTNIP00000016574  LSAKIERKGYTPGESIQIFAEVENCSSRVVVP-...KAA......LYQTQTFFA..........KGKGKQIQQLVSNL
ENSTNIP00000009333  ---------------------------------...---......------V--..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000021564  ---------------------------------...---......---------..........--------------
ENSTNIP00000015432  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000006675  LEASLDKEV------THTWVFCKLQRNKNTHNAcsfLVP......VRQYADICL..........FSMAQYKCQVAHLE
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000021437  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000014295  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  -----------------VKVHVINPSGTKT---...---......---------..........--------------
ENSTNIP00000000464  -----------------VKVHVINPSGTKT---...---......---------..........--------------
ENSTNIP00000019109  -----------------VKVHVINPSGTKT---...---......---------..........--------------
ENSTNIP00000014296  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ------------GEGVPVDVQVKDNGN------...---......---GTYSCS..........YTPRKPVKHTAMIS
ENSTNIP00000002488  ------------GEGVPVDVQVKDNGN------...---......---GTYSCS..........YTPRKPVKHTAMIS
ENSTNIP00000007616  ------------GEGVPVDVQVKDNGN------...---......---GTYSCS..........YTPRKPVKHTAMIS
ENSTNIP00000008895  ---------------------------------...---......---K-----..........--------------
ENSTNIP00000002599  LEASLDKEV------THTWVFCKLQRNKNTHNA...QLQikhkvpVRQYADICL..........FSMAQYKCQVAHLE
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......----V----..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......----V----..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000013288  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......-------C-..........--------------
ENSTNIP00000000464  ---------------------------------...---......-------C-..........--------------
ENSTNIP00000019109  ---------------------------------...---......-------C-..........--------------
ENSTNIP00000009333  ---------------------------------...---......-------V-..........--------------
ENSTNIP00000009333  ---------------------------------...---......------Y--..........--------------
ENSTNIP00000000464  ---------------------------------...---......-----K---..........--------------
ENSTNIP00000005012  ---------------------------------...---......-----TYCP..........TEPGN---------
ENSTNIP00000000464  ---------------------------------...---......-----TYCP..........TEPGN---------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......-----TYCP..........TEPGN---------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------T-----
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000006011  ---TNNKVVYGPGESISGTVKIRTSSSLPYKVI...KVN......CQGSCGISN..........---KLNDSSWAMEE
ENSTNIP00000013084  --------VFSSGDVVSGRVLLDLFGEVRVSSL...KLH......AEGFAKVHW..........T-------------
ENSTNIP00000009333  ---------------------------------...---......---------..........-----------M--
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........-PTKAIKHTIII--
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000009872  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  CKVQTPQ--------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000016574  --------VFSGGDMVSGRVVVEVTGDVRVKSL...DVH......ARGVAKVRWtesrnagantTYTQNYTEEVEYLH
ENSTNIP00000018364  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......----VTYCP..........TEPGNYIINIKFA-
ENSTNIP00000002488  ---------------------------------...---......----VTYCP..........TEPGNYIINIKFA-
ENSTNIP00000007616  ---------------------------------...---......----VTYCP..........TEPGNYIINIKFA-
ENSTNIP00000018732  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  --------A------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  --V------------------------------...---......---------..........--------------
ENSTNIP00000001925  MDVSLEKTGFCQGEGISVLACIQNNSSREIKP-...KYC......LYRKHSFFA..........EGKRRVHTKDLLKE
ENSTNIP00000001568  MDVSLEKTGFCQGEGISVLACIQNNSSREIKP-...KYC......LYRKHSFFA..........EGKRRVHTKDLLKE
ENSTNIP00000014417  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  CKVTTP---------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........-----Q--------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000005497  ---------------------------------...---......---------..........--N-----------
ENSTNIP00000012789  ------VPVFSSGDCVSGRVIIEVTGEIRVKSL...KIH......AKGLAKVRWtesrna....GSN----TAYTQNY
ENSTNIP00000008895  ---------------------------------...---......---------..........------N-------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........-------CVVTELE
ENSTNIP00000009333  ------------------E--------------...---......---------..........--------------
ENSTNIP00000006205  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  LEAALDAG-------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........---DCVECPEGYRV
ENSTNIP00000002488  ---------------------------------...---......---------..........---DCVECPEGYRV
ENSTNIP00000003313  ---------------------------------...---......---------..........---DCVECPEGYRV
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  VNIDGP---------------------------...---......---------..........--------------
ENSTNIP00000000464  VNIDGP---------------------------...---......---------..........--------------
ENSTNIP00000019109  VNIDGP---------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000001133  -----DKTEYSSGDSVSGSVKVELSGPLLCKAI...KIN......CCGFCGVTN..........KVNDTSWNVEEQYF
ENSTNIP00000012114  ---------------------------------...---......---------..........H-------------
ENSTNIP00000002873  -----DKTEYSSGDSVSGSVKVELSGPLLCKAI...KIN......CCGFCGVTN..........KVNDTSWNVEEQYF
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......--------V..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........------V-------
ENSTNIP00000000464  ---------------------------------...---......---------..........------V-------
ENSTNIP00000019109  ---------------------------------...---......---------..........------V-------
ENSTNIP00000008895  --------------------------D------...---......---------..........--------------
ENSTNIP00000019406  ---------------------------------...---......---------..........--------V-----
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000002873  LKAQTDMKGYTPGQIIQVKAHISNQSGKSTGHM...AAS......LVQNVSYGT..........KKPTHDVRTIAEVE
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  --------------------C------------...---......---------..........--------------
ENSTNIP00000001133  LKAQTDMKGYTPGQIIQVKAHISNQSGKSTGHM...AAS......LVQNVSYGT..........KKPTHDVRTIAEVE
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000005680  ------------GE-------------------...---......---------..........--------------
ENSTNIP00000005012  CKVQTPQ--------------------------...---......---------..........--------------
ENSTNIP00000019109  CKVQTPQ--------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000005012  ---------------------------------...-LK......VNQEASFMV..........QRNGARGVVDAKVH
ENSTNIP00000000464  ---------------------------------...-LK......VNQEASFMV..........QRNGARGVVDAKVH
ENSTNIP00000019109  ---------------------------------...-LK......VNQEASFMV..........QRNGARGVVDAKVH
ENSTNIP00000002488  ---------------------------------...---......---------..........-------IRFVPT-
ENSTNIP00000007616  ---------------------------------...---......---------..........-------IRFVPT-
ENSTNIP00000003313  ---------------------------------...---......---------..........-------IRFVPT-
ENSTNIP00000015515  LQVAISN--------------------------...---......---------..........--------------
ENSTNIP00000020196  ---------------------------------...---......---------..........--------------
ENSTNIP00000019366  ---------------------------------...---......---------..........--------------
ENSTNIP00000019239  ---------------I-----------------...---......---------..........--------------
ENSTNIP00000009911  ---------------------------------...---......---------..........--------------
ENSTNIP00000018930  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000005679  --------SIVDGE-------------------...---......---------..........--------------
ENSTNIP00000002488  ------------------------------A--...---......---------..........--------------
ENSTNIP00000007616  ------------------------------A--...---......---------..........--------------
ENSTNIP00000003313  ------------------------------A--...---......---------..........--------------
ENSTNIP00000002618  --------VFSSGDVVSGRVLLDLFGEVRVSSL...KLH......A-EFAKVHW..........--------------
ENSTNIP00000012827  ---------------------------------...---......---------..........--------------
ENSTNIP00000004899  --------VFSSGDVVSGRVLLDLFGEVRVSSL...KLH......A-EFAKVHW..........TERSAGSSTAYTQN
ENSTNIP00000007675  ------KSFFCGGDVVSGRVEVEVNEATRVSAV...RLL......ALGRAKVEY..........AKGKQRCRQEAEYL
ENSTNIP00000001568  --------TFSNGDSVSGQVTLEVAKDCQISSL...SVK......FKGKARVLWser.......HGNTTVVYH----S
ENSTNIP00000018500  ---INSRNTFTNGDTINGRIVVEVSKETTIQAL...IFI......GQGEAQVCWseqlgl....HHQQQYQQNEKYYK
ENSTNIP00000004388  ---------------------------------...---......---------..........-----Y--------
ENSTNIP00000009333  ---------------------------------...---......---------..........--------------
ENSTNIP00000003898  LTATAEKKAFSPGETLKIVCEISNASSRTVTP-...KMK......LLQKQNFYThnk.......VSRRLYSQTLASVN
ENSTNIP00000000963  ---------------------------------...---......---------..........--------------
ENSTNIP00000010401  ---------------------------------...---......---------..........--------------
ENSTNIP00000006011  LKTRSDLRGYIPGQVIRLATEIHNKSGKDTGCV...LAS......LIQKVSYKT..........RRPLFDLRTIAEVE
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000006954  ---------------------------------...---......---------..........-----I--------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000007675  LNAKIDRSGFCEGEDICINAKFENCSRIVVPK-...-AA......IIAKHIYQA..........NGRTKVFRQKLSSV
ENSTNIP00000005012  ---------------------------------...---......---------..........F-------------
ENSTNIP00000000464  ---------------------------------...---......---------..........F-------------
ENSTNIP00000006346  ---------------------------------...---......---------..........--------------
ENSTNIP00000019109  ---------------------------------...---......---------..........F-------------
ENSTNIP00000003898  -------RSFCSGDRVTGKISFELKKETKISAI...RME......FRGTAHVHWst........SGGKNRRRRNYSAR
ENSTNIP00000005012  ---------------------------------...---......---------..........--------------
ENSTNIP00000000464  ---------------------------------...---......---------..........--------------
ENSTNIP00000003313  ---------------------------------...---......---------..........--------------
ENSTNIP00000002488  ---------------------------------...---......---------..........--------------
ENSTNIP00000007616  ---------------------------------...---......---------..........--------------
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000018500  MHIKTDRMGYMQGETIQVTLEITNCSCRSVKP-...TFA......LYERQSFFA..........QGKRTVHARNILKV
ENSTNIP00000009333  ---------------------------------...---......--------Y..........--------------
ENSTNIP00000010401  --------------------------AVTVTGT...NLD......IIQTPLIRA..........KYNNHETLNL----
ENSTNIP00000000963  --------------------------AVTVTGT...NLD......IIQTPLIRA..........KYNNHETLNL----
ENSTNIP00000008895  ---------------------------------...---......---------..........--------------
ENSTNIP00000009333  ---------------------------------...---......----DTYCVs.........FVPEMGVHSVSVTA
ENSTNIP00000001925  --------TFSNGDSVSGQVTLEVAKDCQISSL...SVK......FKGKARVLWser.......HGNTTVVYHSKEKY
ENSTNIP00000019147  ---------------------------------...---......---------..........--------------
ENSTNIP00000019148  ---------------------------------...---......---------..........--------------
ENSTNIP00000003258  ---------------------------------...---......---------..........-----I--------
ENSTNIP00000011053  ---------------------------------...---......---------..........-----I--------
ENSTNIP00000007602  ---------------------------------...---......---------..........--------------
ENSTNIP00000008163  ---------------------------------...---......------VTI..........GSNECKVVHATDTE
ENSTNIP00000019109  ---------------------------------...---......---------..........--------------
ENSTNIP00000006767  ---------------------------------...---......---------..........--------------
ENSTNIP00000006766  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......------VTI..........GSNECKVVHATDTE
ENSTNIP00000019061  ---------------------------------...---......---------..........--------------
ENSTNIP00000007602  ---------------------------------...---......---------..........----N---------
ENSTNIP00000012220  ---------------------------------...---......---------..........--------K-----
ENSTNIP00000008162  ---------------------------------...---......---------..........--------T-----
ENSTNIP00000010401  -----------------C---------------...---......---------..........--------------
ENSTNIP00000000963  -----------------C---------------...---......---------..........--------------
ENSTNIP00000002265  ---------------V-----------------...---......---------..........--------------
ENSTNIP00000017783  ---------------V-----------------...---......---------..........--------------
ENSTNIP00000006767  ---------------------------------...---......---------..........-----------V--
ENSTNIP00000006766  ---------------------------------...---......---------..........-----------V--
ENSTNIP00000021085  ---------------------------------...---......---------..........--------------
ENSTNIP00000013222  ---------------------------------...---......---------..........--------------
ENSTNIP00000008163  ---------------------------------...---......---------..........--------------
ENSTNIP00000006767  ---------------------------------...---......---------..........--------------
ENSTNIP00000006766  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........--------------
ENSTNIP00000008003  ---------------------------------...---......---------..........--------------
ENSTNIP00000009803  ---------------------------------...---......---------..........--------------
ENSTNIP00000008163  ---------------VTGTGFISENASILVGTA...KCH......VEQITNTTQ..........--------------
ENSTNIP00000010138  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------VTGTGFISENASILVGTA...KCH......VEQITNTTQ..........--------------
ENSTNIP00000006346  ---------------------------------...---......---------..........--------------
ENSTNIP00000021085  ---------------------------------...---......---------..........-----------T--
ENSTNIP00000002265  ---------------------------------...---......---------..........------R-------
ENSTNIP00000017783  ---------------------------------...---......---------..........------R-------
ENSTNIP00000008003  ---------------------------------...---......---------..........--------------
ENSTNIP00000021085  ---------------------------------...---......-----R---..........--------------
ENSTNIP00000008163  ---------------------------------...---......---------..........--------------
ENSTNIP00000019061  ---------------------------------...---......---------..........--------------
ENSTNIP00000008163  ---------------------------------...---......---------..........-------N------
ENSTNIP00000007472  ---------------------------------...---......---------..........--------------
ENSTNIP00000009146  ---------------------------------...---......---------..........--------------
ENSTNIP00000008163  ---------------------------------...---......---------..........--------------
ENSTNIP00000002804  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........------D-------
ENSTNIP00000007744  ---------------------------------...---......---------..........--------------
ENSTNIP00000008163  ---------------------------------...---......---------..........--------------
ENSTNIP00000007714  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........--------------
ENSTNIP00000008163  ---------------------------------...---......---------..........--------------
ENSTNIP00000010138  ---------------------------------...---......---------..........--------------
ENSTNIP00000019147  ---------------------------------...---......---------..........--------------
ENSTNIP00000019148  ---------------------------------...---......---------..........--------------
ENSTNIP00000018520  ---------------------------------...---......---------..........--------------
ENSTNIP00000020566  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........--------------
ENSTNIP00000009105  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........--------------
ENSTNIP00000005417  ---------------------------------...---......---------..........--------------
ENSTNIP00000004483  ---------------------------------...---......I--------..........--------------
ENSTNIP00000001542  ---------------------------------...---......I--------..........--------------
ENSTNIP00000018046  ---------------------------------...---......I--------..........--------------
ENSTNIP00000010138  ---------------------------------...---......---------..........--------------
ENSTNIP00000002265  ---------------------------------...---......-----R---..........--------------
ENSTNIP00000017783  ---------------------------------...---......-----R---..........--------------
ENSTNIP00000006346  ---------------------------------...---......---------..........--------------
ENSTNIP00000008162  ---------------------------------...---......---------..........--------------
ENSTNIP00000006857  ---------------------------------...---......---------..........--------------
ENSTNIP00000019147  ---------------------------------...---......---------..........--------------
ENSTNIP00000019148  ---------------------------------...---......---------..........--------------
ENSTNIP00000006521  ---------------------------------...---......---------..........--------------
ENSTNIP00000019061  -----------------------------V---...---......---------..........--------------
ENSTNIP00000004388  ---------------------------------...---......---------..........--------------
ENSTNIP00000016904  ---------------------------------...---......---------..........--------------
ENSTNIP00000022219  ---------------------------------...---......---------..........--------------
ENSTNIP00000002960  ---------------------------------...---......---------..........--------------
ENSTNIP00000010459  IRLKRANKVYREGEVVSGVIVMVCKEAVQHHGI...FLG......MEGLVSLQL..........SSKSVGVFEAFYNS
ENSTNIP00000008492  ---------------------------------...---......---------..........--------------
ENSTNIP00000011929  --------------FVVLNVTFSNTSGLMCR--...---......---------..........--------------
ENSTNIP00000010401  ---------------------------------...---......---------..........--------------
ENSTNIP00000000963  ---------------------------------...---......---------..........--------------


                                 90       100       110                       120        130        
                                  |         |         |                         |          |        
d1cf1a2               AQEKVP....PNSSLTKTLTLVPLLANNRERRGIALDGKI................KHEDTNLASSTI.IKE..GID.
ENSTNIP00000015820  ------....------------------------------................------------.---..---.
ENSTNIP00000014157  ------....----------------KSLTRLQERLMKKL................GEHAHPFTFKIP.LNL..PCS.
ENSTNIP00000001954  ------....----------------KSLTRLQERLMKKL................GEHAHPFTFKIP.LNL..PCS.
ENSTNIP00000014574  ------....------------------------------................------------.---..---.
ENSTNIP00000014544  ------....------------------------------................------------.---..---.
ENSTNIP00000010486  ------....-----------------PNSRLQERLLKKL................GQHAHPFYFTIP.QNL..PCS.
ENSTNIP00000013758  ------....------------------------------................------------.---..---.
ENSTNIP00000012673  ------....------------------------------................------------.---..---.
ENSTNIP00000022103  TEDEVL....WGHRFLPVMS--------------------................------------.---..---.
ENSTNIP00000010457  ------....------------------------------................------------.---..---.
ENSTNIP00000017993  TEDEVL....WGHRFLPVMS--------------------................------------.---..---.
ENSTNIP00000006675  ------....---------------------LQNRLLTKL................GQNAYPFTFTIP.QNL..PCS.
ENSTNIP00000002599  ------....---------------------LQNRLLTKL................GQNAYPFTFTIP.QNL..PCS.
ENSTNIP00000007179  ------....------------------------------................------------.---..---.
ENSTNIP00000019582  ------....------------------------------................------------.---..---.
ENSTNIP00000009102  ------....------------------------------................------------.---..---.
ENSTNIP00000017145  ------....------------------------------................------------.---..---.
ENSTNIP00000009422  ------....------------------------------................------------.---..---.
ENSTNIP00000009249  ------....------------------------------................------------.---..---.
ENSTNIP00000005244  ------....------------------------------................------------.---..---.
ENSTNIP00000005246  ------....------------------------------................------------.---..---.
ENSTNIP00000014127  ------....---------------QLTHTKVQQRLLQKL................GDNAFPFFFEFP.DNL..PCS.
ENSTNIP00000006368  ------....------------------------------................------------.---..---.
ENSTNIP00000009083  ------....---------------------------KKA................GDNAYPFTFEIP.NNL..PCS.
ENSTNIP00000002561  ------....---------------------------KKA................GDNAYPFTFEIP.NNL..PCS.
ENSTNIP00000001954  SDDVVP....PSSTFCKVFTVTPFLANNRDKRGLALDGKL................KHEDTNLASSTL.LGE..GAS.
ENSTNIP00000019946  ------....----------------------QEFLLGKI................GEQGYAFSFQMP.TDL..PCS.
ENSTNIP00000014157  SDDVVP....PSSTFCKVFTVTPFLANNRDKRGLALDGKL................KHEDTNLASSTL.LGE..GAS.
ENSTNIP00000010486  ADDQVS....SSSTFCKVYTLTPTLDKNREKRGLALDGKL................KHEDTNLASSTI.VKD..VTN.
ENSTNIP00000010899  ------....------------------------------................------------.---..---.
ENSTNIP00000003800  ------....------------------------------................------------.---..---.
ENSTNIP00000008976  ------....------------------------------................------------.---..---.
ENSTNIP00000010244  ------....------------------------------................------------.---..---.
ENSTNIP00000000824  ------....------------------------------................------------.---..---.
ENSTNIP00000007048  ------....------------------------------................------------.---..---.
ENSTNIP00000009940  ------....------------------------------................----FEFGFVIP.NS-..---.
ENSTNIP00000019946  FGETVN....SNSTLEKSFQLTPLLSNNKEKRGLSVNGRL................KDGDTHLASTTL.SQG..--E.
ENSTNIP00000005358  TGDTVS....PGASLQKTYSLLPLLANNRERRGIALDGKL................KHEDTNLASSSM.TKA..GVL.
ENSTNIP00000014413  ------....------------------------------................------------.---..---.
ENSTNIP00000019221  ------....------------------------------................------------.---..---.
ENSTNIP00000022950  ------....------------------------------................------------.---..---.
ENSTNIP00000005358  ------....--------------P---------------................------------.---..---.
ENSTNIP00000002561  FGETVE....PNGTYENTLSITPMLNENKEKRGLALDGRL................KDEDTNLASTTM.LRQ..GIE.
ENSTNIP00000009083  FGETVE....PNGTYENTLSITPMLNENKEKRGLALDGRL................KDEDTNLASTTM.LRQ..GIE.
ENSTNIP00000006156  ------....------------------------------................------------.---..---.
ENSTNIP00000004888  ------....------------------------------................------------.---..---.
ENSTNIP00000014127  TSDQVA....PGTSLKKDYALYPLLAYNRERRGIALDGRL................RHEDTNLASSSI.VKQ..EVL.
ENSTNIP00000020787  ------....------------------------------................------------.---..---.
ENSTNIP00000002395  ------....------------------------------................------------.---..---.
ENSTNIP00000013223  ------....------------------------------................------------.---..---.
ENSTNIP00000005835  ------....------------------------------................------------.---..---.
ENSTNIP00000009178  ------....------------------------------................------------.---..---.
ENSTNIP00000010775  DELIIR....RGQTFQIEMELSR-----------------................------------.---..---.
ENSTNIP00000005251  ------....------------------------------................------------.---..---.
ENSTNIP00000005249  ------....------------------------------................------------.---..---.
ENSTNIP00000005250  ------....------------------------------................------------.---..---.
ENSTNIP00000016350  ------....------------------------------................------------.---..---.
ENSTNIP00000015973  ------....------------------------------................------------.---..---.
ENSTNIP00000010563  ------....------------------------------................------------.---..---.
ENSTNIP00000021888  ------....---Q--------------------------................------------.---..---.
ENSTNIP00000021411  ------....------------------------------................------------.---..---.
ENSTNIP00000020537  ---P--....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....----------Y-------------------................------------.---..---.
ENSTNIP00000019109  ------....----------Y-------------------................------------.---..---.
ENSTNIP00000000464  ------....--------V---------------------................------------.---..---.
ENSTNIP00000007616  ------....----------Y-------------------................------------.---..---.
ENSTNIP00000003313  ------....----------Y-------------------................------------.---..---.
ENSTNIP00000002488  ------....----------Y-------------------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................------------.---..--D.
ENSTNIP00000001789  ----VS....VKTAKSEDYTLTPLSANEYTSCLC------................------------.---..---.
ENSTNIP00000002977  ----VS....VKTAKSEDYTLTPLSANEYTSCLC------................------------.---..---.
ENSTNIP00000001513  ----VS....VKTAKSEDYTLTPLSANEYTSCLC------................------------.---..---.
ENSTNIP00000017397  ----VS....VKTAKSEDYTLTPLSANEYTSCLC------................------------.---..---.
ENSTNIP00000017377  -----L....------------------------------................------------.---..---.
ENSTNIP00000007616  ------....------------------------------................------------.---..-I-.
ENSTNIP00000008895  ------....---D--------------------------................------------.---..---.
ENSTNIP00000002488  ------....------------------------------................------------.---..---.
ENSTNIP00000006628  ------....------------------------------................------------.---..---.
ENSTNIP00000008517  ------....------------------------------................----V-------.---..---.
ENSTNIP00000017383  -----L....------------------------------................------------.---..---.
ENSTNIP00000008384  -----L....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------P-----------------................------------.---..---.
ENSTNIP00000007897  ------....------------------------------................------------.---..---.
ENSTNIP00000015072  FVMTNA....GRSNEAQTFTYVPDSVDNSESQAV------................------------.---..---.
ENSTNIP00000003494  FVMTNA....GRSNEAQTFTYVPDSVDNSESQAV------................------------.---..---.
ENSTNIP00000006950  ------....------------------------------................------------.---..---.
ENSTNIP00000006734  ------....------------------------------................-----P------.---..---.
ENSTNIP00000009333  ------....-----------L------------------................------------.---..---.
ENSTNIP00000000464  ------....A-----------------------------................------------.---..---.
ENSTNIP00000007616  ------....------------P-----------------................------------.---..---.
ENSTNIP00000003313  ------....------------P-----------------................------------.---..---.
ENSTNIP00000002488  ------....------------P-----------------................------------.---..---.
ENSTNIP00000003313  ------....D-----------------------------................------------.---..---.
ENSTNIP00000002488  ------....D-----------------------------................------------.---..---.
ENSTNIP00000007616  ------....D-----------------------------................------------.---..---.
ENSTNIP00000014961  ------....------------------------------................---ETSFTVQT-.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000012789  RGESLS....SGKTET------------------------................---WSGKMLKIP.PVS..PSI.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ---E--....------------------------------................------------.---..---.
ENSTNIP00000005012  ---G--....------------------------------................------------.---..---.
ENSTNIP00000019109  ---G--....------------------------------................------------.---..---.
ENSTNIP00000005012  --I---....------------------------------................------------.---..---.
ENSTNIP00000019109  --I---....------------------------------................------------.---..---.
ENSTNIP00000009333  -S----....------------------------------................------------.---..---.
ENSTNIP00000013084  CGDVVG....AKCRET------------------------................---WHGRAIKIP.PVG..PSI.
ENSTNIP00000005012  ------....-Q----------------------------................------------.---..---.
ENSTNIP00000000464  ------....-Q----------------------------................------------.---..---.
ENSTNIP00000019109  ------....-Q----------------------------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000016574  RGEPLP....QGKSQSWEGKL-------------------................--------LKIP.PVS..PSI.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  ---S--....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....-----W------------------------................------------.---..---.
ENSTNIP00000021564  ------....------------------------------................------------.---..---.
ENSTNIP00000015432  ------....------------------------------................------------.---..---.
ENSTNIP00000007616  ------....-------------LISNPSGSCTDALISDL................GDGTYSVAYTPY.EEG..PHS.
ENSTNIP00000003313  ------....-------------LISNPSGSCTDALISDL................GDGTYSVAYTPY.EEG..PHS.
ENSTNIP00000002488  ------....-------------LISNPSGSCTDALISDL................GDGTYSVAYTPY.EEG..PHS.
ENSTNIP00000005012  ------....----------------D-------------................------------.---..---.
ENSTNIP00000000464  ------....----------------D-------------................------------.---..---.
ENSTNIP00000019109  ------....----------------D-------------................------------.---..---.
ENSTNIP00000003313  -----V....DNQDGTCTVSYLPVL---------------................------------.---..---.
ENSTNIP00000002488  -----V....DNQDGTCTVSYLPVL---------------................------------.---..---.
ENSTNIP00000007616  -----V....DNQDGTCTVSYLPVL---------------................------------.---..---.
ENSTNIP00000007616  ------....---D--------------------------................------------.---..---.
ENSTNIP00000002488  ------....---D--------------------------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................------------.---..---.
ENSTNIP00000002488  ------....------------------------------................------------.---..---.
ENSTNIP00000007616  ------....------------------------------................------------.---..---.
ENSTNIP00000006675  ADDQIS....PSSTSCHIYTLTPLLRNNREKRGLALDGKL................KHEDTNLASSTI.IKE..GAS.
ENSTNIP00000008895  -Q----....------------------------------................------------.---..---.
ENSTNIP00000021437  ------....------------------------------................------------.---..---.
ENSTNIP00000007616  -EVHIQ....DNGDGTYTITYIPL----------------................------------.---..---.
ENSTNIP00000002488  -EVHIQ....DNGDGTYTITYIPL----------------................------------.---..---.
ENSTNIP00000003313  -EVHIQ....DNGDGTYTITYIPL----------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000014295  ------....------------------------------................---------IVV.E--..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000014296  ------....------------------------------................---------IVV.E--..---.
ENSTNIP00000003313  WGGVNI....PDSP--------------------------................------------.---..---.
ENSTNIP00000002488  WGGVNI....PDSP--------------------------................------------.---..---.
ENSTNIP00000007616  WGGVNI....PDSP--------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000002599  ADDQIS....PSSTSCHIYTLTPLLRNNREKRGLALDGKL................KHEDTNLASSTI.IKE..GAS.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................-A----------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....--R---------------------------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  -----L....------------------------------................------------.---..---.
ENSTNIP00000013288  ------....-------------------------VDLPE................GEHQYKF-----.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....-----S------------------------................------------.---..---.
ENSTNIP00000000464  ------....-----S------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....-----S------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................------------.---..---.
ENSTNIP00000002488  ------....------------------------------................------------.---..---.
ENSTNIP00000007616  ------....------------------------------................------------.---..---.
ENSTNIP00000006011  QY----....FNSTLS-----------VADKGTL----AA................GEHCFPFQFVIP.VAV..PTS.
ENSTNIP00000013084  -ESRSA....GSSTAYTQNYSDEVEYLNRREVLLQADNGEvsvlpa..........GRHEFPFSFQLP.EETl.VTS.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................-------T----.---..---.
ENSTNIP00000000464  ------....------------------------------................-------T----.---..---.
ENSTNIP00000019109  ------....------------------------------................-------T----.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  YGDGLE....QGTTFNNSSFIVDTQDAGYGGLALSVEGPS................KVDIQTE-----.---..--D.
ENSTNIP00000009872  ------....------------------------------................------------.-Q-..---.
ENSTNIP00000000464  -----K....PNKDKSRTYTVT------------------................------------.---..---.
ENSTNIP00000005012  -----K....PNKDKSRTYTVT------------------................------------.---..---.
ENSTNIP00000019109  -----K....PNKDKSRTYTVT------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................----------I-.---..---.
ENSTNIP00000016574  HYDTLI....GEERDE----------DCPDENVTVL--HT................GLHEFAFNFNLP.QMAl.ATS.
ENSTNIP00000018364  ------....----------------KSHNDFVAILDLPE................GEHQYKF-----.---..---.
ENSTNIP00000000464  ----S-....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....--------------------------D---................------------.---..---.
ENSTNIP00000003313  D-----....------------------------------................------------.---..---.
ENSTNIP00000002488  D-----....------------------------------................------------.---..---.
ENSTNIP00000007616  D-----....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000003313  -DQHVP....A-----------------------------................------------.---..---.
ENSTNIP00000002488  -DQHVP....A-----------------------------................------------.---..---.
ENSTNIP00000007616  -DQHVP....A-----------------------------................------------.---..---.
ENSTNIP00000018732  ----V-....------------------------------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................-------D----.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000003313  ------....-----------W------------------................------------.---..---.
ENSTNIP00000002488  ------....-----------W------------------................------------.---..---.
ENSTNIP00000007616  ------....-----------W------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000001925  VGNPIP....PSASEK------------------------................----VTRVITIP.QDIe.PSI.
ENSTNIP00000001568  VGNPIP....PSASEK------------------------................----VTRVITIP.QDIe.PSI.
ENSTNIP00000014417  ------....----------------RSQNNFVAIVDLPE................GEHQYKFS----.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................---E--------.---..---.
ENSTNIP00000002488  ------....------------------------------................---E--------.---..---.
ENSTNIP00000007616  ------....------------------------------................---E--------.---..---.
ENSTNIP00000005497  ------....------------------------------................------------.---..---.
ENSTNIP00000012789  TEEVEY....LNHKDI----LIGHERDDDNSEEGLTTIHS................GRHEYAFSLELP.QTPl.ATS.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....-R----------------------------................------------.---..---.
ENSTNIP00000019109  ------....-R----------------------------................------------.---..---.
ENSTNIP00000009333  Q-----....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000006205  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000007616  TYTPMA....PGSYLISIKYGG------------------................------------.---..---.
ENSTNIP00000002488  TYTPMA....PGSYLISIKYGG------------------................------------.---..---.
ENSTNIP00000003313  TYTPMA....PGSYLISIKYGG------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..K--.
ENSTNIP00000009333  ------....--------------------Q---------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000003313  ------....----Q-------------------------................------------.---..---.
ENSTNIP00000002488  ------....----Q-------------------------................------------.---..---.
ENSTNIP00000007616  ------....----Q-------------------------................------------.---..---.
ENSTNIP00000001133  NSTISV....ADKGTL----------------------KQ................GKHVFPFKFLLP.ASC..PTS.
ENSTNIP00000012114  ------....------------------------------................------------.---..---.
ENSTNIP00000002873  NSTISV....ADKGTL----------------------KQ................GKHVFPFKFLLP.ASC..PTS.
ENSTNIP00000008895  ------....P-----------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000019406  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....----------------------------EM................GPHTVNVKYRGQ.HVP..GS-.
ENSTNIP00000005012  ------....----------------------------EM................GPHTVNVKYRGQ.HVP..GS-.
ENSTNIP00000002873  -GGVVK....PGKEVE------------------------................----WKEQIIVP.PLP..QSS.
ENSTNIP00000019109  ------....----------------------------EM................GPHTVNVKYRGQ.HVP..GSP.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000001133  -GGVVK....LGKEVE------------------------................----WKEQIIVP.PLP..QSS.
ENSTNIP00000007616  ------....-----T------------------------................------------.---..---.
ENSTNIP00000003313  ------....-----T------------------------................------------.---..---.
ENSTNIP00000002488  ------....-----T------------------------................------------.---..---.
ENSTNIP00000005680  ------....------------------------------................------------.---..---.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------V-----.---..---.
ENSTNIP00000005012  ------....------------------------------................------V-----.---..---.
ENSTNIP00000019109  ------....------------------------------................------V-----.---..---.
ENSTNIP00000007616  ------....------------------------------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................------------.---..---.
ENSTNIP00000002488  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  T-----....------------------------------................------------.---..---.
ENSTNIP00000005012  TPSGSS....------EECYVTELDSDKNAIR--FIPREN................GVHSIDVKFNGC.HIP..GSP.
ENSTNIP00000000464  TPSGSS....------EECYVTELDSDKNAIR--FIPREN................GVHSIDVKFNGC.HIP..GSP.
ENSTNIP00000019109  TPSGSS....------EECYVTELDSDKNAIR--FIPREN................GVHSIDVKFNGC.HIP..GSP.
ENSTNIP00000002488  ------....----------------------------ET................GVHTVSVKYQGS.HVP..GSP.
ENSTNIP00000007616  ------....----------------------------ET................GVHTVSVKYQGS.HVP..GSP.
ENSTNIP00000003313  ------....----------------------------ET................GVHTVSVKYQGS.HVP..GSP.
ENSTNIP00000015515  ------....------------------------------................------------.---..---.
ENSTNIP00000020196  ------....------------------------------................------------.---..---.
ENSTNIP00000019366  -----A....------------------------------................------------.---..---.
ENSTNIP00000019239  ------....------------------------------................------------.---..---.
ENSTNIP00000009911  ------....----------------------GEILDNKN................GTYEYLF-----.---..---.
ENSTNIP00000018930  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....----------------------------EM................GAHTVNVRYRDQ.HVP..GSP.
ENSTNIP00000008895  ------....------------------H-----------................------------.---..---.
ENSTNIP00000005679  ------....------------------------------................------------.---..---.
ENSTNIP00000002488  ------....------------------------------................------------.---..---.
ENSTNIP00000007616  ------....------------------------------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................------------.---..---.
ENSTNIP00000002618  -TERSA....GSSTAYTQNYSDEVEYLNRREVLLQADNGEvsvla...........GRHEFPFSFQLP.EETl.VTS.
ENSTNIP00000012827  -E----....------------------------------................------------.---..---.
ENSTNIP00000004899  YSDEVEy...LNRREVLLQAVKDQWVKSGDEITARSRSSA................GRHEFPFSFQLP.EETl.VTS.
ENSTNIP00000007675  RHEE--....----------LLRLESQPTDSDGSVLLRPG................NKYEYSFGFELP.QNGqlVSS.
ENSTNIP00000001568  KEKYFT....-------FKNYFIRDKKATGDNVV----AP................GCHVYPFTFQIP.YQIm.PPS.
ENSTNIP00000018500  IKHYIL....KESRQDGTEVIGK-----------------................GRHVFPFSFQIPdRNI..PST.
ENSTNIP00000004388  ------....------------------------------................------------.---..---.
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000003898  -GHTISp...HSSEVH------------------------................----TELLLTIP.SSA..PCS.
ENSTNIP00000000963  ------....------------------------------................------------.---..---.
ENSTNIP00000010401  ------....------------------------------................------------.---..---.
ENSTNIP00000006011  -GAGVK....AG----------------------------................KHAEWREQIIVP.PLP..QSA.
ENSTNIP00000003313  ------....------------------------------................------------.---..---.
ENSTNIP00000002488  ------....------------------------------................------------.---..---.
ENSTNIP00000006954  ------....------------------------------................------------.---..---.
ENSTNIP00000007616  ------....------------------------------................------------.---..---.
ENSTNIP00000007675  RGNHII....SGMCDA------------------------................---WQGKTIRVP.KIK..PSM.
ENSTNIP00000005012  ------....------------------------------................------------.---..---.
ENSTNIP00000000464  ------....------------------------------................------------.---..---.
ENSTNIP00000006346  ------....------------------------------................------------.---..---.
ENSTNIP00000019109  ------....------------------------------................------------.---..---.
ENSTNIP00000003898  LDYFHI....KSSILEDSSGMPPPRQFAPELRFKSLKGKYsmfppaaavgglrlqaGTHVYPFTLQIP.EGDf.PST.
ENSTNIP00000005012  ------....---------------------T--------................------------.---..---.
ENSTNIP00000000464  ------....---------------------T--------................------------.---..---.
ENSTNIP00000003313  ------....------------------------------................------I-----.---..---.
ENSTNIP00000002488  ------....------------------------------................------I-----.---..---.
ENSTNIP00000007616  ------....------------------------------................------I-----.---..---.
ENSTNIP00000008895  ----V-....------------------------------................------------.---..---.
ENSTNIP00000018500  MAEAIE....GGKKKA------------------------................----VTQLINLP.MEL..PSSi
ENSTNIP00000009333  ------....------------------------------................------------.---..---.
ENSTNIP00000010401  ------....------------------------------................------------.---..---.
ENSTNIP00000000963  ------....------------------------------................------------.---..---.
ENSTNIP00000008895  ------....------------------------V-----................------------.---..---.
ENSTNIP00000009333  DGEHVP....------------------------------................------------.---..---.
ENSTNIP00000001925  FTFKNYfirdKKATDDDAEALITTETGEYYSNVVAP----................GCHVYPFTFQIP.YQIm.PPS.
ENSTNIP00000019147  ------....------------------------------................------------.---..P--.
ENSTNIP00000019148  ------....------------------------------................------------.---..P--.
ENSTNIP00000003258  ------....------------------------------................------------.---..---.
ENSTNIP00000011053  ------....------------------------------................------------.---..---.
ENSTNIP00000007602  ------....------------------------------................------------.---..---.
ENSTNIP00000008163  LKCRTP....AGTAGSQTI---------------------................------------.---..---.
ENSTNIP00000019109  ------....----------------------I-------................------------.---..---.
ENSTNIP00000006767  ------....------------------------------................------------.---..---.
ENSTNIP00000006766  ------....------------------------------................------------.---..---.
ENSTNIP00000008162  LKCRTP....AGTAGSQTI---------------------................------------.---..---.
ENSTNIP00000019061  ------....Y-----------------------------................------------.---..---.
ENSTNIP00000007602  ------....------------------------------................------------.---..---.
ENSTNIP00000012220  ------....------------------------------................------------.---..---.
ENSTNIP00000008162  ------....------------------------------................------------.---..---.
ENSTNIP00000010401  ------....------------------------------................------------.---..---.
ENSTNIP00000000963  ------....------------------------------................------------.---..---.
ENSTNIP00000002265  ------....------------------------------................------------.---..---.
ENSTNIP00000017783  ------....------------------------------................------------.---..---.
ENSTNIP00000006767  ------....------------------------------................------------.---..---.
ENSTNIP00000006766  ------....------------------------------................------------.---..---.
ENSTNIP00000021085  ------....------------------------------................------------.---..---.
ENSTNIP00000013222  ------....------------------------------................------------.---..---.
ENSTNIP00000008163  ------....------------------------HVEGQV................RTDIWVLSTQYP.---..---.
ENSTNIP00000006767  ------....-----------------------I------................------------.---..---.
ENSTNIP00000006766  ------....-----------------------I------................------------.---..---.
ENSTNIP00000008162  ------....------------------------------................------------.---..---.
ENSTNIP00000008162  ------....------------------------HVEGQV................RTDIWVLSTQYP.---..---.
ENSTNIP00000008003  ------....--P---------------------------................------------.---..---.
ENSTNIP00000009803  ------....------------------------------................------------.-R-..---.
ENSTNIP00000008163  ------....------------------------------................------------.---..---.
ENSTNIP00000010138  ------....--------------V---------------................------------.---..---.
ENSTNIP00000008162  ------....------------------------------................------------.---..---.
ENSTNIP00000006346  ------....--N---------------------------................------------.---..---.
ENSTNIP00000021085  ------....------------------------------................------------.---..---.
ENSTNIP00000002265  ------....------------------------------................------------.---..---.
ENSTNIP00000017783  ------....------------------------------................------------.---..---.
ENSTNIP00000008003  ------....------------------------------................------------.---..---.
ENSTNIP00000021085  ------....------------------------------................------------.---..---.
ENSTNIP00000008163  ------....------------------------------................------------.---..---.
ENSTNIP00000019061  ------....------------------------------................----------V-.---..---.
ENSTNIP00000008163  ------....------------------------------................------------.---..---.
ENSTNIP00000007472  ------....------------------------------................------------.---..---.
ENSTNIP00000009146  ------....------------------------------................------------.---..---.
ENSTNIP00000008163  TTDVVI....YGSGFGNHADDVVVFASNT-----------................------------.---..---.
ENSTNIP00000002804  ------....------------------------------................------------.---..---.
ENSTNIP00000008162  ------....------------------------------................------------.---..---.
ENSTNIP00000008162  ------....------------------------------................------------.---..---.
ENSTNIP00000007744  ------....------------------------------................------------.---..---.
ENSTNIP00000008163  ------....------------------------------................------------.---..---.
ENSTNIP00000007714  ------....------------------------------................------------.---..---.
ENSTNIP00000008162  TTDVVI....YGSGFGNHADDVVVFASNT-----------................------------.---..---.
ENSTNIP00000008163  ------....------------------------------................------------.---..---.
ENSTNIP00000010138  ----C-....------------------------------................------------.---..---.
ENSTNIP00000019147  ------....-----K------------------------................------------.---..---.
ENSTNIP00000019148  ------....-----K------------------------................------------.---..---.
ENSTNIP00000018520  ------....------------------------------................------------.---..---.
ENSTNIP00000020566  ------....------------------------------................------------.-T-..---.
ENSTNIP00000008162  ------....------------------------------................------------.---..---.
ENSTNIP00000009105  ------....------------------------------................--------I---.---..---.
ENSTNIP00000008162  ------....------------------------------................------------.---..---.
ENSTNIP00000005417  ------....----------V-------------------................------------.---..---.
ENSTNIP00000004483  ------....------------------------------................------------.---..---.
ENSTNIP00000001542  ------....------------------------------................------------.---..---.
ENSTNIP00000018046  ------....------------------------------................------------.---..---.
ENSTNIP00000010138  ------....------------------------------................------WEFQSP.LRP..AIT.
ENSTNIP00000002265  ------....------------------------------................------------.---..---.
ENSTNIP00000017783  ------....------------------------------................------------.---..---.
ENSTNIP00000006346  ------....------------------------------................------------.---..---.
ENSTNIP00000008162  ------....-----H------------------------................------------.---..---.
ENSTNIP00000006857  ------....--L---------------------------................------------.---..---.
ENSTNIP00000019147  ---SCV....-----------------------------Y................GENGTSIHCTTP.S--..---.
ENSTNIP00000019148  ---SCV....-----------------------------Y................GENGTSIHCTTP.S--..---.
ENSTNIP00000006521  ------....--L---------------------------................------------.---..---.
ENSTNIP00000019061  ------....------------------------------................------------.---..---.
ENSTNIP00000004388  ------....------------------------------................------------.---..---.
ENSTNIP00000016904  ------....-------------E----------------................------------.---..---.
ENSTNIP00000022219  ------....------------P-----------------................------------.---..---.
ENSTNIP00000002960  ------....------------P-----------------................------------.---..---.
ENSTNIP00000010459  VKP---....--------------IQLISSNIEVAKAGKV................PPGKTEIPFEFP.LNT..KSNk
ENSTNIP00000008492  --D---....------------------------------................------------.---..---.
ENSTNIP00000011929  ------....------------------------------................------------.---..---.
ENSTNIP00000010401  ------....------------------------------................------------.---..---.
ENSTNIP00000000963  ------....------------------------------................------------.---..---.


                              140       150         160       170                  180              
                                |         |           |         |                    |              
d1cf1a2               .....KT.VMGILVSYQIKVKLTV..SGLLGELTSSEVATEVPFRLM.HPQP..........EDPDTAK.........
ENSTNIP00000015820  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000014157  .....VT.----------------..---------------------.----..........-------.........
ENSTNIP00000001954  .....VT.----------------..---------------------.----..........-------.........
ENSTNIP00000014574  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000014544  .....--.-----VEYKIKISFKV..---------------------.----..........-------.........
ENSTNIP00000010486  .....VT.----------------..---------------------.----..........-------.........
ENSTNIP00000013758  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000012673  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000022103  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010457  .....--.----------------..---------------------.----..........-D-----.........
ENSTNIP00000017993  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006675  .....VT.----------------..---------------------.----..........-------.........
ENSTNIP00000002599  .....VT.----------------..---------------------.----..........-------.........
ENSTNIP00000007179  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019582  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009102  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000017145  .....--.-----VEYKIKISFRV..N--------------------.----..........-------.........
ENSTNIP00000009422  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009249  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005244  .....--.----------------..---------------------.----..........-E-----.........
ENSTNIP00000005246  .....--.----------------..---------------------.----..........-E-----.........
ENSTNIP00000014127  .....V-.----------------..---------------------.----..........-------.........
ENSTNIP00000006368  .....--.----------------..-------------FVCPLTLY.HV--..........INRSSPF.........
ENSTNIP00000009083  .....V-.----------------..---------------------.----..........-------.........
ENSTNIP00000002561  .....V-.----------------..---------------------.----..........-------.........
ENSTNIP00000001954  .....KE.ILGIIVSYKVKVKLVV..SRLLGDLTMSDVSIELPFTLM.HPKP..........LNFHLLL.........
ENSTNIP00000019946  .....VS.----------------..---------------------.----..........-------.........
ENSTNIP00000014157  .....KE.ILGIIVSYKVKVKLVV..S------RGGDVSIELPFTLM.HPKPledvdaddpnP-----Apgeaqtdrn
ENSTNIP00000010486  .....KE.VLGILVSYRVKVKLVV..S------RGGDVSVELPFILM.HPKP..........VEPPASRpqsavpemd
ENSTNIP00000010899  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003800  .....--.----------------..--------------------Y.----..........-------.........
ENSTNIP00000008976  .....--.----------------..----------------P----.----..........-------.........
ENSTNIP00000010244  .....--.----------------..---------------------.P---..........-------.........
ENSTNIP00000000824  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007048  .....--.----------------..---------------VEFTVG.NRPL..........NHF----.........
ENSTNIP00000009940  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019946  .....KE.MQGIIVSYKVKVNLMVsgGGLLGGLTGSDVTVELPLTLM.SPKP..........-------.........
ENSTNIP00000005358  .....KE.VMGIMVSYRVTVKLVV..AGMM---GSSEVGLEVPFKLM.HPKP..........DSV---R.........
ENSTNIP00000014413  .....--.----------------..-----------------FTVG.DRPI..........NSF----.........
ENSTNIP00000019221  .....--.----------------..------------GATVEFTVG.DLPI..........ENF----.........
ENSTNIP00000022950  .....--.----------------..-----------VGATVEFTVG.DTPI..........NNFR---.........
ENSTNIP00000005358  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002561  .....KE.VLGILVSYKIKINLIVagGGLLGGLTASDVTVELPLMLM.HPKP..........-------.........
ENSTNIP00000009083  .....KE.VLGILVSYKIKINLIVagGGLLGGLTASDVTVELPLMLM.HPKP..........-------.........
ENSTNIP00000006156  .....--.----------------..----------DVHRQVAIVFR.TPPY..........RHA----.........
ENSTNIP00000004888  .....--.----------------..---------------------.----..........----S--.........
ENSTNIP00000014127  .....KE.VQGMLVSYKLVVRMMA..CGTI---GSSEVSLELPFRLM.HPKP..........----EPA.........
ENSTNIP00000020787  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002395  .....--.----------------..-------GKDNLFFVCPLTLY.HV--..........-------.........
ENSTNIP00000013223  .....--.----------------..-------GKDNLFFVCPLTLY.HV--..........-------.........
ENSTNIP00000005835  .....--.-------FQVKITFNR..P------YKPKDKFALEFVIG.TNPD..........YNKGTYI.........
ENSTNIP00000009178  .....--.----------------..------------LFIFPLTFY.HPPG..........-------.........
ENSTNIP00000010775  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005251  .....--.----------------..-----------VHRQFAIVFK.TPKY..........RDQ----.........
ENSTNIP00000005249  .....--.----------------..-----------VHRQFAIVFK.TPKY..........RDQ----.........
ENSTNIP00000005250  .....--.----------------..-----------VHRQFAIVFK.TPKY..........RDQ----.........
ENSTNIP00000016350  .....--.----------------..---------------------.----..........--A----.........
ENSTNIP00000015973  .....--.----------------..-------RWVRQPVQVPVTL-.----..........-------.........
ENSTNIP00000010563  .....--.----------------..----------DVHRQIAIVFK.TPPY..........QD-----.........
ENSTNIP00000021888  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000021411  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000020537  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000001789  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002977  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000001513  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000017397  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000017377  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....-T.----------------..---------------------.----..........-------.........
ENSTNIP00000006628  .....--.------------K---..---------------------.----..........-------.........
ENSTNIP00000008517  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000017383  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008384  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007897  .....--.--------------D-..---------------------.----..........-------.........
ENSTNIP00000015072  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003494  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006950  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006734  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000014961  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..-------------V-------.----..........-------.........
ENSTNIP00000012789  .....LD.CSIIRVEYSLMVYVDI..P------GAINLSLNLPLVIG.TIPL..........HPFGSRT.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000013084  .....LH.CRIIKVEYMLKVCVDV..P------GTSKLFLELPLVIG.TIPL..........HPFGSRT.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000016574  .....LD.CPIIRVEYALVVYVDV..P------GGLNLSVSLPLVIG.TIPL..........NACAS--.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000021564  .....--.---------V------..---------------------.----..........-------.........
ENSTNIP00000015432  .....--.---------V------..---------------------.----..........-------.........
ENSTNIP00000007616  .....VE.VC--------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....VE.VC--------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....VE.VC--------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..-------YGGDHVPKSPFTV-.----..........-------.........
ENSTNIP00000002488  .....--.----------------..-------YGGDHVPKSPFTV-.----..........-------.........
ENSTNIP00000007616  .....--.----------------..-------YGGDHVPKSPFTV-.----..........-------.........
ENSTNIP00000006675  .....KE.MMGILVSYRVKVKLVV..S--------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000021437  .....--.----------------..-K-------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.------D---------..---------------------.----..........-------.........
ENSTNIP00000014295  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000014296  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002599  .....KE.MMGILVSYRVKVKLVV..S--------------------.----..........-------.........
ENSTNIP00000005012  .....--.------D---------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.------D---------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------R-----..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000013288  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000006011  .....FE.GPFGKVSYRVKAVIDT..PR-----FSKDYKAQKPFYLL.NL--..........-------.........
ENSTNIP00000013084  .....FE.GKHGSIRYWVKVKLHR..PRATVKKIKKDFTVIEPIDIN.TPAL..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....ME.DRICKVSYC-------..---------------------.----..........-------.........
ENSTNIP00000009872  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000016574  .....FE.GKHGSVRYWVKAELHR..P------WLVPVRVKKEFIVFeHIDI..........NM-----.........
ENSTNIP00000018364  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000018732  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.------------TIVV..T------FGGDPISKSPFTVG.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000001925  .....FN.CSIIKAEHRLRVYLDV..K------YASDPEIKFPIVIL.RAPT..........VSAAPPF.........
ENSTNIP00000001568  .....FN.CSIIKAEHRLRVYLDV..K------YASDPEIKFPIVIL.RAPT..........VSAAPPF.........
ENSTNIP00000014417  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.------D---------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005497  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000012789  .....FE.GKHGSVRYWVKAELHR..P------WLLPMKTKKEFTVFeHIDI..........NT-----.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006205  .....--.---------------V..P------TYSDLSITRPVSV-.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000001133  .....FE.GKYGRIIYRVRAVIDT..PR-----FVTDYSAEKPFYLL.NL--..........-------.........
ENSTNIP00000012114  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002873  .....FE.GKYGRIIYRVRAVIDT..PR-----FVTDYSAEKPFYLL.NL--..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019406  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002873  .....LAgCELIKVEYYVKVRLKF..P---------DVLLTLPIHIG.NVSL..........DK-----.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000001133  .....LAgCELIKVEYYVKVRLKF..P---------DVLLTLPIHIG.NVSL..........DK-----.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005680  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.T---..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.-----V----------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005012  .....FN.VR--------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....FN.VR--------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....FN.VR--------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....F-.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....F-.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....F-.----------------..---------------------.----..........-------.........
ENSTNIP00000015515  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000020196  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019366  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019239  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009911  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000018930  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000005679  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002618  .....FE.GKHGSIRYWVKVKLHP..RA-TVKKIKKDFTVIEPIDIN.TPAL..........-------.........
ENSTNIP00000012827  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000004899  .....FE.GKHGSIRYWVKVKLHP..RA-TVKKIKKDFTVIEPIDIN.TPAL..........-------.........
ENSTNIP00000007675  .....YK.GKFGYVHYCVKAVMER..PQQPALECKKAFEVEEPLDVN.TPDL..........L------.........
ENSTNIP00000001568  .....FK.GADGKIVYSLEARLSR..S------MRIDQK--------.----..........-------.........
ENSTNIP00000018500  .....FK.SSVGKIVHKLKAELKQ..S------LRLTKKARTHFTFV.----..........-------.........
ENSTNIP00000004388  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------G-----------.----..........-------.........
ENSTNIP00000003898  .....ISnCSILEVQYVVEV----..---------------------.----..........-------.........
ENSTNIP00000000963  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010401  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006011  .....LAgCSLIDIEYFIQVSLKS..P---------DAVVTLPIYIG.NIPV..........NLSPS--.........
ENSTNIP00000003313  .....--.----------------..-------------ADIPLDIG.ELDL..........TQLTASL.........
ENSTNIP00000002488  .....--.----------------..-------------ADIPLDIG.ELDL..........TQLTASL.........
ENSTNIP00000006954  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..-------------ADIPLDIG.ELDL..........TQLTASL.........
ENSTNIP00000007675  .....LS.CNIIRVEYALMIYVHI..P------GSEKLILELPLVIG.TA--..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006346  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003898  .....FR.GIHGTVTYNLTVTIDR..P------WHLSKS--------.----..........-------.........
ENSTNIP00000005012  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000464  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003313  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002488  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007616  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000018500  .....FN.CSIIKLEYRLKAYLDN..K------CARDPEVTIPIVVL.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010401  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000963  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008895  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009333  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000001925  .....FK.GADGKIVYSLEARLSR..S------MRIDQK--------.----..........-------.........
ENSTNIP00000019147  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019148  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000003258  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000011053  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007602  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008163  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019109  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006767  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006766  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019061  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007602  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000012220  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010401  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000000963  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002265  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000017783  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006767  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006766  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000021085  .....--.-------Y--------..---------------------.----..........-------.........
ENSTNIP00000013222  .....--.----------------..-------------------I-.----..........-------.........
ENSTNIP00000008163  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006767  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006766  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------A-----------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008003  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000009803  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008163  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010138  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006346  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000021085  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002265  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000017783  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008003  .....--.----------------..---------------ISITVG.GV--..........-------.........
ENSTNIP00000021085  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008163  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019061  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008163  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007472  .....--.----------------..---------------------.----..........---G---.........
ENSTNIP00000009146  .....--.----------------..---------------------.----..........---G---.........
ENSTNIP00000008163  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002804  .....--.----------------..-------------TKVPLTVY.NY--..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000007744  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008163  .....--.CAIVSVNYT-------..---------------------.----..........-------.........
ENSTNIP00000007714  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008163  .....--.----------------..-------------CAIEVIV-.----..........-------.........
ENSTNIP00000010138  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019147  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019148  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000018520  .....--.----------------..------------------TVY.NY--..........-------.........
ENSTNIP00000020566  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.CAIVSVNYT-------..---------------------.----..........-------.........
ENSTNIP00000009105  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..-------------CAIEVIV-.----..........-------.........
ENSTNIP00000005417  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000004483  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000001542  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000018046  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010138  .....SR.TH--------------..---------------------.----..........-------.........
ENSTNIP00000002265  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000017783  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006346  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000008162  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006857  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019147  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019148  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000006521  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000019061  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000004388  .....L-.----------------..---------------------.----..........-------.........
ENSTNIP00000016904  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000022219  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000002960  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010459  vlyetYH.GVFVNIQYTLRCDLKR..PL-----LAKDLSKNCEFIVH.----..........-------.........
ENSTNIP00000008492  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000011929  .....--.----------------..---------------------.----..........-------.........
ENSTNIP00000010401  .....--.---------V------..---------------------.----..........-------.........
ENSTNIP00000000963  .....--.---------V------..---------------------.----..........-------.........


                                     190       200       210                                        
                                       |         |         |                                        
d1cf1a2               .............ESFQDENFVFEEFARQNLKDAG----eyke...................................
ENSTNIP00000015820  .............--------------------------legmveatamttqarssylaseilwghrfepvlfeeknm
ENSTNIP00000014157  .............--------------------------lqpgpedtgkacgvdfevkafcaenpeekihkrnsvrlv
ENSTNIP00000001954  .............--------------------------lqpgpedtgkacgvdfevkafcaenpeekihkrnsvrlv
ENSTNIP00000014574  .............--------------------------viileglveatamttqarssylpseilwghrfepvifee
ENSTNIP00000014544  .............--------------------------nkeivsglkyvqqtfrkgvkvdktdymvgsygprpaeey
ENSTNIP00000010486  .............--------------------------lqpgpedtgkacgvdfeirafcaksieekihkrnsvrlv
ENSTNIP00000013758  .............--------------------------mttqfrssylarevlwghrfesviyedrdsykvdyarfh
ENSTNIP00000012673  .............--------------------------amttqcrssyvageilwghrfepvlfeeknyykvdysrf
ENSTNIP00000022103  .............--------------------------leegffrvdysqfhntfevptppysvkeqeeks......
ENSTNIP00000010457  .............--------------------------isqahlakeeleivvilegmveatgmtcqarssyvssei
ENSTNIP00000017993  .............--------------------------leegffrvdysqfhstfevptpphsvkehaekn......
ENSTNIP00000006675  .............--------------------------lqpgpqdsgkacgvdyelqafcaksadekihhrnsvhlv
ENSTNIP00000002599  .............--------------------------lqpgpqdsgkacgvdyelqafcaksadekihhrnsvhlv
ENSTNIP00000007179  .............------------F-------------eivvilegmveatamttqarssylakeilwghrfepvvl
ENSTNIP00000019582  .............--------------------------vilegivettgmtcqartsytedevlwghrffpvislee
ENSTNIP00000009102  .............--------------------------vvilegmveatagmtcqarssylaeevlwghrfspmmsl
ENSTNIP00000017145  .............--------------------------reivsglkyvqqtyrkglridksdymvgsygprdceydf
ENSTNIP00000009422  .............--------------------------ittqartsyvaeeilwgqrfvptvseeegayavdyskfg
ENSTNIP00000009249  .............--------------------------vivilegvvettgittqartsyvseeilwghrfvpivte
ENSTNIP00000005244  .............--------------------------rgsplyelsaqalsaedleiivilegvvettgitmqart
ENSTNIP00000005246  .............--------------------------rgsplyelsaqalsaedleiivilegvvettgitmqart
ENSTNIP00000014127  .............--------------------------alqpgpsdvgkkcavefevkgfcgqnqddrqdkqssvrl
ENSTNIP00000006368  .............YELSADSLPHQDFELV----------vflegtaestssacqvrtsyipqeiqwgytflpiisciq
ENSTNIP00000009083  .............--------------------------slqpgpddkgkacgvdfevktylakeksnpdekiekkdt
ENSTNIP00000002561  .............--------------------------slqpgpddkgkacgvdfevktylakeksnpdekiekkdt
ENSTNIP00000001954  .............--LSDDDIIFEDFARQRLTGVVDE--k......................................
ENSTNIP00000019946  .............--------------------------lqpgpndsgkacgvdfevkaylanaphnvdeviekkdtc
ENSTNIP00000014157  ..liefdtnnfhlLLLSDDDIIFEDFARQRLTGVVDE--k......................................
ENSTNIP00000010486  ppidtnliefdtnSVSQDDDFVFEDFARLRLKGVVDD--k......................................
ENSTNIP00000010899  .............--------------------------lvvilegmveatamttqcrssyvaseilwghrfepvlfe
ENSTNIP00000003800  .............--------------------------hvldehsplaglnarnlrrhdfellvtlnatmestaatc
ENSTNIP00000008976  .............--------------------------flilpltfyhliddnsplrawaakdpelaefellvimsa
ENSTNIP00000010244  .............--------------------------ltfyhviddssplrawaakgggwtdpeladfellvimsa
ENSTNIP00000000824  .............--------------------------ytgdstgllhqtrtsytptdihwgqrfqdvmklhkgryk
ENSTNIP00000007048  .............--------------------------rmierhyfrdhllksfdfdfgfcipnsrntcehiyefpq
ENSTNIP00000009940  .............--------------------------tntwqslieaapesqmmpanvltgnviietkfydddlhv
ENSTNIP00000019946  .............--------------------------.......................................
ENSTNIP00000005358  .............ESEVEEEVEFQEFKRAYLKGMMDD--e......................................
ENSTNIP00000014413  .............--------------------------rmierhyfqgrllksfdfdfgfcipnsrntcehiyefpq
ENSTNIP00000019221  .............--------------------------rmierhyfrerllksfdfefgfcmprskntcehiyefpp
ENSTNIP00000022950  .............--------------------------mierhyfrdqllksfdfefgfcmpsskntcehiyefpal
ENSTNIP00000005358  .............--------------------------lqnsrstprarrrllrklgeeefpyfnrgfrtltcasge
ENSTNIP00000002561  .............--------------------------e......................................
ENSTNIP00000009083  .............--------------------------e......................................
ENSTNIP00000006156  .............--------------------------hlsepvrvkmqlrrpsdrevsepvdfqylpaepdeyrlt
ENSTNIP00000004888  .............--------------------------plaglnarnlrrhdfellvtlnatmestaatcqsrtsyi
ENSTNIP00000014127  .............KDSESGDMVFEEFKRAYLKGV-----v......................................
ENSTNIP00000020787  .............--------------------------nledgcwgaavvkqegnrihlsvnssataavgryqltve
ENSTNIP00000002395  .............--------------------------idksspffdmavdtlhkqefelvvfldgtaestssscqv
ENSTNIP00000013223  .............--------------------------idksspffdmavdtlhkqefelvvfldgtaestssscqv
ENSTNIP00000005835  .............--------------------------pifpnkdrksrwpgritntsdsvltigitplancivgky
ENSTNIP00000009178  .............--------------------------psplyptlcegrnnhfelvvflsalregtgdicqkrtsy
ENSTNIP00000010775  .............--------------------------pfstdadrlhldmktgplptvskgthatiplvdslkgkr
ENSTNIP00000005251  .............--------------------------nlqkptsvfvqlkrksdnetsepkpftyhpqvigsdkee
ENSTNIP00000005249  .............--------------------------nlqkptsvfvqlkrksdnetsepkpftyhpqvigsdkee
ENSTNIP00000005250  .............--------------------------nlqkptsvfvqlkrksdnetsepkpftyhpqvigsdkee
ENSTNIP00000016350  .............--------------------------eierpvtvflqlkrkkagdssdpkqftyiphvqdkeevl
ENSTNIP00000015973  .............--------------------------vrndgiiysttltftytp.....................
ENSTNIP00000010563  .............--------------------------qdiaeevevsvslrrisdqmesepigftylphnpdpyev
ENSTNIP00000021888  .............--------------------------ygtravfglsaiinnscwsaavtsppgdtlalsicsapd
ENSTNIP00000021411  .............--------------------------ggqdqappppgrawawklwelqaplppgaqeleivckav
ENSTNIP00000020537  .............--------------------------vhfnipsddgcksgihcpilvqhsysyindlpvkseypa
ENSTNIP00000005012  .............--------------------------ipftpgdydvnitygghpipgspfqvpvkdpvd......
ENSTNIP00000019109  .............--------------------------ipftpgdydvnitygghpipgspfqvpvkdpvd......
ENSTNIP00000000464  .............--------------------------eyipftpgdydvnitygghpipgspfqvpvkdpv.....
ENSTNIP00000007616  .............--------------------------vpyepgtynlnityggqpitgspfsvpvsdtvd......
ENSTNIP00000003313  .............--------------------------vpyepgtynlnityggqpitgspfsvpvsdtvd......
ENSTNIP00000002488  .............--------------------------vpyepgtynlnityggqpitgspfsvpvsdtv.......
ENSTNIP00000003313  .............--------------------------akdagegllavqitdpegkpkkanirdnhdgtylvsyvp
ENSTNIP00000001789  .............--------------------------gnerktlswtmlpsvigvvsvtvtaeavashascdneiv
ENSTNIP00000002977  .............--------------------------gnerktlswtmlpsvigvvsvtvtaeavashascdneiv
ENSTNIP00000001513  .............--------------------------gnerktlswtmlpsvigvvsvtvtaeavashascdneiv
ENSTNIP00000017397  .............--------------------------gnerktlswtmlpsvigvvsvtvtaeavashascdneiv
ENSTNIP00000017377  .............--------------------------vplsgdqyssclcggerktvswnlvasttgvvevsvtaa
ENSTNIP00000007616  .............--------------------------dakdagegllavqitdpegkpkkanirdnhdgtylvsyv
ENSTNIP00000008895  .............--------------------------gsctveyipfnsgeydvnitfgglpipgspfsvpvr...
ENSTNIP00000002488  .............--------------------------idakdagegllavqitdpegkpkkanirdnhdgtylvsy
ENSTNIP00000006628  .............--------------------------vqegpapggrwwfsqwrvqdetvltlhspadaaighyrl
ENSTNIP00000008517  .............--------------------------afnsqsgvwpgqivemqgsvvtvsvtpatdaivgryrvy
ENSTNIP00000017383  .............--------------------------cgeesatftwivtpaalgipvklkvsaealktdvlcgne
ENSTNIP00000008384  .............--------------------------cgeesatftwivtpaalgipvklkvsaealktdvlcgne
ENSTNIP00000009333  .............--------------------------fspglydinityggehipgspfrvpvtd...........
ENSTNIP00000007897  .............--------------------------vsvfvdgwrcarqpvtvplsliradgliyrssfsftytp
ENSTNIP00000015072  .............--------------------------kteepsllepcifdgqpksiss.................
ENSTNIP00000003494  .............--------------------------kteepsllepcifdgqpksiss.................
ENSTNIP00000006950  .............--------------------------pviaplfpqkreegwwvvigdpksnslisikrltlqqka
ENSTNIP00000006734  .............--------------------------ltitaatgpqpsetrgtlsrvripplpasrpakaawkmd
ENSTNIP00000009333  .............--------------------------itdqdgkakqpsigdngdgtycvsyvpdrtgrytiviky
ENSTNIP00000000464  .............--------------------------geglltvqildpegkpknatiqdnrdgtytvsyvpdstg
ENSTNIP00000007616  .............--------------------------kgleepckrkdlgdgvygfeyyptspgtysititwggqh
ENSTNIP00000003313  .............--------------------------kgleepckrkdlgdgvygfeyyptspgtysititwggqh
ENSTNIP00000002488  .............--------------------------kgleepckrkdlgdgvygfeyyptspgtysititwggqh
ENSTNIP00000003313  .............--------------------------ngdqthtvnyvptregpysinvlyddeeiprspykvkvl
ENSTNIP00000002488  .............--------------------------ngdqthtvnyvptregpysinvlyddeeiprspykvkvl
ENSTNIP00000007616  .............--------------------------ngdqthtvnyvptregpysinvlyddeeiprspykvkvl
ENSTNIP00000014961  .............--------------------------gplpqkksntkvsfglsgstpdtewrasatdgpsektvc
ENSTNIP00000008895  .............--------------------------aepitvtdnndgthtanyspandgpytvcvkyadqevpc
ENSTNIP00000012789  .............SSV-----------------------ss.....................................
ENSTNIP00000008895  .............--------------------------ytvsyvpdmtgrytitikyggdeipyspycihaiptgd.
ENSTNIP00000000464  .............--------------------------cqdngdgscsvyylptepgeyainilfadqhipgspfka
ENSTNIP00000005012  .............--------------------------kpknatiqdnrdgtytvsyvpdstgpytitikyggdeip
ENSTNIP00000019109  .............--------------------------kpknatiqdnrdgtytvsyvpdstgpytitikyggdeip
ENSTNIP00000005012  .............--------------------------ecqdngdgscsvyylptepgeyainilfadqhipgspfk
ENSTNIP00000019109  .............--------------------------ecqdngdgscsvyylptepgeyainilfadqhipgspfk
ENSTNIP00000009333  .............--------------------------dngdgtcsvsylptepgeylvnilfedvpipgspfradi
ENSTNIP00000013084  .............SSVSSQYSVNLEWLRMAIPEQPEP--p......................................
ENSTNIP00000005012  .............--------------------------dagnavynceyyplkpgkytvsitwgghpiprspfevev
ENSTNIP00000000464  .............--------------------------dagnavynceyyplkpgkytvsitwgghpiprspfevev
ENSTNIP00000019109  .............--------------------------dagnavynceyyplkpgkytvsitwgghpiprspfevev
ENSTNIP00000005012  .............--------------------------qdgpytvavkyaeqevphspfkvmsqpghdaskvrasgp
ENSTNIP00000000464  .............--------------------------qdgpytvavkyaeqevphspfkvmsqpghdaskvrasgp
ENSTNIP00000019109  .............--------------------------qdgpytvavkyaeqevphspfkvmsqpghdaskvrasgp
ENSTNIP00000016574  .............--------------------------rtssis.................................
ENSTNIP00000009333  .............--------------------------dcrkagvaplavdvtgpkglreavevtdggdgqhlvsyt
ENSTNIP00000009333  .............--------------------------vtdnadgtysvaytpfenglhsvqvlyddtpvpkspfqv
ENSTNIP00000009333  .............--------------------------ptepgeyavhvtcdnvdiehspfmalivpd.........
ENSTNIP00000021564  .............--------------------------evpayrdasvchavkvnfcvingkrkrsqpqhftftp..
ENSTNIP00000015432  .............--------------------------evpayrdasvchavkvnfcvingkrkrsqpqhftftp..
ENSTNIP00000007616  .............--------------------------ydgmpvpkspfhvavtegcn...................
ENSTNIP00000003313  .............--------------------------ydgmpvpkspfhvavtegcn...................
ENSTNIP00000002488  .............--------------------------ydgmpvpkspfhvavtegcn...................
ENSTNIP00000005012  .............--------------------------nkdgtclvsylptapgdyniivkfdnkhipgspftakit
ENSTNIP00000000464  .............--------------------------nkdgtclvsylptapgdyniivkfdnkhipgspftakit
ENSTNIP00000019109  .............--------------------------nkdgtclvsylptapgdyniivkfdnkhipgspftakit
ENSTNIP00000003313  .............--------------------------pgdysilvkyndkhipgspfsaritgd............
ENSTNIP00000002488  .............--------------------------pgdysilvkyndkhipgspfsaritgd............
ENSTNIP00000007616  .............--------------------------pgdysilvkyndkhipgspfsaritgd............
ENSTNIP00000007616  .............--------------------------gtfdifytapqpgeyvicvrfggehipnspfqvtatd..
ENSTNIP00000002488  .............--------------------------gtfdifytapqpgeyvicvrfggehipnspfqvtaleg.
ENSTNIP00000003313  .............--------------------------tvaptldl...............................
ENSTNIP00000002488  .............--------------------------tvaptldl...............................
ENSTNIP00000007616  .............--------------------------tvaptldl...............................
ENSTNIP00000006675  .............--------------------------l......................................
ENSTNIP00000008895  .............--------------------------dngdgscsvsylptepgeyainilfaeqhvpgspfkavv
ENSTNIP00000021437  .............--------------------------tqanmlfvevppyrdrfishpakvnffvingkkkrsqpq
ENSTNIP00000007616  .............--------------------------ypgsytltiryggqdvpnfparlnvepavdasgvrvfgp
ENSTNIP00000002488  .............--------------------------ypgsytltiryggqdvpnfparlnvepavdasgvrvfgp
ENSTNIP00000003313  .............--------------------------ypgsytltiryggqdvpnfparlnvepavdasgvrvfgp
ENSTNIP00000008895  .............--------------------------yavhvicddedikdspfmahvlsa...............
ENSTNIP00000014295  .............--------------------------vppyhsktvasavqvqfyvcngkrkrsqsqrftyl....
ENSTNIP00000005012  .............--------------------------esyltdkgdgtyrveytafedgihlievlyddvpvpksp
ENSTNIP00000000464  .............--------------------------esyltdkgdgtyrveytafedgihlievlyddvpvpksp
ENSTNIP00000019109  .............--------------------------esyltdkgdgtyrveytafedgihlievlyddvpvpksp
ENSTNIP00000014296  .............--------------------------vppyhsktvasavqvqfyvcngkrkrsqsqrftyl....
ENSTNIP00000003313  .............--------------------------frmnigagchpnkvkvsgpgv..................
ENSTNIP00000002488  .............--------------------------frmnigagchpnkvkvsgpgv..................
ENSTNIP00000007616  .............--------------------------frmnigagchpnkvkvsgpgv..................
ENSTNIP00000008895  .............--------------------------vtycptepgnyiinikfadqhvpgspftvkvfgeg....
ENSTNIP00000002599  .............--------------------------l......................................
ENSTNIP00000005012  .............--------------------------yavhvicddedikdspfiahilpaa..............
ENSTNIP00000008895  .............--------------------------eiackdnkdgtctvsylptacgdynivvkfddkqipgsp
ENSTNIP00000019109  .............--------------------------yavhvicddedikdspfiahilpaa..............
ENSTNIP00000008895  .............--------------------------dgtysityiplfqglytitikyggcavpnfpsrllvdpa
ENSTNIP00000005012  .............--------------------------kytppapgrytimvlfaeqeipispfkvkvdpsh.....
ENSTNIP00000008895  .............--------------------------ytavqqgnmsiavchggdpipkspfhimvapll......
ENSTNIP00000019109  .............--------------------------kytppapgrytimvlfaeqeipispfkvkvdpsh.....
ENSTNIP00000009333  .............--------------------------enedgtfdifytapapgnyviyvrfggeniphspfnvva
ENSTNIP00000013288  .............--------------------------yvdgqwthdpaepvvtnqmgtvnniiqvk..........
ENSTNIP00000005012  .............--------------------------vytpvkpikhtiiitwgevnvpnspfrvlvgegsh....
ENSTNIP00000000464  .............--------------------------vytpvkpikhtiiitwgevnvpnspfrvlvgegsh....
ENSTNIP00000019109  .............--------------------------vytpvkpikhtiiitwgevnvpnspfrvlvgegsh....
ENSTNIP00000009333  .............--------------------------aqepgdyeisvkfneqhipdspflvpvaap.........
ENSTNIP00000009333  .............--------------------------hpsspgkysvsiswggtqipkspfevavgeea.......
ENSTNIP00000000464  .............--------------------------ytppapgrytimvlfaeqeipispfkvkvdpshd.....
ENSTNIP00000005012  .............--------------------------ynvnikfaekhipgspftvkvtgeg..............
ENSTNIP00000000464  .............--------------------------ynvnikfaekhipgspftvkvtgeg..............
ENSTNIP00000005012  .............--------------------------ytvkytalqqgnmsisvthggdpipkspfhitvappld.
ENSTNIP00000000464  .............--------------------------ytvkytalqqgnmsisvthggdpipkspfhitvappld.
ENSTNIP00000019109  .............--------------------------ynvnikfaekhipgspftvkvtgeg..............
ENSTNIP00000019109  .............--------------------------ytvkytalqqgnmsisvthggdpipkspfhitvappld.
ENSTNIP00000008895  .............--------------------------vkytppgsgqytimvlfadqqipispfrikvepsh....
ENSTNIP00000003313  .............--------------------------syivqepgdyevsirfndehipdspfivpvasps.....
ENSTNIP00000002488  .............--------------------------syivqepgdyevsirfndehipdspfivpvasps.....
ENSTNIP00000007616  .............--------------------------syivqepgdyevsirfndehipdspfivpvasps.....
ENSTNIP00000006011  .............--------------------------lnlnevpdiehpnyavi......................
ENSTNIP00000013084  .............--------------------------lap....................................
ENSTNIP00000009333  .............--------------------------edkgdgvyrctyrptqagthgvtvtfggvgipkspfsvd
ENSTNIP00000005012  .............--------------------------yippfhgahtitikygghmiphfpkvlqvdpsvdtsgvh
ENSTNIP00000000464  .............--------------------------yippfhgahtitikygghmiphfpkvlqvdpsvdtsgvh
ENSTNIP00000019109  .............--------------------------yippfhgahtitikygghmiphfpkvlqvdpsvdtsgvh
ENSTNIP00000008895  .............--------------------------twagvtvpnspfrvmvgegshpenvkvygpgve......
ENSTNIP00000009333  .............--------------------------ptepgnyfvsirfaeehipgspftvhvtgeg........
ENSTNIP00000009872  .............--------------------------tpstfcysfkpssarwqayfkpegldlhrpsiwifspas
ENSTNIP00000000464  .............--------------------------yvpkvegvhkvkvlfagqdidkspytvnvak........
ENSTNIP00000005012  .............--------------------------yvpkvegvhkvkvlfagqdidkspytvnvak........
ENSTNIP00000019109  .............--------------------------yvpkvegvhkvkvlfagqdidkspytvnvak........
ENSTNIP00000000464  .............--------------------------gmeldmdvvenhdgtfdiyytapepgkyvitirfggqni
ENSTNIP00000009333  .............--------------------------ipnandtftvkyippaagkmtvkvlftdkevpqspfqvt
ENSTNIP00000016574  .............--------------------------plllapqtgtkektlccwfc...................
ENSTNIP00000018364  .............--------------------------fvdgqwvhdiseptvtselgtinnliqvk..........
ENSTNIP00000000464  .............--------------------------vfrctyrpvlegphtihvlfaeqeipkspytvniaea..
ENSTNIP00000009333  .............--------------------------hkdgtcsvsylptlpgdysiivkynqdhipgspftarit
ENSTNIP00000003313  .............--------------------------kgnnsyrctykptqegqhiisvtfaggqisrspftvsvg
ENSTNIP00000002488  .............--------------------------kgnnsyrctykptqegqhiisvtfaggqisrspftvsvg
ENSTNIP00000007616  .............--------------------------kgnnsyrctykptqegqhiisvtfaggqisrspftvsvg
ENSTNIP00000019109  .............--------------------------syivkepgdyevsikfnnehipdspfivpia........
ENSTNIP00000005012  .............--------------------------syivkepgdyevsikfnnehipdspfivpia........
ENSTNIP00000000464  .............--------------------------syivkepgdyevsikfnnehipdspfivpia........
ENSTNIP00000003313  .............--------------------------gsaftvkvtgeg...........................
ENSTNIP00000002488  .............--------------------------gsaftvkvtgeg...........................
ENSTNIP00000007616  .............--------------------------gsaftvkvtgeg...........................
ENSTNIP00000018732  .............--------------------------vdnsdgtysvsytpdqegaysvwvcvraqhvqgspfalt
ENSTNIP00000003313  .............--------------------------eldvdvvenedgtfdifytapqpgeyvicvrfggehipn
ENSTNIP00000008895  .............--------------------------rkdgscgvsyvvqgpgdyeisikfndehipdspftvpis
ENSTNIP00000009333  .............--------------------------vaapld.................................
ENSTNIP00000003313  .............--------------------------ptepgeyavhvlcnnediqhspfmaeivtp.........
ENSTNIP00000002488  .............--------------------------ptepgeyavhvlcnnediqhspfmaeivtp.........
ENSTNIP00000007616  .............--------------------------ptepgeyavhvlcnnediqhspfmaeivtp.........
ENSTNIP00000008895  .............--------------------------kgprgavepvkvvemgndmfecsyypvsrgkyvvtiswg
ENSTNIP00000001925  .............PTASAP--------------------ypaaafgfgntalpqpppappnpfd..............
ENSTNIP00000001568  .............PTASAP--------------------ypaaafgfgntalpqpppappnp................
ENSTNIP00000014417  .............--------------------------vdghwmldpngavatsrtgvvnntiqvkrtdfe......
ENSTNIP00000008895  .............--------------------------dgaeldvdvvenadgtfdvyytapepgkyvitirfggen
ENSTNIP00000000464  .............--------------------------yavhvicddedikdspfiahilpaa..............
ENSTNIP00000009333  .............--------------------------evpegykvhytpmapgnylisvkyggpyhvsgspfkakv
ENSTNIP00000003313  .............--------------------------eakvtanndknrtysvfytprvtgmhkvtvlfagqhisk
ENSTNIP00000002488  .............--------------------------eakvtanndknrtysvfytprvtgmhkvtvlfagqhisk
ENSTNIP00000007616  .............--------------------------eakvtanndknrtysvfytprvtgmhkvtvlfagqhisk
ENSTNIP00000005497  .............--------------------------qrlstrvhvnfyvcngkkkrsqhqhftfvp.........
ENSTNIP00000012789  .............--------------------------pll....................................
ENSTNIP00000008895  .............--------------------------vtytvkeqgsyilivkwgddnvpgspfhvtv........
ENSTNIP00000005012  .............--------------------------ctyrpvlegphtihvlfaeqeipkspytvniaea.....
ENSTNIP00000019109  .............--------------------------ctyrpvlegphtihvlfaeqeipkspytvniaea.....
ENSTNIP00000009333  .............--------------------------dkyairfiprenglhtidvkfngshipgspfqvrvgepg
ENSTNIP00000009333  .............--------------------------vkvtgkgdglysccytpaapikhtlaltwggvsipkspf
ENSTNIP00000006205  .............--------------------------slyvsngkrkrssthcfkflps.................
ENSTNIP00000009333  .............--------------------------vqaktevldnqdgtqtvtyvplssgmytlllryggrpvp
ENSTNIP00000007616  .............--------------------------pyhivgspfkaris.........................
ENSTNIP00000002488  .............--------------------------pyhivgspfkaris.........................
ENSTNIP00000003313  .............--------------------------pyhivgspfkaris.........................
ENSTNIP00000008895  .............--------------------------mdfqecpegykvsytptapgnylisikyggpqhivgspf
ENSTNIP00000009333  .............--------------------------lkaepnegkkthsvsyvpqvtgphrvtvlfagqqipksp
ENSTNIP00000005012  .............--------------------------skvkldcrecpegykitytpmapgnyliaikyggpqhiv
ENSTNIP00000000464  .............--------------------------skvkldcrecpegykitytpmapgnyliaikyggpqhiv
ENSTNIP00000019109  .............--------------------------skvkldcrecpegykitytpmapgnyliaikyggpqhiv
ENSTNIP00000003313  .............--------------------------dkyavrfiprenglylidvkfngshipgspfkirvgetg
ENSTNIP00000002488  .............--------------------------dkyavrfiprenglylidvkfngshipgspfkirvgetg
ENSTNIP00000007616  .............--------------------------dkyavrfiprenglylidvkfngshipgspfkirvgetg
ENSTNIP00000001133  .............--------------------------lnlnqvpdi..............................
ENSTNIP00000012114  .............--------------------------qngsytvsylpkcegehlvsvlvcnrhiqgspfkvtvks
ENSTNIP00000002873  .............--------------------------lnlnqvpdi..............................
ENSTNIP00000008895  .............--------------------------nndknrtysvvylpkvegfhqvkvlfagqdidrspfrvn
ENSTNIP00000009333  .............--------------------------syqlreagsyslvvkwgedhipgspfhvtv.........
ENSTNIP00000005012  .............--------------------------khmgnklynvtyaikdkgsyqiivkwgddnvpgspykvv
ENSTNIP00000000464  .............--------------------------khmgnklynvtyaikdkgsyqiivkwgddnvpgspykvv
ENSTNIP00000019109  .............--------------------------khmgnklynvtyaikdkgsyqiivkwgddnvpgspykvv
ENSTNIP00000008895  .............--------------------------svfrctyipvleglhmvhvtfagqqiprspfaahiseac
ENSTNIP00000019406  .............--------------------------wqnkskgakktakskkkkltkkkttpapakskqangnva
ENSTNIP00000000464  .............--------------------------pfqftvgpmgeggahkvraggpgler.............
ENSTNIP00000005012  .............--------------------------pfqftvgpmgeggahkvraggpgler.............
ENSTNIP00000002873  .............--------------------------klqpsn.................................
ENSTNIP00000019109  .............--------------------------fqftvgpmgeggahkvraggpgler..............
ENSTNIP00000008895  .............--------------------------vsnpsgattdayitdkgdgtyrveytphedglhlievlf
ENSTNIP00000001133  .............--------------------------klqpsn.................................
ENSTNIP00000007616  .............--------------------------ftvkytppgagsytimvlfadqaipmtpirikvdpah..
ENSTNIP00000003313  .............--------------------------ftvkytppgagsytimvlfadqaipmtpirikvdpah..
ENSTNIP00000002488  .............--------------------------ftvkytppgagsytimvlfadqaipmtpirikvdpah..
ENSTNIP00000005680  .............--------------------------lvdhnngtyefvyvipregdfslalrlydqhikgspfrl
ENSTNIP00000005012  .............--------------------------gmeldmdvvenhdgtfdiyytapepgkyvitirfggqni
ENSTNIP00000019109  .............--------------------------gmeldmdvvenhdgtfdiyytapepgkyvitirfggqni
ENSTNIP00000008895  .............--------------------------qgaggqgrldvkilspsrrpipcklesgvnnevytvtyi
ENSTNIP00000000464  .............--------------------------kmtspsgrpipcklesdkakgihsvkyippeeghykvdv
ENSTNIP00000005012  .............--------------------------kmtspsgrpipcklesdkakgihsvkyippeeghykvdv
ENSTNIP00000019109  .............--------------------------kmtspsgrpipcklesdkakgihsvkyippeeghykvdv
ENSTNIP00000007616  .............--------------------------syqlkekgeyilvvkwgdehipgspyhitv.........
ENSTNIP00000003313  .............--------------------------syqlkekgeyilvvkwgdehipgspyhitv.........
ENSTNIP00000002488  .............--------------------------syqlkekgeyilvvkwgdehipgspyhitv.........
ENSTNIP00000009333  .............--------------------------eegvhainvtydghtvpgspfpvdaqlppdpskvkasgp
ENSTNIP00000005012  .............--------------------------vgdp...................................
ENSTNIP00000000464  .............--------------------------vgdp...................................
ENSTNIP00000019109  .............--------------------------vgdp...................................
ENSTNIP00000002488  .............--------------------------qftvgplgeggahkvraggpgler...............
ENSTNIP00000007616  .............--------------------------qftvgplgeggahkvraggpgler...............
ENSTNIP00000003313  .............--------------------------qftvgplgeggahkvraggpgler...............
ENSTNIP00000015515  .............--------------------------qiisnsvvfey............................
ENSTNIP00000020196  .............-H------------------------ipgvvevtlsykskqfckgapgrfvyta...........
ENSTNIP00000019366  .............--------------------------lraeilsadgtcteaevvdnkngtyevgytirsegeftf
ENSTNIP00000019239  .............--------------------------pgvvevtlsykskqfckgtpgrfiyt.............
ENSTNIP00000009911  .............--------------------------tapkegtfnlslrlyeqhikgspfrikv...........
ENSTNIP00000018930  .............-H------------------------ipgvvevtlsykskqfckgapgrfiyt............
ENSTNIP00000008895  .............--------------------------fqftvgplgeggahkvraggtgldr..............
ENSTNIP00000008895  .............--------------------------airfiprenglhtidvrfngshipgspfkirvgel....
ENSTNIP00000005679  .............--------------------------lvdhnngtyefvyvipregdflgvrlydqhikgspfrlk
ENSTNIP00000002488  .............--------------------------skvepglspetsqvkfipreagpyqveltydgvpipgsp
ENSTNIP00000007616  .............--------------------------skvepglspetsqvkfipreagpyqveltydgvpipgsp
ENSTNIP00000003313  .............--------------------------skvepglspetsqvkfipreagpyqveltydgvpipgsp
ENSTNIP00000002618  .............--------------------------lap....................................
ENSTNIP00000012827  .............--------------------------vsdnkngtyevgytlhsegeysfslmlygqpvrgspfrl
ENSTNIP00000004899  .............--------------------------lap....................................
ENSTNIP00000007675  .............--------------------------sp.....................................
ENSTNIP00000001568  .............--------------------------dltk...................................
ENSTNIP00000018500  .............--------------------------skanlalltlmep..........................
ENSTNIP00000004388  .............--------------------------evsirfndehipdspfivpvaspsd..............
ENSTNIP00000009333  .............--------------------------qhianspitimvvqsevgnasqvraygdgleq.......
ENSTNIP00000003898  .............--------------------------.......................................
ENSTNIP00000000963  .............--------------------------vsvsvsidkahlqkdlrfeyv..................
ENSTNIP00000010401  .............--------------------------vsvsvsidkahlqkdlrfeyv..................
ENSTNIP00000006011  .............--------------------------rttp...................................
ENSTNIP00000003313  .............TTPS----------------------greepcllkmlrnghvgisfvpkeigehlvnikkngrhi
ENSTNIP00000002488  .............TTPS----------------------greepcllkmlrnghvgisfvpkeigehlvnikkngrhi
ENSTNIP00000006954  .............--------------------------vcrvgpakddkgeiivttksgglgtstvsfkl.......
ENSTNIP00000007616  .............TTPS----------------------greepcllkmlrnghvgisfvpkeigehlvnikkngrhi
ENSTNIP00000007675  .............--------------------------glgs...................................
ENSTNIP00000005012  .............--------------------------tpkevgehevsvrkngvhvanspfkimvgq.........
ENSTNIP00000000464  .............--------------------------tpkevgehevsvrkngvhvanspfkimvgq.........
ENSTNIP00000006346  .............-----I--------------------vcllndatnyrvqeahvevcvkdcindyralsprpftfv
ENSTNIP00000019109  .............--------------------------tpkevgehevsvrkngvhvanspfkimvgq.........
ENSTNIP00000003898  .............--------------------------fvtelmf................................
ENSTNIP00000005012  .............--------------------------itikyqpterglhemdikyegnqipgsplqffvdavntg
ENSTNIP00000000464  .............--------------------------itikyqpterglhemdikyegnqipgsplqffvdavntg
ENSTNIP00000003313  .............--------------------------kyegihipgsplqffvdyinsgnvsaygpgl........
ENSTNIP00000002488  .............--------------------------kyegihipgsplqffvdyinsgnvsaygpgl........
ENSTNIP00000007616  .............--------------------------kyegihipgsplqffvdyinsgnvsaygpgl........
ENSTNIP00000008895  .............--------------------------vsvkktgkhvsnspfrimvgqseigdaskvkvfgqgl..
ENSTNIP00000018500  .............--------------------------p......................................
ENSTNIP00000009333  .............--------------------------spteaglhemhikyngthipesplqfyvnhanspsmtah
ENSTNIP00000010401  .............--------------------------cqvlsptsmlcqapelpislarqqevlekpdefgfkldd
ENSTNIP00000000963  .............--------------------------cqvlsptsmlcqapelpislarqqevlekpdefgfkldd
ENSTNIP00000008895  .............--------------------------kyspterglhemeikydgshipgsplqfyvdainsghvt
ENSTNIP00000009333  .............--------------------------gspfqftvgplgeggaskvraggqgl.............
ENSTNIP00000001925  .............--------------------------dltk...................................
ENSTNIP00000019147  .............--------------------------tmltcktspyavpckqpvkltvdsverqapllftynr..
ENSTNIP00000019148  .............--------------------------tmltcktspyavpckqpvkltvdsverqapllftynr..
ENSTNIP00000003258  .............--------------------------vcrvgpakddkgeiivttksgglgtstvsfkl.......
ENSTNIP00000011053  .............--------------------------vcrvgpakddkgeiivttksgglgtstvsfkl.......
ENSTNIP00000007602  .............--------------------------crtkasggeksgqvsvkvsggdlglstdlftyqdp....
ENSTNIP00000008163  .............--------------------------tvtvskmsqaasssfty......................
ENSTNIP00000019109  .............--------------------------tikyqpterglhemdikyegnqipgsplqffvdavntgv
ENSTNIP00000006767  .............--------D-----------------maeallphspggpvelcigvcsaefrtlssqtysfvs..
ENSTNIP00000006766  .............--------D-----------------maeallphspggpvelcigvcsaefrtlssqtysfvs..
ENSTNIP00000008162  .............--------------------------tvtvskmsqaasssfty......................
ENSTNIP00000019061  .............--------------------------svstsivceigpinpssqhwgqvevevkgekrgmsfinf
ENSTNIP00000007602  .............--------------------------lkcvtgssnrtgqhgvtlhynsgqrhlhssaytyth...
ENSTNIP00000012220  .............--------------------------dtkvifqenvadekswkaeaeidmelfhq..........
ENSTNIP00000008162  .............--------------------------dtqvycktgnnpggtyrvmlyhkekghaqsdvtfty...
ENSTNIP00000010401  .............--------------------------emgkaeksqytgnvqvcvgvgecrpefmaksskyyy...
ENSTNIP00000000963  .............--------------------------emgkaeksqytgnvqvcvgvgecrpefmaksskyyy...
ENSTNIP00000002265  .............--------------------------pvtvlidsfqvtttktfhyk...................
ENSTNIP00000017783  .............--------------------------pvtvlidsfqvtttktfhyk...................
ENSTNIP00000006767  .............--------------------------etsnfctlvndstmtclapglvynklappegalhpeefg
ENSTNIP00000006766  .............--------------------------etsnfctlvndstmtclapglvynklappegalhpeefg
ENSTNIP00000021085  .............--------------------------tvslelvcitgpsaddktdivqvdvdqsgtgtskesfsy
ENSTNIP00000013222  .............--------------------------sheinekspfwemslaqmekeefeivvilegmveat...
ENSTNIP00000008163  .............--------------------------pltfn..................................
ENSTNIP00000006767  .............--------------------------icitpaslsgsgpasirlmidkaevtssetkyvyte...
ENSTNIP00000006766  .............--------------------------icitpaslsgsgpasirlmidkaevtssetkyvyte...
ENSTNIP00000008162  .............--------------------------nvthiicvtnaqrqsqetkvrvsikdqgvakmdnadffy
ENSTNIP00000008162  .............--------------------------pltfn..................................
ENSTNIP00000008003  .............--------------------------akrvppsdvpfepthagvvevlveggrsgmsefnftyrd
ENSTNIP00000009803  .............--------------------------kdgsflvryrmyatysdlhihvllkneqvanspfll...
ENSTNIP00000008163  .............--------------------------vcrlgsatagtypvtvsfpslghs...............
ENSTNIP00000010138  .............--------------------------tqpkgnvssiiclsqhisevrdvplsvfidkspipttkv
ENSTNIP00000008162  .............--------------------------vcrlgsatagtypvtvsfpslghs...............
ENSTNIP00000006346  .............--------------------------svmvclapsvadselgfsesgtdpdeigfyldnvnalvv
ENSTNIP00000021085  .............--------------------------ektdnviectmpaitqahadsvsvcvefenltcq.....
ENSTNIP00000002265  .............--------------------------vtvgsttcavlpekssseklvckiqeknkpgqdlk....
ENSTNIP00000017783  .............--------------------------vtvgsttcavlpekssseklvckiqeknkpgqdlk....
ENSTNIP00000008003  .............--------------------------pcpvlsfgdvitcttgryseq..................
ENSTNIP00000021085  .............--------------------------ttcgvisnntihcpshpssesqqtavqfflngvlytd..
ENSTNIP00000008163  .............--------------------------askktvypggrglkieawndtrsnqlsdvf.........
ENSTNIP00000019061  .............--------------------------nitcrtgeyraltpsrstvkygksttttipnvfqfven.
ENSTNIP00000008163  .............--------------------------rvffgdaecevkdasenelqcilqteqkt..........
ENSTNIP00000007472  .............--------------------------trsppglsaalsvvcelqpsgkqregpvqvrvgaappgr
ENSTNIP00000009146  .............--------------------------trsppglsaalsvvcelqpsgkqregpvqvrvgaappgr
ENSTNIP00000008163  .............--------------------------elritnvndgnisarvdalpagdhpikvivrskglas..
ENSTNIP00000002804  .............--------------------------lptcaevsprtlgvvaskqgqrkkcvppgeatptsivfs
ENSTNIP00000008162  .............--------------------------askktvypggrglkieawndtrsnqlsdvf.........
ENSTNIP00000008162  .............--------------------------nrvffgdaecevkdasenelqcilqteqk..........
ENSTNIP00000007744  .............---------------P----------klkdegwflvlgevehrqllalkrlghvqarsstalafy
ENSTNIP00000008163  .............--------------------------svicdtspsqphggdvifqigniqsschsnc........
ENSTNIP00000007714  .............--F-----------------------qsrrtymlgsfvllfnpwlke..................
ENSTNIP00000008162  .............--------------------------elritnvndgnisarvdalpagdhpikvivrskglas..
ENSTNIP00000008163  .............--------------------------ggqpcevinstnadimcrlrydnrlpigvahavvvrian
ENSTNIP00000010138  .............--------------------------vgnssptrmecftpafprdeteegelsfdmdgdlglwnr
ENSTNIP00000019147  .............--------------------------vplvtvevagahckllrqdyinrwteiqcspmsagnftp
ENSTNIP00000019148  .............--------------------------vplvtvevagahckllrqdyinrwteiqcspmsagnftp
ENSTNIP00000018520  .............--------------------------lptcaevhvkvsvpkgikfv...................
ENSTNIP00000020566  .............--------------------------qevlqepesnvvkvaftvrkagryevavklgglnvaysp
ENSTNIP00000008162  .............--------------------------svicdtspsqphggdvifqigniqsschsnc........
ENSTNIP00000009105  .............--------------------------rihvpppldrqdgsflvryrlygtvqgglkvevhhqgvh
ENSTNIP00000008162  .............--------------------------ggqpcevinstnadimcrlrydnrlpigvahavvvrian
ENSTNIP00000005417  .............--------------------------epvevqrmtcrtprvtpdlkikgvwfqmdnvrih.....
ENSTNIP00000004483  .............--------------------------vkearyiaitmmkayenysfeelrfasptpkrpsenmli
ENSTNIP00000001542  .............--------------------------vkearyiaitmmkayenysfeelrfasptpkrpsenmli
ENSTNIP00000018046  .............--------------------------vkearyiaitmmkayenysfeelrfasptpkrpsenmli
ENSTNIP00000010138  .............--------------------------qvrlghtactvlpaksnnthlvckirirttelftpvnit
ENSTNIP00000002265  .............--------------------------vcngstnathmecwapafpeempdekesgqisihmedqr
ENSTNIP00000017783  .............--------------------------vcngstnathmecwapafpeempdekesgqisihmedqr
ENSTNIP00000006346  .............-----------E--------------gsylnagsyvsvrfaqrpcffkrkvk.............
ENSTNIP00000008162  .............--------------------------lfcqspfnngsqdtlsctvvvsnklktvnisngfty...
ENSTNIP00000006857  .............--------------------------setqlvcewpnltgehkvtvrvggfeyspgtlqiys...
ENSTNIP00000019147  .............--------------------------laklalqppvvtkvafvldgymteqk.............
ENSTNIP00000019148  .............--------------------------laklalqppvvtkvafvldgymteqk.............
ENSTNIP00000006521  .............--------------------------setqlvcewpnltgehkvtvrvggfeyspgtlqiys...
ENSTNIP00000019061  .............--------------------------tgsgfdfiqtavmkvhgnnmtaveagieleysspeyvlh
ENSTNIP00000004388  .............--------------------------ngakgmidakvhspsgaleecciteid............
ENSTNIP00000016904  .............--------------------------lgagvagrvldhrngfysalfpllwvgpaqvevtl....
ENSTNIP00000022219  .............--------------------------yskrdfgkweltlppkh......................
ENSTNIP00000002960  .............--------------------------yskrdfgkweltlppkh......................
ENSTNIP00000010459  .............--------------------------cqpq...................................
ENSTNIP00000008492  .............--------------------------svlgagvagrvvdhlngsysalfslpwegsaqvevtl..
ENSTNIP00000011929  .............--------------------------fhnntvtegyvdghgrghcvspllyrtglvsleisyngs
ENSTNIP00000010401  .............--------------------------ligekpcmltvsetqllcespnltgrhkvlvs.......
ENSTNIP00000000963  .............--------------------------ligekpcmltvsetqllcespnltgrhkvlvs.......


                                                                                                    
                                                                                                    
d1cf1a2               ..............................................................................
ENSTNIP00000015820  ykvdyshfhktyevpstprcsakdm.....................................................
ENSTNIP00000014157  irkvqyap......................................................................
ENSTNIP00000001954  irkvqyap......................................................................
ENSTNIP00000014574  ksqyridyaffhktfevpstprcsakdmeerk..............................................
ENSTNIP00000014544  dylttaeeapkgmlargtynikskftdddkhdhlswewsltikkdwkd..............................
ENSTNIP00000010486  irkvqyap......................................................................
ENSTNIP00000013758  ktyevpstphlsakeldeag..........................................................
ENSTNIP00000012673  dntyevpstpvcsarelaek..........................................................
ENSTNIP00000022103  ..............................................................................
ENSTNIP00000010457  kwgyrftpvltledgfyevdynsfhdvyetntppysakeladi...................................
ENSTNIP00000017993  ..............................................................................
ENSTNIP00000006675  irkvqfap......................................................................
ENSTNIP00000002599  irkvqfap......................................................................
ENSTNIP00000007179  ekadrfhvdysrfhktyevpstplcsarelnq..............................................
ENSTNIP00000019582  gffkvdysqfhatfevptppysvkeqee..................................................
ENSTNIP00000009102  aegffdvdygafhhtfevdtpscsarelsl................................................
ENSTNIP00000017145  vtsmeeaptglmargqyaikskftdddkhdhlswewnlnikkdwt.................................
ENSTNIP00000009422  ntvrvptplcsarkldeag...........................................................
ENSTNIP00000009249  eegvysvdyskfgntvkvntplcsareldekp..............................................
ENSTNIP00000005244  sytpeeilwgrrfvsiiseedgrycvdyskfgntvpvrmpllsakeldqs............................
ENSTNIP00000005246  sytpeeilwgrrfvsiiseedgrycvdyskfgntvpvrmpllsakeldqs............................
ENSTNIP00000014127  sirkvqfsp.....................................................................
ENSTNIP00000006368  tgkyrvdfsnfsksvrvstphcvhcceadsdq..............................................
ENSTNIP00000009083  arliirkiqyap..................................................................
ENSTNIP00000002561  arliirkiqyap..................................................................
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000019946  rlmirkiqfap...................................................................
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000010899  rkecyqvrkae...................................................................
ENSTNIP00000003800  qsrtsyipqeilfgyefrpvlfsttggryvadfnffdkv.......................................
ENSTNIP00000008976  tieptsatcqvrtsylpdeilwgyefppvvslsssgkyvanftffdkvskaktmpi......................
ENSTNIP00000010244  tveptsatcqvrtsylpdeilwgyefppvvslspsgkyvadfaffdkvaktktpplfkqtl.................
ENSTNIP00000000824  vdyslfnatvwvpvpllsakefgr......................................................
ENSTNIP00000007048  lseslvrqmvecpyetrsdsfyfadnrlvmhnkadyay........................................
ENSTNIP00000009940  stsrvrlfyv....................................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000014413  lpddlirqmvarpyetrsdsfyfvdnklimhnkadyaf........................................
ENSTNIP00000019221  lsedsiqemilhpyetqsdsfyfvdnklvmhnkadysy........................................
ENSTNIP00000022950  seeimhemilhpyetqsdsfyfvdnklvmhnkadysy.........................................
ENSTNIP00000005358  wlwqpaphdvgndrcavefeikafsaesqdakvrkrstvklmirkvqfap............................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000006156  ekrkrtgdvfqslkl...............................................................
ENSTNIP00000004888  pqeilfgyefrpvlfsttggryvadfnffdkv..............................................
ENSTNIP00000014127  ..............................................................................
ENSTNIP00000020787  ttctgghavsthhpdndvyilfnpwcee..................................................
ENSTNIP00000002395  rtsfipqeimwgynflpiisrskegryrvdfsnfskvvpvatahcaycfhnikghhh.....................
ENSTNIP00000013223  rtsfipqeimwgynflpiisrskegryrvdfsnfskvvpvatahcaycfhnikghhh.....................
ENSTNIP00000005835  hmyvavmtpfgirrtkkestrdlyilfnpwsp..............................................
ENSTNIP00000009178  lrqeiqfdrrflpalvldeqgryltklqhfd...............................................
ENSTNIP00000010775  weakiveqsgnkvklsvnspasavcgqyrltvtcgsaegeattthdcsknivmlfnpwcee.................
ENSTNIP00000005251  vqrkrqktlpnfhdflhrg...........................................................
ENSTNIP00000005249  vqrkrqktlpnfhdflhrg...........................................................
ENSTNIP00000005250  vqrkrqktlpnfhdfhhrg...........................................................
ENSTNIP00000016350  rkkqkplphyepwfgg..............................................................
ENSTNIP00000015973  ..............................................................................
ENSTNIP00000010563  krkrkqtappwqsspstsqt..........................................................
ENSTNIP00000021888  apigrysltlgqltriefillfnpwcp...................................................
ENSTNIP00000021411  dssynvqpdsvlpiwnlrgvlsnawhrvrvkv..............................................
ENSTNIP00000020537  iklvvkwellddnqkdlfcikfpvqiv...................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  dmtgrytilikyggdeipyspyriralptgd...............................................
ENSTNIP00000001789  svpergrtdtvtrslivk............................................................
ENSTNIP00000002977  svpergrtdtvtrslivk............................................................
ENSTNIP00000001513  svpergrtdtvtrslivk............................................................
ENSTNIP00000017397  svpergrtdtvtrslivk............................................................
ENSTNIP00000017377  avasevscnneivtvpmrgrvdkvtrtlivk...............................................
ENSTNIP00000007616  pdmtgrytilikyggdeipyspyriralpt................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002488  vpdmtgrytilikyggdeipyspyriralp................................................
ENSTNIP00000006628  svsvmsaggnvvelvekvqfhllfnpwckd................................................
ENSTNIP00000008517  vniltasgvirspknsntdlyllfnawcpd................................................
ENSTNIP00000017383  vatvpktgqidtvvrtllve..........................................................
ENSTNIP00000008384  vatvpktgqidtvvrtllve..........................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007897  ..............................................................................
ENSTNIP00000015072  ..............................................................................
ENSTNIP00000003494  ..............................................................................
ENSTNIP00000006950  kvkldfvapamgihnytlyfmsdaymgcdqeykfsvdvke......................................
ENSTNIP00000006734  ldgsssasrgvvplavtppadapvgeysltaafreescllgrltllfnpwcpd.........................
ENSTNIP00000009333  ggddipaspyrvrava..............................................................
ENSTNIP00000000464  pytitikyggdeipyspyriqs........................................................
ENSTNIP00000007616  iprspievkispe.................................................................
ENSTNIP00000003313  iprspievkispe.................................................................
ENSTNIP00000002488  iprspievkispe.................................................................
ENSTNIP00000003313  pthdaskvrasgpgln..............................................................
ENSTNIP00000002488  pthdaskvrasgpgln..............................................................
ENSTNIP00000007616  pthdaskvrasgpgln..............................................................
ENSTNIP00000014961  vsitsaptapvglyalsvklegqktklgefvllfnawc........................................
ENSTNIP00000008895  spfkiktlpa....................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  pvr...........................................................................
ENSTNIP00000005012  yspyriqslptgd.................................................................
ENSTNIP00000019109  yspyriqslptgd.................................................................
ENSTNIP00000005012  apv...........................................................................
ENSTNIP00000019109  apv...........................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000005012  ggea..........................................................................
ENSTNIP00000000464  ggea..........................................................................
ENSTNIP00000019109  ggea..........................................................................
ENSTNIP00000005012  gl............................................................................
ENSTNIP00000000464  gl............................................................................
ENSTNIP00000019109  gl............................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000009333  ptvegpyavavkyaeedvprspfrfrvlpth...............................................
ENSTNIP00000009333  svregcd.......................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000021564  ..............................................................................
ENSTNIP00000015432  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005012  gd............................................................................
ENSTNIP00000000464  gd............................................................................
ENSTNIP00000019109  gd............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000008895  q.............................................................................
ENSTNIP00000021437  hflytp........................................................................
ENSTNIP00000007616  gve...........................................................................
ENSTNIP00000002488  gve...........................................................................
ENSTNIP00000003313  gve...........................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000014295  ..............................................................................
ENSTNIP00000005012  frvsvvegc.....................................................................
ENSTNIP00000000464  frvsvvegc.....................................................................
ENSTNIP00000019109  frvsvvegc.....................................................................
ENSTNIP00000014296  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ftakitg.......................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  vdttgvkvygpgve................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  sde...........................................................................
ENSTNIP00000013288  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000009333  vgpa..........................................................................
ENSTNIP00000005012  vygpgve.......................................................................
ENSTNIP00000000464  vygpgve.......................................................................
ENSTNIP00000019109  vygpgve.......................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009872  asvgsygfqlcvftlgkirrcmmgqfvllcnpwcpe..........................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  pkspfhvvvgk...................................................................
ENSTNIP00000009333  vdpsh.........................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000018364  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  g.............................................................................
ENSTNIP00000003313  eacn..........................................................................
ENSTNIP00000002488  eacn..........................................................................
ENSTNIP00000007616  eacn..........................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000018732  v.............................................................................
ENSTNIP00000003313  spfqvtaleg....................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ghnip.........................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000014417  ..............................................................................
ENSTNIP00000008895  ipnspfhvvvekg.................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  tgp...........................................................................
ENSTNIP00000003313  spfevei.......................................................................
ENSTNIP00000002488  spfevei.......................................................................
ENSTNIP00000007616  spfevei.......................................................................
ENSTNIP00000005497  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  q.............................................................................
ENSTNIP00000009333  rvnvgkgs......................................................................
ENSTNIP00000006205  ..............................................................................
ENSTNIP00000009333  gfpakvmahpavdtsgvrafgpgld.....................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  kakvtgp.......................................................................
ENSTNIP00000009333  fevnvdk.......................................................................
ENSTNIP00000005012  gspfkakitg....................................................................
ENSTNIP00000000464  gspfkakitg....................................................................
ENSTNIP00000019109  gspfkakitg....................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000012114  g.............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000008895  vsk...........................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  n.............................................................................
ENSTNIP00000019406  gaeaattaaatakedeeeasdkgsesdegeankdspserdedsdkqsdtevdemagddeeewealqqsiqrreralle
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  devllpkspfrvlvtegcdp..........................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005680  kv............................................................................
ENSTNIP00000005012  pkspfhvvvgk...................................................................
ENSTNIP00000019109  pkspfhvvvgk...................................................................
ENSTNIP00000008895  ppeegayrvdisydgnpvpgspfav.....................................................
ENSTNIP00000000464  sydgnpvmgspfgvea..............................................................
ENSTNIP00000005012  sydgnpvmgspfgvea..............................................................
ENSTNIP00000019109  sydgnpvmgspfgvea..............................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000009333  glk...........................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000015515  ..............................................................................
ENSTNIP00000020196  ..............................................................................
ENSTNIP00000019366  slllyeqpvrgspfrlra............................................................
ENSTNIP00000019239  ..............................................................................
ENSTNIP00000009911  ..............................................................................
ENSTNIP00000018930  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005679  a.............................................................................
ENSTNIP00000002488  fsptaysasd....................................................................
ENSTNIP00000007616  fsptaysasd....................................................................
ENSTNIP00000003313  fsptaysasd....................................................................
ENSTNIP00000002618  ..............................................................................
ENSTNIP00000012827  ra............................................................................
ENSTNIP00000004899  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000003313  pnspisvmire...................................................................
ENSTNIP00000002488  pnspisvmire...................................................................
ENSTNIP00000006954  ..............................................................................
ENSTNIP00000007616  pnspisvmire...................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000006346  t.............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000005012  vvtaygpgl.....................................................................
ENSTNIP00000000464  vvtaygpgl.....................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000009333  gpgl..........................................................................
ENSTNIP00000010401  vqslmalnntnfiyypn.............................................................
ENSTNIP00000000963  vqslmalnntnfiyypn.............................................................
ENSTNIP00000008895  aygpglth......................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000003258  ..............................................................................
ENSTNIP00000011053  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019109  vtaygpgls.....................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000019061  tyrdp.........................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000012220  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006767  fifdqvssllvlnstpfthypn........................................................
ENSTNIP00000006766  fifdqvssllvlnstpfthypn........................................................
ENSTNIP00000021085  l.............................................................................
ENSTNIP00000013222  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  i.............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008003  p.............................................................................
ENSTNIP00000009803  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  fyyken........................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006346  vnktfsyypd....................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007472  slqvftyqdp....................................................................
ENSTNIP00000009146  slqvftyqdp....................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000002804  vtelgpanitaraiaysepsccsdefqa..................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000007744  tpert.........................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007714  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  efsyhp........................................................................
ENSTNIP00000019147  sghtvkvt......................................................................
ENSTNIP00000019148  sghtvkvt......................................................................
ENSTNIP00000018520  ..............................................................................
ENSTNIP00000020566  yykifqpg......................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000009105  vaespysl......................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000005417  ..............................................................................
ENSTNIP00000004483  rantdgtysanwtpgavglytihvtidgieid..............................................
ENSTNIP00000001542  rantdgtysanwtpgavglytihvtidgieid..............................................
ENSTNIP00000018046  rantdgtysanwtpgavglytihvtidgieid..............................................
ENSTNIP00000010138  v.............................................................................
ENSTNIP00000002265  evwnssfeyhsn..................................................................
ENSTNIP00000017783  evwnssfeyhsn..................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006857  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000006521  ..............................................................................
ENSTNIP00000019061  pdyvahekndtviqfrsptvnsslnqhvrtyiqldnwvkelkpfdy................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000016904  ..............................................................................
ENSTNIP00000022219  ..............................................................................
ENSTNIP00000002960  ..............................................................................
ENSTNIP00000010459  ..............................................................................
ENSTNIP00000008492  ..............................................................................
ENSTNIP00000011929  af............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................


                                                                                                    
                                                                                                    
d1cf1a2               ..............................................................................
ENSTNIP00000015820  ..............................................................................
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000014574  ..............................................................................
ENSTNIP00000014544  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000013758  ..............................................................................
ENSTNIP00000012673  ..............................................................................
ENSTNIP00000022103  ..............................................................................
ENSTNIP00000010457  ..............................................................................
ENSTNIP00000017993  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000007179  ..............................................................................
ENSTNIP00000019582  ..............................................................................
ENSTNIP00000009102  ..............................................................................
ENSTNIP00000017145  ..............................................................................
ENSTNIP00000009422  ..............................................................................
ENSTNIP00000009249  ..............................................................................
ENSTNIP00000005244  ..............................................................................
ENSTNIP00000005246  ..............................................................................
ENSTNIP00000014127  ..............................................................................
ENSTNIP00000006368  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000010899  ..............................................................................
ENSTNIP00000003800  ..............................................................................
ENSTNIP00000008976  ..............................................................................
ENSTNIP00000010244  ..............................................................................
ENSTNIP00000000824  ..............................................................................
ENSTNIP00000007048  ..............................................................................
ENSTNIP00000009940  ..............................................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000014413  ..............................................................................
ENSTNIP00000019221  ..............................................................................
ENSTNIP00000022950  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000006156  ..............................................................................
ENSTNIP00000004888  ..............................................................................
ENSTNIP00000014127  ..............................................................................
ENSTNIP00000020787  ..............................................................................
ENSTNIP00000002395  ..............................................................................
ENSTNIP00000013223  ..............................................................................
ENSTNIP00000005835  ..............................................................................
ENSTNIP00000009178  ..............................................................................
ENSTNIP00000010775  ..............................................................................
ENSTNIP00000005251  ..............................................................................
ENSTNIP00000005249  ..............................................................................
ENSTNIP00000005250  ..............................................................................
ENSTNIP00000016350  ..............................................................................
ENSTNIP00000015973  ..............................................................................
ENSTNIP00000010563  ..............................................................................
ENSTNIP00000021888  ..............................................................................
ENSTNIP00000021411  ..............................................................................
ENSTNIP00000020537  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000001789  ..............................................................................
ENSTNIP00000002977  ..............................................................................
ENSTNIP00000001513  ..............................................................................
ENSTNIP00000017397  ..............................................................................
ENSTNIP00000017377  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006628  ..............................................................................
ENSTNIP00000008517  ..............................................................................
ENSTNIP00000017383  ..............................................................................
ENSTNIP00000008384  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007897  ..............................................................................
ENSTNIP00000015072  ..............................................................................
ENSTNIP00000003494  ..............................................................................
ENSTNIP00000006950  ..............................................................................
ENSTNIP00000006734  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000014961  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000021564  ..............................................................................
ENSTNIP00000015432  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000021437  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000014295  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000014296  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013288  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009872  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000018364  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000018732  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000014417  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000005497  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000006205  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000012114  ..............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019406  tkskvthpayslyfpeekqewwwlyiadrrdqslvsmphhvctlkdteevelkfpapsktgnyqysvilrsdsylgld
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005680  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000015515  ..............................................................................
ENSTNIP00000020196  ..............................................................................
ENSTNIP00000019366  ..............................................................................
ENSTNIP00000019239  ..............................................................................
ENSTNIP00000009911  ..............................................................................
ENSTNIP00000018930  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005679  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002618  ..............................................................................
ENSTNIP00000012827  ..............................................................................
ENSTNIP00000004899  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006954  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000003258  ..............................................................................
ENSTNIP00000011053  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000012220  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000013222  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000009803  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007472  ..............................................................................
ENSTNIP00000009146  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000002804  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000007744  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007714  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000018520  ..............................................................................
ENSTNIP00000020566  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000009105  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000005417  ..............................................................................
ENSTNIP00000004483  ..............................................................................
ENSTNIP00000001542  ..............................................................................
ENSTNIP00000018046  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006857  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000006521  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000016904  ..............................................................................
ENSTNIP00000022219  ..............................................................................
ENSTNIP00000002960  ..............................................................................
ENSTNIP00000010459  ..............................................................................
ENSTNIP00000008492  ..............................................................................
ENSTNIP00000011929  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................


                                 
                                 
d1cf1a2               ...........
ENSTNIP00000015820  ...........
ENSTNIP00000014157  ...........
ENSTNIP00000001954  ...........
ENSTNIP00000014574  ...........
ENSTNIP00000014544  ...........
ENSTNIP00000010486  ...........
ENSTNIP00000013758  ...........
ENSTNIP00000012673  ...........
ENSTNIP00000022103  ...........
ENSTNIP00000010457  ...........
ENSTNIP00000017993  ...........
ENSTNIP00000006675  ...........
ENSTNIP00000002599  ...........
ENSTNIP00000007179  ...........
ENSTNIP00000019582  ...........
ENSTNIP00000009102  ...........
ENSTNIP00000017145  ...........
ENSTNIP00000009422  ...........
ENSTNIP00000009249  ...........
ENSTNIP00000005244  ...........
ENSTNIP00000005246  ...........
ENSTNIP00000014127  ...........
ENSTNIP00000006368  ...........
ENSTNIP00000009083  ...........
ENSTNIP00000002561  ...........
ENSTNIP00000001954  ...........
ENSTNIP00000019946  ...........
ENSTNIP00000014157  ...........
ENSTNIP00000010486  ...........
ENSTNIP00000010899  ...........
ENSTNIP00000003800  ...........
ENSTNIP00000008976  ...........
ENSTNIP00000010244  ...........
ENSTNIP00000000824  ...........
ENSTNIP00000007048  ...........
ENSTNIP00000009940  ...........
ENSTNIP00000019946  ...........
ENSTNIP00000005358  ...........
ENSTNIP00000014413  ...........
ENSTNIP00000019221  ...........
ENSTNIP00000022950  ...........
ENSTNIP00000005358  ...........
ENSTNIP00000002561  ...........
ENSTNIP00000009083  ...........
ENSTNIP00000006156  ...........
ENSTNIP00000004888  ...........
ENSTNIP00000014127  ...........
ENSTNIP00000020787  ...........
ENSTNIP00000002395  ...........
ENSTNIP00000013223  ...........
ENSTNIP00000005835  ...........
ENSTNIP00000009178  ...........
ENSTNIP00000010775  ...........
ENSTNIP00000005251  ...........
ENSTNIP00000005249  ...........
ENSTNIP00000005250  ...........
ENSTNIP00000016350  ...........
ENSTNIP00000015973  ...........
ENSTNIP00000010563  ...........
ENSTNIP00000021888  ...........
ENSTNIP00000021411  ...........
ENSTNIP00000020537  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000001789  ...........
ENSTNIP00000002977  ...........
ENSTNIP00000001513  ...........
ENSTNIP00000017397  ...........
ENSTNIP00000017377  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000006628  ...........
ENSTNIP00000008517  ...........
ENSTNIP00000017383  ...........
ENSTNIP00000008384  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000007897  ...........
ENSTNIP00000015072  ...........
ENSTNIP00000003494  ...........
ENSTNIP00000006950  ...........
ENSTNIP00000006734  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000014961  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000012789  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000013084  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000016574  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000021564  ...........
ENSTNIP00000015432  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000006675  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000021437  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000014295  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000014296  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000002599  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000013288  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000006011  ...........
ENSTNIP00000013084  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000009872  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000016574  ...........
ENSTNIP00000018364  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000018732  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000001925  ...........
ENSTNIP00000001568  ...........
ENSTNIP00000014417  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000005497  ...........
ENSTNIP00000012789  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000006205  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000001133  ...........
ENSTNIP00000012114  ...........
ENSTNIP00000002873  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000019406  qikplklevhe
ENSTNIP00000000464  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000002873  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000001133  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000005680  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000015515  ...........
ENSTNIP00000020196  ...........
ENSTNIP00000019366  ...........
ENSTNIP00000019239  ...........
ENSTNIP00000009911  ...........
ENSTNIP00000018930  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000005679  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002618  ...........
ENSTNIP00000012827  ...........
ENSTNIP00000004899  ...........
ENSTNIP00000007675  ...........
ENSTNIP00000001568  ...........
ENSTNIP00000018500  ...........
ENSTNIP00000004388  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000003898  ...........
ENSTNIP00000000963  ...........
ENSTNIP00000010401  ...........
ENSTNIP00000006011  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000006954  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000007675  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000006346  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000003898  ...........
ENSTNIP00000005012  ...........
ENSTNIP00000000464  ...........
ENSTNIP00000003313  ...........
ENSTNIP00000002488  ...........
ENSTNIP00000007616  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000018500  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000010401  ...........
ENSTNIP00000000963  ...........
ENSTNIP00000008895  ...........
ENSTNIP00000009333  ...........
ENSTNIP00000001925  ...........
ENSTNIP00000019147  ...........
ENSTNIP00000019148  ...........
ENSTNIP00000003258  ...........
ENSTNIP00000011053  ...........
ENSTNIP00000007602  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000019109  ...........
ENSTNIP00000006767  ...........
ENSTNIP00000006766  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000019061  ...........
ENSTNIP00000007602  ...........
ENSTNIP00000012220  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000010401  ...........
ENSTNIP00000000963  ...........
ENSTNIP00000002265  ...........
ENSTNIP00000017783  ...........
ENSTNIP00000006767  ...........
ENSTNIP00000006766  ...........
ENSTNIP00000021085  ...........
ENSTNIP00000013222  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000006767  ...........
ENSTNIP00000006766  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000008003  ...........
ENSTNIP00000009803  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000010138  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000006346  ...........
ENSTNIP00000021085  ...........
ENSTNIP00000002265  ...........
ENSTNIP00000017783  ...........
ENSTNIP00000008003  ...........
ENSTNIP00000021085  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000019061  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000007472  ...........
ENSTNIP00000009146  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000002804  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000007744  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000007714  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000008163  ...........
ENSTNIP00000010138  ...........
ENSTNIP00000019147  ...........
ENSTNIP00000019148  ...........
ENSTNIP00000018520  ...........
ENSTNIP00000020566  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000009105  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000005417  ...........
ENSTNIP00000004483  ...........
ENSTNIP00000001542  ...........
ENSTNIP00000018046  ...........
ENSTNIP00000010138  ...........
ENSTNIP00000002265  ...........
ENSTNIP00000017783  ...........
ENSTNIP00000006346  ...........
ENSTNIP00000008162  ...........
ENSTNIP00000006857  ...........
ENSTNIP00000019147  ...........
ENSTNIP00000019148  ...........
ENSTNIP00000006521  ...........
ENSTNIP00000019061  ...........
ENSTNIP00000004388  ...........
ENSTNIP00000016904  ...........
ENSTNIP00000022219  ...........
ENSTNIP00000002960  ...........
ENSTNIP00000010459  ...........
ENSTNIP00000008492  ...........
ENSTNIP00000011929  ...........
ENSTNIP00000010401  ...........
ENSTNIP00000000963  ...........


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046127 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Atopobium parvulum DSM 20469
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228