SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

E set domains alignments in Tetraodon nigroviridis 76_8

These alignments are sequences aligned to the 0046920 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1g4ma2               e.............................................................................
ENSTNIP00000015820  gciidcfmigaimakmarpkkraqtllfshnaviamrdgklclmwrvgnlrkshiveahvraqlikpritdegeyipl
ENSTNIP00000014157  frvfkkaspngkltvylgkrdfvdrvdqvesvdgvvlidpeylkerkvfvtltcafrygredldvlgltfr.......
ENSTNIP00000001954  hqvfkkaspngkltvylgkrdfvdrvdqvesvdgvvlidpeylkerkvfvtltcafrygredldvlgltfr.......
ENSTNIP00000014574  gciidafmigaimakmarpkkraetllfshnavialhdgklcfmfrvanlrkshiveahvraqllkpryteegeyipl
ENSTNIP00000014544  tpeqlaamaaeikedecqvnykppaqkslqeiqeldkddeslrkyketllgnvstltdpklpnvqvtkmtlvcdtapg
ENSTNIP00000010486  trvfkksspnckvtvylgkdfvdhldhvdpvdgvilvdpeylkdrkvfvtltcafrygredldvlglsfrkdlyistf
ENSTNIP00000013758  gciidsfmigtimakmarpkkrnntlmfsknavialrdgklclmwrvgnlrrshiveahvraqlirsyvtaegefipl
ENSTNIP00000012673  gciidafiigavmakmakpkkrnetlvfsyyatvamrdsklclmwrvgnlrkshlveahvraqllksrttaegeyipl
ENSTNIP00000022103  gsivdafligcmfikmsqpkkraetlmfsqdavisqrdgklclmfrvgnlrnshmvsaqirckliksrqtpegeflpl
ENSTNIP00000010457  gsivnafmvgcmfvkisqpkkraetlvfstnavismrdgrlclmfrvgdlrnshiveasiraklikskqtkegefipl
ENSTNIP00000017993  gsivdafligcmfikmsqpkkraetlmfsqdavisqrdgklclmfrvgnlrnshmvsaqirckliksrqtpegeflpl
ENSTNIP00000006675  trvfkktspnskltvylgrrdfvdhvscvdpvdgivlvepeylkdrkvfvtlncafrygqedldvlglsfrkdlfakt
ENSTNIP00000002599  trvfkktspnskltvylgrrdfvdhvscvdpvdgivlvepeylkdrkvfvtlncafrygqedldvlglsfrkdlfakt
ENSTNIP00000007179  gcivdsfmigtimakmvrpkkraqtllfshhavialrdgklclmwrlgnmrkshivehvraqlikphvtaegeylple
ENSTNIP00000019582  gsivdafligcmfikmsqpkkraetlmfsehaaismrdgkltlmfrvgnlrnshmvsaqirckllksrqtpegeflpl
ENSTNIP00000009102  gsmvnafmvgcmfvkisqpnkraetlvfskhavislrddklclmfrvgdlrsshivganmraklikskqtqegefipl
ENSTNIP00000017145  qlaaiaaeneepepvnykppaqksvkeiqdldkddeslckyketllgpgvtsvdpaapnvqvtrmallcessprplil
ENSTNIP00000009422  glvinaimlgcifmktaqanrraetlifskhavisvrnnrlcfmirlgdlrksmiisatvrmqvvrrttteegellpl
ENSTNIP00000009249  gliinavmlgcifmktaqsnrraetlifsrhaviavrnnrlcfmvrigdlrksmiigatvrlqvvrktttpegevipi
ENSTNIP00000005244  gliinavmlgcvfmktaqanrraetlifsrnaviaprngrptfmfrvgdlrksmiisatiqlqvirrtvtaegevipv
ENSTNIP00000005246  gliinavmlgcvfmktaqanrraetlifsrnaviaprngrptfmfrvgdlrksmiisatiqlqvirrtvtaegevipv
ENSTNIP00000014127  mkvfkkvsrdqsltvymdkrdfvdrcdsvqpvdgvivvdpqqlrgrkvyvmlsctfkygrqdmdvmgvafrrdlfvvt
ENSTNIP00000006368  gvfincfmcgvilakislpkkraktvtfsdqaviclkegslcllirvanlrktlligsqiygkllrttstadgetiil
ENSTNIP00000009083  kvfkktsgnggltlylgkrdyvdnvnvvdkvegvvkldpkdfgdrkvfvqlacafrygsedldvmglcfrkdiwfeci
ENSTNIP00000002561  kvfkktsgnggltlylgkrdyvdnvnvvdkvegvvkldpkdfgdrkvfvqlacafrygsedldvmglcfrkdiwfeci
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000019946  rvfkktngngnitlylgkrdfvdhvdsvevvegavkvdpsglngrkvyvylacafrygsedldvmglsfrrdiwiqrv
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000010899  gciidafiigavmakiakpkkrnetlvfsdtavvalrdgklcmmwrvgnmrkshlveahvraqllkprvteegeflpl
ENSTNIP00000003800  eifvtgaflaklarpkkrsetikfsqvavicrrqgklclmvrvanmrkslliqcqltgkllhpsvtqegektlvhqsp
ENSTNIP00000008976  lmeifitgtflakvarpkkrgetvkfsqhavvtthegqpclmirvanmrkslligcqvtgkllqtsltkesetvwl..
ENSTNIP00000010244  vmeifitgtflakvarpkkrgetvkfsqhavvsdheglpclmirvanmrkslllgcqvtgkllqtsmtkegetvrldq
ENSTNIP00000000824  clldtiiigiiiakmasarkravtvgfsrcavinlrngclclawrlgdlrgnhilegvvkatvvryvrkpqgaivmsy
ENSTNIP00000007048  kpedniynidfirfkirdletstilfeiakpphaeeeeenrdadtsagrfvryqftpaflklrtvgatv.........
ENSTNIP00000009940  edrakeilkgfklnwmnlrdaesgkvlwqgtedlsvpgvehearvpkkilkckavsrelnfssseklekfrleqkvff
ENSTNIP00000019946  g.............................................................................
ENSTNIP00000005358  a.............................................................................
ENSTNIP00000014413  kaednvynvdftrfkirdletgtvlfeiakppgsapvdseedgldvdasagrfvryqftpaflklctvgatveftvgd
ENSTNIP00000019221  spdenifsidftrfkirdmetgtvlfeitkppttdktgdkrdidpnagrfvryqftpaflrlrqv.............
ENSTNIP00000022950  saspednvhmidftrfkirdmetgtvlfeitkpptpagdkkqsdpnagrfvryqftpflqlrqvg.............
ENSTNIP00000005358  nvvfkkiskdksvgvylgkrdfvdrvdcvdpvdgviiidpealqgrkvfvtlsctfryrddmdvmgvafrrelylstt
ENSTNIP00000002561  ga............................................................................
ENSTNIP00000009083  ga............................................................................
ENSTNIP00000006156  taelkicrvnrnsgsckggdeifllcdkvqkedievrffqdsweak................................
ENSTNIP00000004888  gklclmvrvanmrkslliqcqltgkllhpsvtqegektlvhqspvdfymdssgd........................
ENSTNIP00000014127  ttf...........................................................................
ENSTNIP00000020787  vrsvdlmksregqnrskhhthlyqtdafiirrgqnfqmwlglsrpfdpkedklhlilktgplptvskgtqvnvplvkn
ENSTNIP00000002395  gaiincfmcgvilskislpmrktlmgsqiygkllrttntpdgetiimdqvniefmvda....................
ENSTNIP00000013223  gaiincfmcgvilskislptqnpddgsqiygkllrttntpdgetiimdqvniefmvda....................
ENSTNIP00000005835  rgrtafavassnsdstevpefepfiapgprgfppmtefldilevdmvskfeeinkqehrtefydsnflivrrgqe...
ENSTNIP00000009178  glmleafitgafvakiarpqmragairfspyavvgqhqsqkclmlratnllqhpivdvkvsavlyeeyegevlhqtsv
ENSTNIP00000010775  lsvcsvdllssktgrn..............................................................
ENSTNIP00000005251  snlkivrmdrtagcvsggeevyllcdkvqkddiqvrfyeeddsgltwealgd..........................
ENSTNIP00000005249  snlkivrmdrtagcvsggeevyllcdkvqkddiqvrfyeeddsgltwealgd..........................
ENSTNIP00000005250  snlkivrmdrtagcvsggeevyllcdkvqkddiqvrfyeeddsgltwealgd..........................
ENSTNIP00000016350  snlkisrmdktcgtvlggdeifllcdkvqkddieirfyeedeggwe................................
ENSTNIP00000015973  dkaeytfyegmgpvhapvtpvpvveslqlngggdvamleltgqnftpnlrvwfgdveaetmyrcaesmlcvvpdisaf
ENSTNIP00000010563  tsqlkisclnqyrgscagktevymlcdkvqkddieiifrkgswkangefaq...........................
ENSTNIP00000021888  aldidhfdleceynnvehrtdlngidrlivrrgqafsirlylrsgsyqpgvsaldciaetgpqpseqygtr.......
ENSTNIP00000021411  elpvqsaitspadgaavegssqevtvrgyawsgggrevvrvdvsldggktwqvarleggqdq................
ENSTNIP00000020537  svifadcgstsgkvamvdivp.........................................................
ENSTNIP00000005012  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftvetrgagtgglgltiegaseakisckdnkdgs
ENSTNIP00000019109  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftvetrgagtgglgltiegaseakisckdnkdgs
ENSTNIP00000000464  evlyddvpvpkspfrvsvvegcdpsrvrafgpgleggitnkpncftvetrgagtgglgltiegaseakisckdnkdgs
ENSTNIP00000007616  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgagtgglglamegpseakmscidnkdgs
ENSTNIP00000003313  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgagtgglglamegpseakmscidnkdgs
ENSTNIP00000002488  evcydgmpvpkspfhvavtegcnpgrvrvhgpglkggttnkpnkftietrgagtgglglamegpseakmscidnkdgs
ENSTNIP00000003313  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpveftidakdagegllavqitdpegkpkkani...
ENSTNIP00000001789  itvfqpfflelslpysivrgeqfelka...................................................
ENSTNIP00000002977  itvfqpfflelslpysivrgeqfelka...................................................
ENSTNIP00000001513  itvfqpfflelslpysivrgeqfelka...................................................
ENSTNIP00000017397  itvfqpfflelslpysivrgeqfelka...................................................
ENSTNIP00000017377  ltvfqpffleltlpysiirgeqfelkatvfsylskcimltvtgeesadyklvp.........................
ENSTNIP00000007616  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpveftidakdagegllavqitdpegkpkkani...
ENSTNIP00000008895  evlfdevllpkspfrvlvtegcdpsrvraygpgleeglvnatncftvetrgagtgglglaiegpseakmsckdnk...
ENSTNIP00000002488  nvlyddeeiprspykvkvlpthdaskvrasgpglnttgvpaslpveftidakdagegllavqitdpegkpkkan....
ENSTNIP00000006628  vsvdlrcrennrahrtweidrerlivrrgqpfsvtlqghrpltpqhyldlvlhlavpsgpgkrdelvvkvqegpapgg
ENSTNIP00000008517  sinkpahmttdyhtellvvrrgfemffkvtfsqplteaddfqmefligkspsstkgsmvtvafnsqsgvwpgqive..
ENSTNIP00000017383  ltafqpffvsltlpysvvrgevfplratvfnylsdcimvqltlaesdqyafr..........................
ENSTNIP00000008384  ltafqpffvsltlpysvvrgevfplratvfnylsdcimvqltlaesdqyafr..........................
ENSTNIP00000009333  vlyddtpvpkspfqvsvregcdptrvvaagpglqkalsqkpnnfniitrgagiggvgitvegpseskmsckdnkdgsc
ENSTNIP00000007897  aveftfnrglaaapapvtpfpviaglevnggghvamlelhgenfsphlkvwfgntetd....................
ENSTNIP00000015072  glpeilkkslhscsvrggeevfiigknflkgtkvifqeniaddnswqgeakidmdyfhqnhlivtvppfhnqs.....
ENSTNIP00000003494  glpeilkkslhscsvrggeevfiigknflkgtkvifqeniaddnswqgeakidmdyfhqnhlivtvppfhnqs.....
ENSTNIP00000006950  nielsyevadrdsiksgspvlvqvqlereeev..............................................
ENSTNIP00000006734  dvsicravklhcdsnnlehhtsqasqdrllvrrgqafrltlelsq.................................
ENSTNIP00000009333  vkyaeedvprspfrfrvlpthdaskvrasgpgltsgvpasfpvefnidtkdagqgqlsvlitdq..............
ENSTNIP00000000464  vkyaeqevphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpegkpknatiq...
ENSTNIP00000007616  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsikgpkgleepckrkd.
ENSTNIP00000003313  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsikgpkgleepckrkd.
ENSTNIP00000002488  svtfaggqisrspftvsvgeacnpnlcrakgrglqpkglrvketadfkvytkgagtgelkvsikgpkgleepckrkd.
ENSTNIP00000003313  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvvepvevvdngdq...................
ENSTNIP00000002488  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvvepvevvdngdq...................
ENSTNIP00000007616  vdstkvkcqgpglgnnvranipqaftvdaskagvaplqvrvqgpkgvvepvevvdngdq...................
ENSTNIP00000014961  mercdlnikt....................................................................
ENSTNIP00000008895  nitfgglpipgspfsvpvrelvdpskvrcfgpgleigvrahvpqtftvdsskaglaplvvqlygptgvae........
ENSTNIP00000012789  pqagt.........................................................................
ENSTNIP00000008895  spfkiktlpahdaskvrasgpglnasgitaslpveftidardageglltvqildpegkpkranirdnwngtytvsy..
ENSTNIP00000000464  padpskvrafgpglqggivgkpapftidtkgagagglgltvegpceakiecqdngdg.....................
ENSTNIP00000005012  evphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpegkpknatiqdnrdg....
ENSTNIP00000019109  evphspfkvmsqpghdaskvrasgpgldtkgvsaslpveftidardageglltvqildpegkpknatiqdnrdg....
ENSTNIP00000005012  padpskvrafgpglqggivgkpapftidtkgagagglgltvegpceakiecqdngd......................
ENSTNIP00000019109  padpskvrafgpglqggivgkpapftidtkgagagglgltvegpceakiecqdngd......................
ENSTNIP00000009333  ppdpskvkasgpglkgglvgspaeftidtkgagtgglgltvegpteakiecsdngdg.....................
ENSTNIP00000013084  pqagtkdkla....................................................................
ENSTNIP00000005012  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvkgptgaeeqvkv.............
ENSTNIP00000000464  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvkgptgaeeqvkv.............
ENSTNIP00000019109  kspytvniaeavnpnacratgrglqpkgvrvkevadfkvftkgagsgelkvsvkgptgaeeqvkv.............
ENSTNIP00000005012  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvgvknngdgtht...............
ENSTNIP00000000464  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvgvknngdgtht...............
ENSTNIP00000019109  pvdpskvkcsgpglgtgvrahvpqtftvdctkagqapldvklygptgtaepvgvknngdgtht...............
ENSTNIP00000016574  pqt...........................................................................
ENSTNIP00000009333  gspfrvpvtdvvdpskvkvtgpgvgsgvrakvpqtftvdc......................................
ENSTNIP00000009333  gfpakvmahpavdtsgvrafgpgldgqavfreattdftvdarsltqnggahvkaevrnpsgaltdcsvtdnadg....
ENSTNIP00000009333  siswggtqipkspfevavgeeagpqqirawgpgleggvvgraaifvvesvaaevgvlgfaiegpsqakiecedqddgs
ENSTNIP00000021564  lpmvekqdmdhcsvlggqqmiltgqnfssdskvvfmeksqegqhtwemeasvdkdksqpnmlfve.............
ENSTNIP00000015432  lpmvekqdmdhcsvlggqqmiltgqnfssdskvvfmeksqegqhtwemeasvdkdksqpnmlfve.............
ENSTNIP00000007616  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhiktlisnpsgsctda............
ENSTNIP00000003313  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhiktlisnpsgsctda............
ENSTNIP00000002488  nfparlnvepavdasgvrvfgpgveskgvfreattdftvdaralapnggdhiktlisnpsgsctda............
ENSTNIP00000005012  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskaeitckd.......................
ENSTNIP00000000464  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskaeitckd.......................
ENSTNIP00000019109  vdavntgvvtaygpglsygtvnkaatftvvtknagegglslavegpskaeitckd.......................
ENSTNIP00000003313  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadiscvdnqdgtc..................
ENSTNIP00000002488  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadiscvdnqdgtc..................
ENSTNIP00000007616  dyinsgnvsaygpglihgtvnkpavftvdtkdagegglslaiegpskadiscvdnqdgtc..................
ENSTNIP00000007616  spyriralptgdaskctvtgagigptiqigeqtvitvdakaagkgkvtcsvctpegaeldvd................
ENSTNIP00000002488  spyriralptgdaskctvtgagigptiqigeqtvitvdakaagkgkvtcsvctpegaeldvd................
ENSTNIP00000003313  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkveaakdvevinnhd
ENSTNIP00000002488  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkveaakdvevinnhd
ENSTNIP00000007616  adqaipmtpirikvdpahdaskvkaegpglsrtgvelnkpthftvstkgagkanldctfsgptkveaakdvevinnhd
ENSTNIP00000006675  qp............................................................................
ENSTNIP00000008895  pdalkvraygpglqgglvgkpapfaidtkgagtgglgltvegpceakiecq...........................
ENSTNIP00000021437  lpsverqdldrcsvlggqqmvltglnftadskvifsektqdgkqiweveatvdrd.......................
ENSTNIP00000007616  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgteaevhiqdngd.........................
ENSTNIP00000002488  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgteaevhiqdngd.........................
ENSTNIP00000003313  qvrcsgpglerarvgekgeffvdctnagpadltieiisdsgteaevhiqdngd.........................
ENSTNIP00000008895  rhspfevhvgeeagpqkvrawgpgletgmvgksadfvveaigtevgtlgfsiegpsqakiecddkgd...........
ENSTNIP00000014295  lpqvdkssltsclvsggeemvisgsnffpeskviflekgpdgrpqweveakiireksqgsc.................
ENSTNIP00000005012  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkaggnh............................
ENSTNIP00000000464  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkaggnh............................
ENSTNIP00000019109  fpkvlqvdpsvdtsgvhvygpgveprgvlrdvtthfivdaralkkaggnh............................
ENSTNIP00000014296  lpqvdkssltsclvsggeemvisgsnffpeskviflekgpdgrpqweveakiireksqgsc.................
ENSTNIP00000003313  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqd...................................
ENSTNIP00000002488  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqd...................................
ENSTNIP00000007616  ypdkvkafgpglqssglavgkpteftvdakhggkaplkivaqd...................................
ENSTNIP00000008895  gdaskvkvfgqglieghtfevaefivdtrnagygglglsiegpskvdincddvedgtck...................
ENSTNIP00000002599  qp............................................................................
ENSTNIP00000005012  piprspfevevggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddgs.......
ENSTNIP00000008895  vdainsghvtaygpglthgtvntpatftivtkdtgegglslaveg.................................
ENSTNIP00000019109  piprspfevevggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddgs.......
ENSTNIP00000008895  fdpsmvtvsgpglergkvnedgsftvdcskagdaeltieivsesgakaevhvqnnrdgt...................
ENSTNIP00000005012  itwgevnvpnspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcseagqalgdisigikcapgvvgpgeadi
ENSTNIP00000008895  vlfadqqipispfrikvepshdaakvraegpglnktgvevnkpthftvytkg..........................
ENSTNIP00000019109  itwgevnvpnspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcseagqalgdisigikcapgvvgpgeadi
ENSTNIP00000009333  spyrvravatgdaskctvtgpgldptvaigeelgmvvntkgagkgkvtclvvqpdgseveaqvlenedg.........
ENSTNIP00000013288  ptvfrwtgeckevylsgsfnnwankiplirsqntfv..........................................
ENSTNIP00000005012  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieiadkgdgt...................
ENSTNIP00000000464  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieiadkgdgt...................
ENSTNIP00000019109  pekvkaygpglkptgvivnkpteftidarlagkghltiyaqdaegctinieiadkgdgt...................
ENSTNIP00000009333  lgeggaskvraggqglkgalagepaefsiwtreagagglaiavegpsraeisfddhkdgscgvsyva...........
ENSTNIP00000009333  kspfsvdvgpacvpgacralgrglqstgmrvnqdgdfrvdtrnagsgdlrvlikgpsgveepvkqisskdgvfyyey.
ENSTNIP00000000464  nspfrvlvgegshpdkvkvygpgvektglkaneptyftvdcseagqalgdisigikcapgvvgpgeadidfdiiknd.
ENSTNIP00000005012  geasrvkafgkglveahtsemaeffvdtrnagygglalsiegpskvdincedmedrtc....................
ENSTNIP00000000464  geasrvkafgkglveahtsemaeffvdtrnagygglalsiegpskvdincedmedrtc....................
ENSTNIP00000005012  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakpevhfaasrpgeavrdfeiidnhdys.....
ENSTNIP00000000464  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakpevhfaasrpgeavrdfeiidnhdys.....
ENSTNIP00000019109  geasrvkafgkglveahtsemaeffvdtrnagygglalsiegpskvdincedmedrtc....................
ENSTNIP00000019109  spfkvkvdpshdagkvraegpglnktgvevgtpthftiytkgagkakpevhfaasrpgeavrdfeiidnhdys.....
ENSTNIP00000008895  nspfrvmvgegshpenvkvygpgverlglkaneptyftvdcseagqgdvsigikcapgvvgpaeadidfdiik.....
ENSTNIP00000003313  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedrkdgssgvsyivqepgdye.......
ENSTNIP00000002488  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedrkdgssgvsyivqepgdye.......
ENSTNIP00000007616  ggahkvraggpgleraeagvpaefsiwtreagagglsiavegpskaeiafedrkdgssgvsyivqepgdye.......
ENSTNIP00000006011  kl............................................................................
ENSTNIP00000013084  klkk..........................................................................
ENSTNIP00000009333  gdaskvtvkgpgvepvgnvankptyfdictagagtgdvtavirdpqgrqnsvev........................
ENSTNIP00000005012  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifsvtyip............
ENSTNIP00000000464  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifsvtyip............
ENSTNIP00000019109  ldpskvtasgpglerakagepatftvdctragdaeltieivsetgakaevhiqktaqgifsvtyip............
ENSTNIP00000008895  penvkcsgpgleplgciinkpaeftmdtrgagrgelklyaqdaegfpiniqmtenenrtffc................
ENSTNIP00000009333  vqsevgnasqvraygdgleqgttfnnssfivdtqdagygglalsvegpskvdiqtedmedrick..............
ENSTNIP00000009872  aelniqhasletsenlqrhktegfssskalvvrrgapfrvslqlegrpfnpkcdslrvklslgtqtp...........
ENSTNIP00000000464  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakvkpnk......................
ENSTNIP00000005012  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakvkpnk......................
ENSTNIP00000019109  pnkvkaygpgiephgnkvlqpavftvdtleagsgevlvyvedpeghteeakvkpnk......................
ENSTNIP00000000464  ipyspyriqslptgdaskclltaanlqklqtsedtvitvdakaagkgkvtckvqtpq.....................
ENSTNIP00000009333  ltwggvsipkspfrvnvgkgshphmvkvfgpgvetsglkanepthftvdcsgagdggdvsvgikcdanmvgdreadvd
ENSTNIP00000016574  nnlp..........................................................................
ENSTNIP00000018364  arptvirwagagk.................................................................
ENSTNIP00000000464  kspytvnvakamgdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvel.............
ENSTNIP00000009333  psmtahgpglsygvanrtatftvftedaseggldlaiegpskaeincvdhkdgtcs......................
ENSTNIP00000003313  dsskataqgpglepsgniankttyfdvytagagvgeveviimdpsgknstvkcni.......................
ENSTNIP00000002488  dsskataqgpglepsgniankttyfdvytagagvgeveviimdpsgknstvkcni.......................
ENSTNIP00000007616  dsskataqgpglepsgniankttyfdvytagagvgeveviimdpsgknstvkcni.......................
ENSTNIP00000019109  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisfedrkdgscgvs.................
ENSTNIP00000005012  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisfedrkdgscgvs.................
ENSTNIP00000000464  ggahkvraggpglergvaaapsefsiwtreagagglsiavegpskaeisfedrkdgscgvs.................
ENSTNIP00000003313  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdintedqedgtc..................
ENSTNIP00000002488  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdintedqedgtc..................
ENSTNIP00000007616  eigdasrvrvsgqglseartfepaefiidtrdagygglslsiegpskvdintedqedgtc..................
ENSTNIP00000018732  tvdvskctiegedlrrcregepahflvvcrdsagepmtrggdhvmvsvvhkgkencka....................
ENSTNIP00000003313  spyriralptgdaskctvtvsigghglgagigptiqigeqtvitvdakaagkgkvtcsvctpeg..............
ENSTNIP00000008895  ggahkvraggtgldrgvagvpgefsiwtreagagglsiavegpskaeitfedrkdgscgvsyvv..............
ENSTNIP00000009333  vlftdkevpqspfqvtvdpshdaskvkaegpglartgvesgkpthftvltkgagkaavdvsfsspvkdfdiidnydys
ENSTNIP00000003313  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgs...........
ENSTNIP00000002488  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgs...........
ENSTNIP00000007616  spievkispeagqqkvrawgpgleggvvgksadfvveavgddvgtlgfsvegpsqakiecddkgdgs...........
ENSTNIP00000008895  hvtfagqqiprspfaahiseacnpnacrasgrglqpkgvrvkevadfkvyakgsgsgelkvvvkgprgavepvk....
ENSTNIP00000001925  p.............................................................................
ENSTNIP00000001568  p.............................................................................
ENSTNIP00000014417  rptvfrwsgpakevfvsg............................................................
ENSTNIP00000008895  spycihaiptgdaskclvtvsigghgpgsgigptiqigeetvitvdakaagkgkvtckvttp................
ENSTNIP00000000464  vggeagvqkvrawgpglktgmvgksadfvveaigvdvgtlgfsiegpsqakiecddkddgscdv..............
ENSTNIP00000009333  gdpglvsvygtglergttgaqsefiinntkagpgaltvtiegpskvkmecqevpegyk....................
ENSTNIP00000003313  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghreea..........................
ENSTNIP00000002488  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghreea..........................
ENSTNIP00000007616  lnpkkaraygpgvepvgnvvmkktvftvetisagmgevlvyvedpaghreea..........................
ENSTNIP00000005497  emcpasggermlveghnfqldskvvfvekaqdghhlweteakvvqeaskstsllveippyrnq...............
ENSTNIP00000012789  v.............................................................................
ENSTNIP00000008895  dasqvllrgaglskafisqknsftvdcsqagtnmlmvgvhgperpceevyvkhmgnrmy...................
ENSTNIP00000005012  gdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelile......................
ENSTNIP00000019109  gdpskvhargpgldpvgnvankptyfdiytagagngdisvviidpgkkdtvelile......................
ENSTNIP00000009333  rlavtglqesglkvnhpasfavhlngaqgkmaakvhspsgaleecvvt..............................
ENSTNIP00000009333  pdrvqafgpgveksgclvdqraeftvsakdagrgplkitaqdaeglpvevk...........................
ENSTNIP00000006205  elpviesisltscsveggeelllsgsnflpisrvlftergtdgkfqweeeahvdrdnsnecllcvrvptysdlsitr.
ENSTNIP00000009333  pfdpskvvasgaglkrakvgepsv......................................................
ENSTNIP00000007616  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkmdcvecpegyrv...................
ENSTNIP00000002488  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkmdcvecpegyrv...................
ENSTNIP00000003313  gdpgmvsaygagleggstgsaceflvntskagpgalavtidgpskvkmdcvecpegyrv...................
ENSTNIP00000008895  gdpglvsafgsglergttglasdfmvntcnagsgalsvtidgpskvkmdfqecpegy.....................
ENSTNIP00000009333  lnpkkaraygpgieptgnrvmrpavftvdtfsagqgqvtvyldhpdgsreeaqlkaep....................
ENSTNIP00000005012  gdpgmvtahgaglqggitgapsefvvktcnagsgtlsvnidgpskvkldc............................
ENSTNIP00000000464  gdpgmvtahgaglqggitgapsefvvktcnagsgtlsvnidgpskvkldc............................
ENSTNIP00000019109  gdpgmvtahgaglqggitgapsefvvktcnagsgtlsvnidgpskvkldc............................
ENSTNIP00000003313  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecci...............................
ENSTNIP00000002488  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecci...............................
ENSTNIP00000007616  rltvaslqesglkvnqpasfavslngakgmidakvhspsgaleecci...............................
ENSTNIP00000001133  tf............................................................................
ENSTNIP00000012114  eglkgalrgkpasftvtgydhdgeprlsggdtvsavimsvpdgnlssa..............................
ENSTNIP00000002873  tf............................................................................
ENSTNIP00000008895  lhprrakaygpgvesrgnvvlkpaeflvetveaglgevlvyvedpeghteearvt.......................
ENSTNIP00000009333  naskvqshgpglskafvdqvnrfyvdcsnagnnmllvgvhgpetpceevl............................
ENSTNIP00000005012  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgphtpceevyvk..........................
ENSTNIP00000000464  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgphtpceevyvk..........................
ENSTNIP00000019109  daskvvcrgtgltkalvgqknnftvdcskagtnmlmvgvhgphtpceevyvk..........................
ENSTNIP00000008895  gdptrvqargpglqqtgnvagkptyfdiytagagagdvgvilvdsngrrdtveivlenrg..................
ENSTNIP00000019406  ddedsnnitagsivtvtvtltrkrmaevfekeqestpclpeestteetqadssktktkv...................
ENSTNIP00000000464  ecgpqtmtaqvtspsgktvdadivdggnstysvrfipqemgphtv.................................
ENSTNIP00000005012  ecgpqtmtaqvtspsgktvdadivdggnstysvrfipqemgphtv.................................
ENSTNIP00000002873  v.............................................................................
ENSTNIP00000019109  cgpqtmtaqvtspsgktvdadivdggnstysvrfipqemgphtv..................................
ENSTNIP00000008895  vkvygpgveprgvlrevtthfivdaqcfymgggdhikacvsn....................................
ENSTNIP00000001133  v.............................................................................
ENSTNIP00000007616  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndndt...........
ENSTNIP00000003313  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndndt...........
ENSTNIP00000002488  chpnkvkvsgpgvaksglkafeptyftvdcseagqgdisigikcapgvvgpaeadidfdiirndndt...........
ENSTNIP00000005680  asqseamgagleeclvghpasvtvvtrdksggacksgnavlsaevftpdgsivdg.......................
ENSTNIP00000005012  spyriqslptgdaskclltvsigghgvsanlqklqtsedtvitvdakaagkgkvtckvqtpq................
ENSTNIP00000019109  spyriqslptgdaskclltvsigghgvsanlqklqtsedtvitvdakaagkgkvtckvqtpq................
ENSTNIP00000008895  ggdpipkspfhimvaplldlskvsvqglnskadvgkdedftvrtqgaggqgrldv.......................
ENSTNIP00000000464  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvgvkmtsps.......................
ENSTNIP00000005012  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvgvkmtsps.......................
ENSTNIP00000019109  kspfhitvappldigkvkvegldnkvevgkdqeftvntkgaggqgnvgvkmtsps.......................
ENSTNIP00000007616  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpceeilvkhlgnrmyn...............
ENSTNIP00000003313  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpceeilvkhlgnrmyn...............
ENSTNIP00000002488  daskvlakglglskaylgqknsfsvdcskavftgrnmllvgvdgpkvpceeilvkhlgnrmyn...............
ENSTNIP00000009333  rvevnqeqefvvdtkgaggqghlevtllspnqrtvpcrvepqpgradvrvvrytpte.....................
ENSTNIP00000005012  rltvtslqekdl..................................................................
ENSTNIP00000000464  rltvtslqekdl..................................................................
ENSTNIP00000019109  rltvtslqekdl..................................................................
ENSTNIP00000002488  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntycirfv..............................
ENSTNIP00000007616  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntycirfv..............................
ENSTNIP00000003313  vgsqcdlslkipeinmaemtaqvtspsgqrhkadimegenntycirfv..............................
ENSTNIP00000015515  mvtdyspewsypeggvkvlitgpwqeassnysclfdqisvp.....................................
ENSTNIP00000020196  pcikaispsegwttggatviligenffdglqvvfgtmlvwselitphairvqtpp.......................
ENSTNIP00000019366  svatgeglrhalvnqhttvtvttkdkdgelvktgna..........................................
ENSTNIP00000019239  pcikaispsegwttggatviiigdnffdglqvifgtmlvwselitphairvqtpp.......................
ENSTNIP00000009911  setvatgeglrhcvvgvptsvtittkdkdselckmgnavitaels.................................
ENSTNIP00000018930  pcikaispsegwttggamvivigenffeglqvvfgsmlvwselitphairvqtpp.......................
ENSTNIP00000008895  vgstcdlnlkipgeagmqemvaqvtspggktedaeiikgedstfsvrfvpqemg........................
ENSTNIP00000008895  ltitslqemslkvgheasfavqlngarglidaktqspsgateecsitel.............................
ENSTNIP00000005679  asqseamgvgleeclvghpasvtvvtrdksggacksgnavlsaevftpdgsivdg.......................
ENSTNIP00000002488  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpvaskv...............
ENSTNIP00000007616  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpvaskv...............
ENSTNIP00000003313  kspftvtvaptldlskisvaglgekmtvgkdqdiiiktkgaggqgkvgakvtapsgkpvaskv...............
ENSTNIP00000002618  drpp..........................................................................
ENSTNIP00000012827  htsvatgeglrhaatgqhhtitvttkdkdgelvrtgnavlkaeitltdgsrgaete......................
ENSTNIP00000004899  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000001568  d.............................................................................
ENSTNIP00000018500  dai...........................................................................
ENSTNIP00000004388  reagaglsiavegpskaeiafedrkdgssgvsyivqepgdyevsir................................
ENSTNIP00000009333  lsqfklgtaadfsldinetdlsqltariqapsgreepcllkrmannhtglsfiprevgehrvsifkng..........
ENSTNIP00000003898  p.............................................................................
ENSTNIP00000000963  iinlkpsrgpvsggtivnitgshldagsnvsvmfkdqpctylrrggqwltcrt.........................
ENSTNIP00000010401  iinlkpsrgpvsggtivnitgshldagsnvsvmfkdqpctylrrggqwltcrt.........................
ENSTNIP00000006011  i.............................................................................
ENSTNIP00000003313  smrmshlkvgsaadipldigeldltqltaslttpsgr.........................................
ENSTNIP00000002488  smrmshlkvgsaadipldigeldltqltaslttpsgr.........................................
ENSTNIP00000006954  qpplvtgispkegvawtkvtirgenlgtgpadliglsicghncvltaew.............................
ENSTNIP00000007616  smrmshlkvgsaadipldigeldltqltaslttpsgr.........................................
ENSTNIP00000007675  ke............................................................................
ENSTNIP00000005012  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlgis............................
ENSTNIP00000000464  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlgis............................
ENSTNIP00000006346  cshpritklfpetgprqggtrvtilgenlglqfrdiqmgvrvgkipcmpveeeyvsaeriv.................
ENSTNIP00000019109  sqlnvgtsadvslkiaetdlssltasirapsgneepcllkklpnrhlgis............................
ENSTNIP00000003898  esr...........................................................................
ENSTNIP00000005012  vnflvpftpqqgeitgevrmpsgktarphitd..............................................
ENSTNIP00000000464  vnflvpftpqqgeitgevrmpsgktarphitd..............................................
ENSTNIP00000003313  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemd...............................
ENSTNIP00000002488  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemd...............................
ENSTNIP00000007616  ftiqkgeitgevrmpsgkvakpditdnkdgtvtvkyapteaglhemd...............................
ENSTNIP00000008895  vgtasdvslkimetdlkslmasirapsgneepcvlkrlpnrhigisftpkevge........................
ENSTNIP00000018500  k.............................................................................
ENSTNIP00000009333  sfrkgeitgevfmpsgkstqptitdnldgtvtvqyspteaglhem.................................
ENSTNIP00000010401  vedptitkiepewsiysghtavtvtgtnldiiqtplirakynnhe.................................
ENSTNIP00000000963  vedptitkiepewsiysghtavtvtgtnldiiqtplirakynnhe.................................
ENSTNIP00000008895  tvqkgqitgevqmpsgrtacpyitdnkdg.................................................
ENSTNIP00000009333  cvgsscdlnlkipavdlkdvrsevlspsgivrpaelvamgndtycvsfvpem..........................
ENSTNIP00000001925  d.............................................................................
ENSTNIP00000019147  fvdpviseifptfgpksgstmltirgasldtgnklevtvgkaacniq...............................
ENSTNIP00000019148  fvdpviseifptfgpksgstmltirgasldtgnklevtvgkaacniq...............................
ENSTNIP00000003258  qpplvtgispkegvawtkvtirgenlgtgpadliglsicghnclltaew.............................
ENSTNIP00000011053  qpplvtgispkegvawtkvtirgenlgtgpadliglsicghnclltaew.............................
ENSTNIP00000007602  cpehvihnieplsglleggtmltisgsnlgqkvedvlysvsvagvpc...............................
ENSTNIP00000008163  iitsfspssgsiadiggtlltvggfgfsenatvtigsneckvvh..................................
ENSTNIP00000019109  nflvpftpqqgeitgevrmpsgktarphitdnk.............................................
ENSTNIP00000006767  cshpritkispltgpreggtrvtiegenlglqvkeiayv.......................................
ENSTNIP00000006766  cshpritkispltgpreggtrvtiegenlglqvkeiayv.......................................
ENSTNIP00000008162  iitsfspssgsiadiggtlltvggfgfsenatvtigsneckvvh..................................
ENSTNIP00000019061  cpnpqitdiiprfgpmrgeisitilgsnlgihrddiksitvagepcthhaek..........................
ENSTNIP00000007602  yqdpfvmsvspnrgpkaggtvltisgrnlltgrlsdiritvggvschivkvyhpsn......................
ENSTNIP00000012220  ipeilkkslhscsvrggeevfiigknf...................................................
ENSTNIP00000008162  tpvlssitpitgssgavvtlagsgfgadlqqisvtinsvpcnvst.................................
ENSTNIP00000010401  cthpritkitplrgpreggtlvtirgenlgldfreiqgnvkvaevdctpiregy........................
ENSTNIP00000000963  cthpritkitplrgpreggtlvtirgenlgldfreiqgnvkvaevdctpiregy........................
ENSTNIP00000002265  fvepsvtdlkpdsgpvfggttvtltgryldsgsqrdvlfgdercsilsvsggpep.......................
ENSTNIP00000017783  fvepsvtdlkpdsgpvfggttvtltgryldsgsqrdvlfgdercsilsvsggpep.......................
ENSTNIP00000006767  tedptitsiepnwtilngstmitvtgtnlltiqepkvra.......................................
ENSTNIP00000006766  tedptitsiepnwtilngstmitvtgtnlltiqepkvra.......................................
ENSTNIP00000021085  cpspeihkifplrgpveggtlltvqgrnlgrraeavkvsigdvpcslqpdry..........................
ENSTNIP00000013222  etlmfshkavisini...............................................................
ENSTNIP00000008163  vaslsplegslaggtsltftgngfapgntsvliggqpceirhvtpstl..............................
ENSTNIP00000006767  fvspsfsrvhpekgpvsggtrltvtgrhldagssvsciinkeeclfvkrtnre.........................
ENSTNIP00000006766  fvspsfsrvhpekgpvsggtrltvtgrhldagssvsciinkeeclfvkrtnre.........................
ENSTNIP00000008162  ltpvitevsprrggtaggtsltitgsgfstnthevnvtiagsvcdvqsan............................
ENSTNIP00000008162  vaslsplegslaggtsltftgngfapgntsvliggqpceirhvtpstl..............................
ENSTNIP00000008003  cpepkitaisprqgplngrilvtikgsnmgvrkedikri.......................................
ENSTNIP00000009803  psasntlvwgpgldanvvlparffyiqaadssgrnlttspgektfevkikspgehltri...................
ENSTNIP00000008163  tpvvteinpsqgsiglgtlltvtgtgfise................................................
ENSTNIP00000010138  fvipniteirpnygprvggtlitvtglhldagrtrkvtlnevpcp.................................
ENSTNIP00000008162  tpvvteinpsqgsiglgtlltvtgtgfise................................................
ENSTNIP00000006346  ysggtlltvsgtnlatiqepkirakygqvesfh.............................................
ENSTNIP00000021085  ymepnkgyraggtkvtitgehldigsqvrvm...............................................
ENSTNIP00000002265  capiitevspkvapvggetevtlcgwefqsplrpaiingkthrvt.................................
ENSTNIP00000017783  capiitevspkvapvggetevtlcgwefqsplrpaiingkthrvt.................................
ENSTNIP00000008003  yrdpeptavepargpaaggtvitikgkylnta..............................................
ENSTNIP00000021085  knptiffikptksylsggrtitvtgqgfdlvqsa............................................
ENSTNIP00000008163  vtgvspskgsveggtlltvdgrffdqtdqparvfvgglpceienvsdd..............................
ENSTNIP00000019061  yrdpipeavepsrgpkaggtlititghflitgskedvqvtiggvgctves............................
ENSTNIP00000008163  vhsvsplygslmggtrltlsgsgfsnnisdn...............................................
ENSTNIP00000007472  scpppqitqvqpvsgpleggvlvtitgsnlgmryqdvvggitvagiwcppfrpkgt......................
ENSTNIP00000009146  scpppqitqvqpvsgpleggvlvtitgsnlgmryqdvvggitvagiwcppfrpkgt......................
ENSTNIP00000008163  tpalttiapnnisettdvviygsgfgnhaddvvvfa..........................................
ENSTNIP00000002804  lrtfkpffvdftlpysl.............................................................
ENSTNIP00000008162  vtgvspskgsveggtlltvdgrffdqtdqparvfvgglpceienvsdd..............................
ENSTNIP00000008162  vhsvsplygslmggtrltlsgsgfsnnisd................................................
ENSTNIP00000007744  wldvqadqeyvlqvalrrlhpgqq......................................................
ENSTNIP00000008163  lpavdslapsigsptghtrlhikgsgfpeghvtvasewca......................................
ENSTNIP00000007714  itvhicspvlssvglyrlllhtqtfq....................................................
ENSTNIP00000008162  tpalttiapnnisettdvviygsgfgnhaddvvvfa..........................................
ENSTNIP00000008163  cstptvhaispnqgsyhqilhiqgngfgnttcaievi.........................................
ENSTNIP00000010138  enpkitavlpdcsfdrncrgskiviegenldsvyrtivrfkpneshlkp.............................
ENSTNIP00000019147  yctpvitkvfptsgpirgsttvticglnfgfvkt............................................
ENSTNIP00000019148  yctpvitkvfptsgpirgsttvticglnfgfvkt............................................
ENSTNIP00000018520  lrtfkpffvdftlp................................................................
ENSTNIP00000020566  kepqevgqtmsfrvqlfykngqpfpahrpvglrvnithielaldip................................
ENSTNIP00000008162  lpavdslapsigsptghtrlhikgsgfpeghvtvasewca......................................
ENSTNIP00000009105  rpercfvagpglhpdvvlpvryfviqavdsngenltlspvkmsrrlqvqisplkkqehir..................
ENSTNIP00000008162  cstptvhaispnqgsyhqilhiqgngfgnttcaievi.........................................
ENSTNIP00000005417  ddpviteaspaesfyaggrvvmvtgrnldvvqrpvlav........................................
ENSTNIP00000004483  adpqktslilnkddircgwpatvvvqtkdqygdvvhvpnmkvevkavpvsqkksvqpdnikklqrlpgnssp......
ENSTNIP00000001542  adpqktslilnkddircgwpatvvvqtkdqygdvvhvpnmkvevkavpvsqkksvqpdnikklqrlpgnssp......
ENSTNIP00000018046  adpqktslilnkddircgwpatvvvqtkdqygdvvhvpnmkvevkavpvsqkksvqpdnikklqrlpgnssp......
ENSTNIP00000010138  scppgiagffprtappdgqteltvfgwefqsplrpaitsrthqvrlghta............................
ENSTNIP00000002265  kinpvvtsveprcsvqrhrgsrlviqgqnldsahktvvkyvskn..................................
ENSTNIP00000017783  kinpvvtsveprcsvqrhrgsrlviqgqnldsahktvvkyvskn..................................
ENSTNIP00000006346  fvtpyfnriqpsqgpisggtritvegs...................................................
ENSTNIP00000008162  nvqpnegsfgggalltvvgsgfepsnstvtvcdeeckvhrdmsssshlfcqsp.........................
ENSTNIP00000006857  eplsstgllelkpgsplilkgrnlipsapgntklnytvligetp..................................
ENSTNIP00000019147  nrdpiissiqpsrsfvsggctvvahglflqsglqpqmilttgqdaevfhvscv.........................
ENSTNIP00000019148  nrdpiissiqpsrsfvsggctvvahglflqsglqpqmilttgqdaevfhvscv.........................
ENSTNIP00000006521  feplsstgllelkpgsplilkgrnlipsapgntklnytvliget..................................
ENSTNIP00000019061  venpivlghnpkesfvcggrnivvtgsgfdfiqtavmkvhgnnmtaveagieleysspeyvlh...............
ENSTNIP00000004388  rltvaslqesglkvnqpasfavslng....................................................
ENSTNIP00000016904  eeqlevlvqmhdfhgrpkryggdfllarl.................................................
ENSTNIP00000022219  slffkewapaaealfltgdfngwdkf....................................................
ENSTNIP00000002960  slffkewapaaealfltgdfngwdkf....................................................
ENSTNIP00000010459  v.............................................................................
ENSTNIP00000008492  gggqwrvgdrlevliemrdfrgipktsggdvllarl..........................................
ENSTNIP00000011929  eispysgsimggtefvvlnvtfsntsglmcrfhnntvtegyvdghgrg..............................
ENSTNIP00000010401  pgspiilkgrnflpptssgngrlny.....................................................
ENSTNIP00000000963  pgspiilkgrnflpptssgngrlny.....................................................


                                                                                               10   
                                                                                                |   
d1g4ma2               .................................................................-RPGPQPTAETTR
ENSTNIP00000015820  .................dqidinvgfdkgldriflvspitilheideesplfgiskqdletsdfe-------------
ENSTNIP00000014157  .................................................................-------------
ENSTNIP00000001954  .................................................................-------------
ENSTNIP00000014574  ................dqidmnvgydkgtdrlflvapltvvheideesplfgiskqdlessdfei-------------
ENSTNIP00000014544  ..........................................plvldlqgdldsfkknpfvlkeg-------------
ENSTNIP00000010486  ................................................qafppvpeerkpnsrlq-------------
ENSTNIP00000013758  .................eqmdlnvgydegtdrlflvsplvivheidkdsplysinraeleadnfe-------------
ENSTNIP00000012673  .................dqvdidvgfdsgldriflvspitivheidedspfyemskedlqtsefe-------------
ENSTNIP00000022103  .................dqceldvgfgtgadqlflvsplticheinskspffdlsqrslmneqfe-------------
ENSTNIP00000010457  ..............nqtdinvgystgddrlflvspliicheinekspfwdisqahlakeeleivv-------------
ENSTNIP00000017993  .................dqceldvgfgtgadqlflvsplticheinpkspffdlskrslmneqfe-------------
ENSTNIP00000006675  ...................................................ievfppaekdqkpa-------------
ENSTNIP00000002599  ...................................................ievfppaekdqkpa-------------
ENSTNIP00000007179  ..................qtdidvgyddgldrlflvsplvvvheinrnsplydmsrddlqredfe-------------
ENSTNIP00000019582  .............................................dqleldvgfstgadqlflvs-------------
ENSTNIP00000009102  .............................................dqtdisvgfetgddrlflvs-------------
ENSTNIP00000017145  ..............................................dlqgdlealkkqafvlkeg-------------
ENSTNIP00000009422  .................dqidihmdnpvgtngiflvspliichvidqgsplynlsasdllhedie-------------
ENSTNIP00000009249  .................qqidiqtesaitsnslfllapliichvidktsplydlsamelqcsdle-------------
ENSTNIP00000005244  .................aqldiqvenplrsngiflvsplvishtiergsplyelsaqalsaedle-------------
ENSTNIP00000005246  .................aqldiqvenplrsngiflvsplvishtiergsplyelsaqalsaedle-------------
ENSTNIP00000014127  ................................................rqvypelqdkeqlthtk-------------
ENSTNIP00000006368  .....................................eqvdidfmvdagkdhlffvcpltlyhvi-------------
ENSTNIP00000009083  ..........................................................qlypesh-------------
ENSTNIP00000002561  ..........................................................qlypesh-------------
ENSTNIP00000001954  .................................................................-KPGPQPTAETSR
ENSTNIP00000019946  ............................................qvypptgdntaktpmqefllg-------------
ENSTNIP00000014157  .................................................................-KPGPQPTAETSR
ENSTNIP00000010486  .................................................................-KPGPQPMVETTR
ENSTNIP00000010899  ................dnvdinvgfdtgtdriflvspvtivheindespffeidrktlekdndle-------------
ENSTNIP00000003800  ......................................................vdfymdssgdc-------------
ENSTNIP00000008976  .................................................................-------------
ENSTNIP00000010244  .................................................rnvpfqvdtssdspfl-------------
ENSTNIP00000000824  qdldipnreivlatpatvihridpssplyglgpedllgnhfemvvsftytgdstgllhqtrtsyt-------------
ENSTNIP00000007048  .................................................................-------------
ENSTNIP00000009940  .............................................................kgqc-------------
ENSTNIP00000019946  .................................................................------PKADITK
ENSTNIP00000005358  .................................................................------PSVETTR
ENSTNIP00000014413  ..................................................rpinsfrmierhyfq-------------
ENSTNIP00000019221  .................................................................-------------
ENSTNIP00000022950  .................................................................-------------
ENSTNIP00000005358  ...............................................................tg-------------
ENSTNIP00000002561  .................................................................-----GPKADVCK
ENSTNIP00000009083  .................................................................-----GPKADVCK
ENSTNIP00000006156  .................................................................-------------
ENSTNIP00000004888  .................................................................-------------
ENSTNIP00000014127  .................................................................------------E
ENSTNIP00000020787  ...........................................................ledgcw-------------
ENSTNIP00000002395  .................................................................-------------
ENSTNIP00000013223  .................................................................-------------
ENSTNIP00000005835  .................................................................-------------
ENSTNIP00000009178  ..................................................dfhldqlgqqpcplf-------------
ENSTNIP00000010775  .................................................................-------------
ENSTNIP00000005251  .................................................................-------------
ENSTNIP00000005249  .................................................................-------------
ENSTNIP00000005250  .................................................................-------------
ENSTNIP00000016350  .................................................................-------------
ENSTNIP00000015973  ............................................................regwr-------------
ENSTNIP00000010563  .................................................................-------------
ENSTNIP00000021888  .................................................................-------------
ENSTNIP00000021411  .................................................................-------------
ENSTNIP00000020537  .................................................................-------------
ENSTNIP00000005012  ...............................................................cs-------------
ENSTNIP00000019109  ...............................................................cs-------------
ENSTNIP00000000464  ...............................................................cs-------------
ENSTNIP00000007616  .............................................................csve-------------
ENSTNIP00000003313  .............................................................csve-------------
ENSTNIP00000002488  ..............................................................csv-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000001789  .................................................................-------------
ENSTNIP00000002977  .................................................................-------------
ENSTNIP00000001513  .................................................................-------------
ENSTNIP00000017397  .................................................................-------------
ENSTNIP00000017377  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000006628  ............................................................rwwfs-------------
ENSTNIP00000008517  .................................................................-------------
ENSTNIP00000017383  .................................................................-------------
ENSTNIP00000008384  .................................................................-------------
ENSTNIP00000009333  .............................................................svey-------------
ENSTNIP00000007897  .................................................................-------------
ENSTNIP00000015072  .................................................................-------------
ENSTNIP00000003494  .................................................................-------------
ENSTNIP00000006950  .................................................................-------------
ENSTNIP00000006734  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000003313  .................................................................--------T----
ENSTNIP00000002488  .................................................................--------T----
ENSTNIP00000007616  .................................................................--------T----
ENSTNIP00000014961  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000012789  .................................................................-------KDKTLC
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000013084  .................................................................------------R
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000016574  .................................................................-----GTKEKTLC
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000009333  ..............................................................cnv-------------
ENSTNIP00000021564  .................................................................-------------
ENSTNIP00000015432  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000003313  .........................................................nthtvkyt-------------
ENSTNIP00000002488  .........................................................nthtvkyt-------------
ENSTNIP00000007616  .........................................................nthtvkyt-------------
ENSTNIP00000006675  .................................................................--------IETHR
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000021437  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000014295  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000014296  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000002599  .................................................................--------IETHR
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000005012  ..............................................................dfd-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000019109  ..............................................................dfd-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000013288  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000006011  .................................................................-------------
ENSTNIP00000013084  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000009872  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000009333  .............................................................fdii-------------
ENSTNIP00000016574  .................................................................-------------
ENSTNIP00000018364  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000018732  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000009333  ....................................................qtvkytpakqgel-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000001925  .................................................................-----QHESKEKK
ENSTNIP00000001568  .................................................................-----QHESKEKK
ENSTNIP00000014417  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000009333  .................................................................-----------V-
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000005497  .................................................................-------------
ENSTNIP00000012789  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000006205  .................................................................-------------
ENSTNIP00000009333  .................................................................---------LNVD
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000001133  .................................................................-------------
ENSTNIP00000012114  .................................................................-------------
ENSTNIP00000002873  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000019406  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000002873  .................................................................--------TKEFS
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000001133  .................................................................--------TKEFS
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000005680  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000015515  .................................................................-------------
ENSTNIP00000020196  .................................................................-------------
ENSTNIP00000019366  .................................................................-------------
ENSTNIP00000019239  .................................................................-------------
ENSTNIP00000009911  .................................................................-------------
ENSTNIP00000018930  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000005679  .................................................................-------------
ENSTNIP00000002488  .................................................................-EPGLSPETSQVK
ENSTNIP00000007616  .................................................................-EPGLSPETSQVK
ENSTNIP00000003313  .................................................................-EPGLSPETSQVK
ENSTNIP00000002618  .................................................................-------------
ENSTNIP00000012827  .................................................................-------------
ENSTNIP00000004899  .................................................................-------------
ENSTNIP00000007675  .................................................................-------------
ENSTNIP00000001568  .................................................................-------------
ENSTNIP00000018500  .................................................................-------------
ENSTNIP00000004388  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000003898  .................................................................---LSGSNSTTLC
ENSTNIP00000000963  .................................................................-------------
ENSTNIP00000010401  .................................................................-------------
ENSTNIP00000006011  .................................................................--------TKKFN
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000006954  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000007675  .................................................................---------KKVT
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000006346  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000003898  .................................................................-------------
ENSTNIP00000005012  .................................................................-------------
ENSTNIP00000000464  .................................................................-------------
ENSTNIP00000003313  .................................................................-------------
ENSTNIP00000002488  .................................................................-------------
ENSTNIP00000007616  .................................................................-------------
ENSTNIP00000008895  .................................................................-------------
ENSTNIP00000018500  .................................................................-------------
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000010401  .................................................................-------------
ENSTNIP00000000963  .................................................................-------------
ENSTNIP00000008895  .................................................................--------TVTVK
ENSTNIP00000009333  .................................................................-------------
ENSTNIP00000001925  .................................................................-------------
ENSTNIP00000019147  .................................................................-------------
ENSTNIP00000019148  .................................................................-------------
ENSTNIP00000003258  .................................................................-------------
ENSTNIP00000011053  .................................................................-------------
ENSTNIP00000007602  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000019109  .................................................................-------------
ENSTNIP00000006767  .................................................................-------------
ENSTNIP00000006766  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000019061  .................................................................-------------
ENSTNIP00000007602  .................................................................-------------
ENSTNIP00000012220  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000010401  .................................................................-------------
ENSTNIP00000000963  .................................................................-------------
ENSTNIP00000002265  .................................................................-------------
ENSTNIP00000017783  .................................................................-------------
ENSTNIP00000006767  .................................................................-------------
ENSTNIP00000006766  .................................................................-------------
ENSTNIP00000021085  .................................................................-------------
ENSTNIP00000013222  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000006767  .................................................................-------I-----
ENSTNIP00000006766  .................................................................-------I-----
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000008003  .................................................................-------------
ENSTNIP00000009803  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000010138  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000006346  .................................................................-------------
ENSTNIP00000021085  .................................................................-------------
ENSTNIP00000002265  .................................................................-------------
ENSTNIP00000017783  .................................................................-------------
ENSTNIP00000008003  .................................................................-------------
ENSTNIP00000021085  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000019061  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000007472  .................................................................-------------
ENSTNIP00000009146  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000002804  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000007744  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000007714  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000008163  .................................................................-------------
ENSTNIP00000010138  .................................................................----------V--
ENSTNIP00000019147  .................................................................-------------
ENSTNIP00000019148  .................................................................-------------
ENSTNIP00000018520  .................................................................-------------
ENSTNIP00000020566  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000009105  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000005417  .................................................................-------------
ENSTNIP00000004483  .................................................................-------------
ENSTNIP00000001542  .................................................................-------------
ENSTNIP00000018046  .................................................................-------------
ENSTNIP00000010138  .................................................................-------------
ENSTNIP00000002265  .................................................................-------------
ENSTNIP00000017783  .................................................................-------------
ENSTNIP00000006346  .................................................................-------------
ENSTNIP00000008162  .................................................................-------------
ENSTNIP00000006857  .................................................................-------------
ENSTNIP00000019147  .................................................................-------------
ENSTNIP00000019148  .................................................................-------------
ENSTNIP00000006521  .................................................................-------------
ENSTNIP00000019061  .................................................................-------------
ENSTNIP00000004388  .................................................................-------------
ENSTNIP00000016904  .................................................................-------------
ENSTNIP00000022219  .................................................................-------------
ENSTNIP00000002960  .................................................................-------------
ENSTNIP00000010459  .................................................................-------------
ENSTNIP00000008492  .................................................................-------------
ENSTNIP00000011929  .................................................................---------H---
ENSTNIP00000010401  .................................................................-------------
ENSTNIP00000000963  .................................................................-------------


                           20        30              40        50                 60        70      
                            |         |               |         |                  |         |      
d1g4ma2               QFLMSDKPLHLEASLDKE......IYYHGEPISVNVHVTNNTNK...TVKKIKIS......VRQYADICLFNT.....
ENSTNIP00000015820  ------------------......--------------------...----IVVI......LEGMVEATAMTTqarss
ENSTNIP00000014157  ------------------......--------------------...--------......------------.....
ENSTNIP00000001954  ------------------......--------------------...--------......------------.....
ENSTNIP00000014574  ------------------......--------------------...-----VII......LEGLVEATAMTTqarss
ENSTNIP00000014544  ------------------......-------VEYKIKISFKVNK...--------......------------.....
ENSTNIP00000010486  ------------------......--------------------...--------......------------.....
ENSTNIP00000013758  ------------------......--------------------...----IVVI......LEGMVEATAMTTqfrss
ENSTNIP00000012673  ------------------......--------------------...----IVVI......LEGMVEATAMTTqcrss
ENSTNIP00000022103  ------------------......--------------------...----IVVI......LEGIVETTGMTC.....
ENSTNIP00000010457  ------------------......--------------------...-------I......LEGMVEAT----.....
ENSTNIP00000017993  ------------------......--------------------...----IVVI......LEGIVETTGMTC.....
ENSTNIP00000006675  ------------------......--------------------...--------......------------.....
ENSTNIP00000002599  ------------------......--------------------...--------......------------.....
ENSTNIP00000007179  ------------------......--------------------...----IVVI......LEGMVEATAMTTqarss
ENSTNIP00000019582  ------------------......--------------------...--------......------------.....
ENSTNIP00000009102  ------------------......--------------------...--------......------------.....
ENSTNIP00000017145  ------------------......--------------------...--------......------------.....
ENSTNIP00000009422  ------------------......--------------------...----VIVV......LEGVVETTGITT.....
ENSTNIP00000009249  ------------------......--------------------...----VIVI......LEGVVETTG---.....
ENSTNIP00000005244  ------------------......--------------------...----I---......------------.....
ENSTNIP00000005246  ------------------......--------------------...----I---......------------.....
ENSTNIP00000014127  ------------------......--------------------...--------......------------.....
ENSTNIP00000006368  ------------------......--------------------...--------......------------.....
ENSTNIP00000009083  ------------------......--------------------...--------......------------.....
ENSTNIP00000002561  ------------------......--------------------...--------......------------.....
ENSTNIP00000001954  QFLMSDKLLHLEASLDKQ......IYYHGEPISVNVHVTNNTNK...TVKKMKVS......VRQLADICLFST.....
ENSTNIP00000019946  ------------------......--------------------...--------......------------.....
ENSTNIP00000014157  QFLMSDKLLHLEASLDKQ......IYYHGEPISVNVHVTNNTNK...TVKKMKVS......VRQLADICLFST.....
ENSTNIP00000010486  SFLMSDRSLHLEASLDKE......LYYHGEPISVNVHVTNNSTK...TVKRVKIS......VRQYADICLFST.....
ENSTNIP00000010899  ------------------......--------------------...----LVVI......LEGMVEATAMTT.....
ENSTNIP00000003800  ------------------......--------------------...--------......------------.....
ENSTNIP00000008976  ------------------......--------------------...--------......------------.....
ENSTNIP00000010244  ------------------......--------------------...--------......------------.....
ENSTNIP00000000824  ------------------......--------------------...--------......-----------Ptdihw
ENSTNIP00000007048  ------------------......--------------------...--------......------------.....
ENSTNIP00000009940  ------------------......--------------------...--------......------------.....
ENSTNIP00000019946  QFIMSDKPVHLEASLEKE......IYYHGQPITVNVKIHNESSK...VVKKIKIS......VEQLTNVVLYSS.....
ENSTNIP00000005358  DFVMSDKPLHVKASLDKE......VYYHGEPVKVHVSVTNSSSK...NIKNIIVS......VDQVANVVLYSN.....
ENSTNIP00000014413  ------------------......--------------------...--------......------------.....
ENSTNIP00000019221  ------------------......--------------------...--------......------------.....
ENSTNIP00000022950  ------------------......--------------------...--------......------------.....
ENSTNIP00000005358  ------------------......--------------------...--------......------------.....
ENSTNIP00000002561  NFMMSDKPVHIEASLEKD......LYFHGEAIPIKIKIQNESNK...TVKKFKVT......VDQTTDIVLYSA.....
ENSTNIP00000009083  NFMMSDKPVHIEASLEKD......LYFHGEAIPIKIKIQNESNK...TVKKFKVT......VDQTTDIVLYSA.....
ENSTNIP00000006156  ------------------......--------------------...--------......------------.....
ENSTNIP00000004888  ------------------......--------------------...--------......------------.....
ENSTNIP00000014127  FFVMSEKPLHVRLSLARE......TFYHGEPVPVSLEINNSSSR...TVKDISLS......VEQVTTVVLYSN.....
ENSTNIP00000020787  ------------------......--------------------...--------......------------.....
ENSTNIP00000002395  ------------------......--------------------...--------......------------.....
ENSTNIP00000013223  ------------------......--------------------...--------......------------.....
ENSTNIP00000005835  ------------------......--------------------...--------......------------.....
ENSTNIP00000009178  ------------------......--------------------...--------......------------.....
ENSTNIP00000010775  ------------------......--------------------...--------......------------.....
ENSTNIP00000005251  ------------------......--------------------...--------......------------.....
ENSTNIP00000005249  ------------------......--------------------...--------......------------.....
ENSTNIP00000005250  ------------------......--------------------...--------......------------.....
ENSTNIP00000016350  ------------------......--------------------...--------......------------.....
ENSTNIP00000015973  ------------------......--------------------...--------......------------.....
ENSTNIP00000010563  ------------------......--------------------...--------......------------.....
ENSTNIP00000021888  ------------------......--------------------...--------......------------.....
ENSTNIP00000021411  ------------------......--------------------...--------......------------.....
ENSTNIP00000020537  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------Y-----.....
ENSTNIP00000003313  ------------------......--------------------...--------......------Y-----.....
ENSTNIP00000002488  ------------------......--------------------...--------......-----E------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000001789  ------------------......--------------------...--------......------------.....
ENSTNIP00000002977  ------------------......--------------------...--------......------------.....
ENSTNIP00000001513  ------------------......--------------------...--------......------------.....
ENSTNIP00000017397  ------------------......--------------------...--------......------------.....
ENSTNIP00000017377  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000006628  ------------------......--------------------...--------......------------.....
ENSTNIP00000008517  ------------------......---------M----------...--------......------------.....
ENSTNIP00000017383  ------------------......--------------------...--------......------------.....
ENSTNIP00000008384  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000007897  ------------------......--------------------...--------......------------.....
ENSTNIP00000015072  ------------------......--------------------...--------......------------.....
ENSTNIP00000003494  ------------------......--------------------...--------......------------.....
ENSTNIP00000006950  ------------------......---T----------------...--------......------------.....
ENSTNIP00000006734  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000014961  ------------------......--------------------...--------......-----------N.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000012789  CWFCTSGPISLSAKIERK......GYTPGESIQIFAEIENCSSR...MV-VPKAA......IYQTQTFYAKGK.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000013084  AWYRNFGQVSVTAKIDRK......GYTPGEVIPVFAEFDNATSR...SV-VPKAF......IIQTQTFIARGT.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......----V-------.....
ENSTNIP00000000464  ------------------......--------------------...--------......----V-------.....
ENSTNIP00000019109  ------------------......--------------------...--------......----V-------.....
ENSTNIP00000016574  CWFCASGPISLSAKIERK......GYTPGESIQIFAEVENCSSR...VV-VPKAA......LYQTQTFFAKGK.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......-----T------.....
ENSTNIP00000021564  ------------------......--------------------...--------......------------.....
ENSTNIP00000015432  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...----L---......------------.....
ENSTNIP00000003313  ------------------......--------------------...----L---......------------.....
ENSTNIP00000002488  ------------------......--------------------...----L---......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000006675  SYLMSDRSLHLEASLDKEvth...T---------WVFCKLQRNKnthNACSFLVP......VRQYADICLFSM.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000021437  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  --------G---------......--------------------...--------......------------.....
ENSTNIP00000014295  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......---------VKVHVINPSGT...KT------......------------.....
ENSTNIP00000000464  ------------------......---------VKVHVINPSGT...KT------......------------.....
ENSTNIP00000019109  ------------------......---------VKVHVINPSGT...KT------......------------.....
ENSTNIP00000014296  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......----GEGVPVDVQVKDNGNG...T-------......-----YSCSYTP.....
ENSTNIP00000002488  ------------------......----GEGVPVDVQVKDNGNG...T-------......-----YSCSYTP.....
ENSTNIP00000007616  ------------------......----GEGVPVDVQVKDNGNG...T-------......-----YSCSYTP.....
ENSTNIP00000008895  ------------------......--------------------...--------......----VTYCPTEP.....
ENSTNIP00000002599  SYLMSDRSLHLEASLDKEv.....TH-------TWVFCKLQRNK...NTHNAQLQikhkvpVRQYADICLFSM.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000013288  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......-----YLCVYTP.....
ENSTNIP00000000464  ------------------......--------------------...--------......-----YLCVYTP.....
ENSTNIP00000019109  ------------------......--------------------...--------......-----YLCVYTP.....
ENSTNIP00000009333  ------------------......--------------------...--------......---------Q--.....
ENSTNIP00000009333  ------------------......--------------------...--------......-------H----.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......---KVTYCPTEP.....
ENSTNIP00000000464  ------------------......--------------------...--------......---KVTYCPTEP.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......---KVTYCPTEP.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000006011  --------QEFDITFTNNkv....VYGPGESISGTVKIRTSSSL...PYKVIKVN......CQGSCGISNKLNd....
ENSTNIP00000013084  ----------LDVVFDSPevdrppVFSSGDVVSGRVLLDLFGEV...RVSSLKLH......AEGFAKVHWTESrsags
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......--------V---.....
ENSTNIP00000009333  ------------------......--------------------...--------......----V-------.....
ENSTNIP00000009872  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000016574  ------------------......VFSGGDMVSGRVVVEVTGDV...RVKSLDVH......ARGVAKVRWTESrnaga
ENSTNIP00000018364  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......---KVTYCPTEP.....
ENSTNIP00000002488  ------------------......--------------------...--------......---KVTYCPTEP.....
ENSTNIP00000007616  ------------------......--------------------...--------......---KVTYCPTEP.....
ENSTNIP00000018732  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ----------C-------......--------------------...--------......------------.....
ENSTNIP00000002488  ----------C-------......--------------------...--------......------------.....
ENSTNIP00000007616  ----------C-------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000001925  MNLFTSGSVSMDVSLEKT......GFCQGEGISVLACIQNNSSR...EI-KPKYC......LYRKHSFFAEGK.....
ENSTNIP00000001568  MNLFTSGSVSMDVSLEKT......GFCQGEGISVLACIQNNSSR...EI-KPKYC......LYRKHSFFAEGK.....
ENSTNIP00000014417  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ----------------D-......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......-----H------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000005497  ------------------......--------------------...--------......------------.....
ENSTNIP00000012789  ---------SFDCLNDTNvp....VFSSGDCVSGRVIIEVTGEI...RVKSLKIH......AKGLAKVRWTESrnags
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......V-----------.....
ENSTNIP00000006205  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  CSRAGPGELSLEAALDA-......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000001133  -----------DIFFDHDkt....EYSSGDSVSGSVKVELSGPL...LCKAIKIN......CCGFCGVTNKVN.....
ENSTNIP00000012114  ------------------......--------------------...--------......------------.....
ENSTNIP00000002873  -----------DIFFDHDkt....EYSSGDSVSGSVKVELSGPL...LCKAIKIN......CCGFCGVTNKVN.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...------V-......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000019406  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000002873  YMLMKSGTVVLKAQTDMK......GYTPGQIIQVKAHISNQSGK...STGHMAAS......LVQNVSYGTKKP.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......----------------P---...--------......------------.....
ENSTNIP00000001133  YMLMKSGTVVLKAQTDMK......GYTPGQIIQVKAHISNQSGK...STGHMAAS......LVQNVSYGTKKP.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000005680  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  -----G------------......--------------------...--------......------------.....
ENSTNIP00000005012  -----G------------......--------------------...--------......------------.....
ENSTNIP00000019109  -----G------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000005012  ------------------......--------------------...-------K......VNQEASFMVQRN.....
ENSTNIP00000000464  ------------------......--------------------...-------K......VNQEASFMVQRN.....
ENSTNIP00000019109  ------------------......--------------------...-------K......VNQEASFMVQRN.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000015515  ------------------......--------------------...--------......------------.....
ENSTNIP00000020196  ------------------......--------------------...--------......------------.....
ENSTNIP00000019366  ------------------......--------------------...--------......------------.....
ENSTNIP00000019239  ------------------......--------------------...--------......------------.....
ENSTNIP00000009911  ------------------......--------------------...--------......------------.....
ENSTNIP00000018930  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000005679  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  FIPREAGPYQVELTYD--......--------------------...--------......------------.....
ENSTNIP00000007616  FIPREAGPYQVELTYD--......--------------------...--------......------------.....
ENSTNIP00000003313  FIPREAGPYQVELTYD--......--------------------...--------......------------.....
ENSTNIP00000002618  ------------------......VFSSGDVVSGRVLLDLFGEV...RVSSLKLH......A-EFAKVHWTERsagss
ENSTNIP00000012827  ------------------......--------------------...--------......--------V---.....
ENSTNIP00000004899  ------------------......VFSSGDVVSGRVLLDLFGEV...RVSSLKLH......A-EFAKVHWTERsagss
ENSTNIP00000007675  ----------------KS......FFCGGDVVSGRVEVEVNEAT...RVSAVRLL......ALGRAKVEYAKG.....
ENSTNIP00000001568  ------------------......TFSNGDSVSGQVTLEVAKDC...QISSLSVK......FKGKARVLWSER.....
ENSTNIP00000018500  --------------NSRN......TFTNGDTINGRIVVEVSKET...TIQALIFI......GQGEAQVCWSEQlglhh
ENSTNIP00000004388  ------------------......--------------------...--------......------------.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000003898  CLWCASGPITLTATAEKK......AFSPGETLKIVCEISNASSR...TV-TPKMK......LLQKQNFYTHNKvsr..
ENSTNIP00000000963  ------------------......--------------------...--------......------------.....
ENSTNIP00000010401  ------------------......--------------------...--------......------------.....
ENSTNIP00000006011  YLLLKTGTLMLKTRSDLR......GYIPGQVIRLATEIHNKSGK...DTGCVLAS......LIQKVSYKTRRP.....
ENSTNIP00000003313  ------------------......--------------------...--------......------------.....
ENSTNIP00000002488  ------------------......--------------------...--------......------------.....
ENSTNIP00000006954  ---M--------------......--------------------...--------......------------.....
ENSTNIP00000007616  ------------------......--------------------...--------......------------.....
ENSTNIP00000007675  CMFIPDGQVSLNAKIDRS......GFCEGEDICINAKFENCSRI...VVPKAAII......A--KHIYQANGR.....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000006346  ------------------......--------------------...------C-......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000003898  ------------------......SFCSGDRVTGKISFELKKET...KISAIRME......FRGTAHVHWSTSg....
ENSTNIP00000005012  ------------------......--------------------...--------......------------.....
ENSTNIP00000000464  ------------------......--------------------...--------......------------.....
ENSTNIP00000003313  ------------I-----......--------------------...--------......------------.....
ENSTNIP00000002488  ------------I-----......--------------------...--------......------------.....
ENSTNIP00000007616  ------------I-----......--------------------...--------......------------.....
ENSTNIP00000008895  ------------------......--------------------...--------......------------.....
ENSTNIP00000018500  SLTLSSGGVFMHIKTDRM......GYMQGETIQVTLEITNCSCR...SV-KPTFA......LYERQSFFAQGK.....
ENSTNIP00000009333  ------------------......--------------------...--------......------------.....
ENSTNIP00000010401  ------------------......--------------------...--------......------------.....
ENSTNIP00000000963  ------------------......--------------------...--------......------------.....
ENSTNIP00000008895  YSPTERGLHEMEIKYDG-......SHIPGSPLQFYVDAINSGHV...--------......------------.....
ENSTNIP00000009333  ------G-----------......--------------------...--------......------------.....
ENSTNIP00000001925  ------------------......TFSNGDSVSGQVTLEVAKDC...QISSLSVK......FKGKARVLWSERhgntt
ENSTNIP00000019147  ------------------......--------------------...--------......------------.....
ENSTNIP00000019148  ------------------......--------------------...--------......------------.....
ENSTNIP00000003258  ---M--------------......--------------------...--------......------------.....
ENSTNIP00000011053  ---M--------------......--------------------...--------......------------.....
ENSTNIP00000007602  ------------------......--------------------...--------......------------.....
ENSTNIP00000008163  ------------------......--------------------...--------......------------.....
ENSTNIP00000019109  ------------------......--------------------...--------......------------.....
ENSTNIP00000006767  ------------------......--------------------...--------......------------.....
ENSTNIP00000006766  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......------------.....
ENSTNIP00000019061  ------------------......--------------------...--------......------------.....
ENSTNIP00000007602  ------------------......--------------------...--------......------------.....
ENSTNIP00000012220  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......---V--------.....
ENSTNIP00000010401  ------------------......--------------------...--------......------------.....
ENSTNIP00000000963  ------------------......--------------------...--------......------------.....
ENSTNIP00000002265  ------------------......--------------------...--------......------------.....
ENSTNIP00000017783  ------------------......--------------------...--------......------------.....
ENSTNIP00000006767  ------------------......--------------------...--------......------------.....
ENSTNIP00000006766  ------------------......--------------------...--------......------------.....
ENSTNIP00000021085  ------------------......--------------------...--------......------------.....
ENSTNIP00000013222  ------------------......--------------------...--------......------------.....
ENSTNIP00000008163  ------------------......--------------------...--------......------------.....
ENSTNIP00000006767  ------------------......--------------------...--------......------------.....
ENSTNIP00000006766  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......---V--------.....
ENSTNIP00000008162  ------------------......--------------------...--------......------------.....
ENSTNIP00000008003  ------------------......--------------------...--------......------------.....
ENSTNIP00000009803  ------------------......--------------------...--------......------------.....
ENSTNIP00000008163  ------------------......----------------NASI...LVGTAKCH......VEQITNTT----.....
ENSTNIP00000010138  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......----------------NASI...LVGTAKCH......VEQITNTT----.....
ENSTNIP00000006346  ------------------......--------------------...--------......------------.....
ENSTNIP00000021085  ------------------......-------------VNNTHKC...V-------......------------.....
ENSTNIP00000002265  ------------------......--------------------...--------......------------.....
ENSTNIP00000017783  ------------------......--------------------...--------......------------.....
ENSTNIP00000008003  ------------------......--------------------...--------......------------.....
ENSTNIP00000021085  ------------------......--------------------...--------......-----TMQVEGI.....
ENSTNIP00000008163  -------R----------......--------------------...--------......------------.....
ENSTNIP00000019061  ------------------......--------------------...--------......------------.....
ENSTNIP00000008163  ------------------......--------------------...--------......------------.....
ENSTNIP00000007472  ------------------......--------------------...--------......------------.....
ENSTNIP00000009146  ------------------......--------------------...--------......------------.....
ENSTNIP00000008163  ------------------......--------------------...--------......------------.....
ENSTNIP00000002804  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  -------R----------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......------------.....
ENSTNIP00000007744  ------------------......--------------------...--------......------------.....
ENSTNIP00000008163  ------------------......--------------------...--------......------------.....
ENSTNIP00000007714  ---------------S--......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......------------.....
ENSTNIP00000008163  ------------------......--------------------...--------......------------.....
ENSTNIP00000010138  ------------------......--------------------...--------......------------.....
ENSTNIP00000019147  ------------------......--------------------...--------......------------.....
ENSTNIP00000019148  ------------------......--------------------...--------......------------.....
ENSTNIP00000018520  ------------------......--------------------...--------......------------.....
ENSTNIP00000020566  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......------------.....
ENSTNIP00000009105  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......------------.....
ENSTNIP00000005417  ------------------......--------------------...--------......--------W---.....
ENSTNIP00000004483  ------------------......--------------------...--------......------------.....
ENSTNIP00000001542  ------------------......--------------------...--------......------------.....
ENSTNIP00000018046  ------------------......--------------------...--------......------------.....
ENSTNIP00000010138  ------------------......--------------------...--------......------------.....
ENSTNIP00000002265  ------------------......--------------------...--------......------------.....
ENSTNIP00000017783  ------------------......--------------------...--------......------------.....
ENSTNIP00000006346  ------------------......--------------------...--------......------------.....
ENSTNIP00000008162  ------------------......--------------------...--------......------------.....
ENSTNIP00000006857  ------------------......--------------------...--------......------------.....
ENSTNIP00000019147  ------------------......--------------------...--------......------------.....
ENSTNIP00000019148  ------------------......--------------------...--------......------------.....
ENSTNIP00000006521  ------------------......--------------------...--------......------------.....
ENSTNIP00000019061  ------------------......--------------------...--------......------------.....
ENSTNIP00000004388  ------------------......--------------------...--------......------------.....
ENSTNIP00000016904  ------------------......--------------------...--------......------------.....
ENSTNIP00000022219  ------------------......--------------------...--------......------------.....
ENSTNIP00000002960  ------------------......--------------------...--------......------------.....
ENSTNIP00000010459  ---------TLDIRLKRAnk....VYREGEVVSGVIVMVCKEAV...QHHGIFLG......MEGLVSLQLSSKsvgvf
ENSTNIP00000008492  ---------------H--......--------------------...--------......------------.....
ENSTNIP00000011929  ------------------......--------------------...--------......------------.....
ENSTNIP00000010401  ------------------......--------------------...--------......------------.....
ENSTNIP00000000963  ------------------......--------------------...--------......------------.....


                                     80         90       100                                 110    
                                      |          |         |                                   |    
d1g4ma2               ........AQYKCPVAMEEA.DDTVAPSSTFCKVYTLTPFLAN....................NR......EKRGLAL
ENSTNIP00000015820  ylaseilwGHRFEPVLFEEK.NMYKVDYSHFHKTYEV------....................--......-------
ENSTNIP00000014157  ........-----------K.DLFVANSQMFPSPPDLEKSLTR....................LQ......ERLMKKL
ENSTNIP00000001954  ........-----------K.DLFVANSQMFPSPPDLEKSLTR....................LQ......ERLMKKL
ENSTNIP00000014574  ylpseilwGHRFEPVIFEEK.SQ--------------------....................--......----YRI
ENSTNIP00000014544  ........------------.----------------------....................--......-------
ENSTNIP00000010486  ........------------.----------------------....................--......ERLLKKL
ENSTNIP00000013758  ylarevlwGHRFESVIYEDR.DSY-------------------....................--......-----KV
ENSTNIP00000012673  yvageilwGHRFEPVLFEEK.NYY-------------------....................--......-----KV
ENSTNIP00000022103  ........------------.----------------------....................--......-------
ENSTNIP00000010457  ........------------.----------------------....................--......-------
ENSTNIP00000017993  ........------------.----------------------....................--......-------
ENSTNIP00000006675  ........------------.---------------------N....................LQ......NRLLTKL
ENSTNIP00000002599  ........------------.---------------------N....................LQ......NRLLTKL
ENSTNIP00000007179  ylakeilwGHRFEPVVLEKA.DRFHVDYSRF------------....................--......-------
ENSTNIP00000019582  ........------------.----------------------....................--......-------
ENSTNIP00000009102  ........------------.----------------------....................--......-------
ENSTNIP00000017145  ........------------.----------------------....................--......-------
ENSTNIP00000009422  ........QARTSYVAEEI-.----------------------....................--......-------
ENSTNIP00000009249  ........------------.----------------------....................--......-------
ENSTNIP00000005244  ........------------.----------------------....................--......-------
ENSTNIP00000005246  ........------------.----------------------....................--......-------
ENSTNIP00000014127  ........------------.----------------------....................VQ......QRLLQKL
ENSTNIP00000006368  ........------------.----------------------....................--......-------
ENSTNIP00000009083  ........------------.----------------KPSLGA....................MH......ETLLKKA
ENSTNIP00000002561  ........------------.----------------KPSLGA....................MH......ETLLKKA
ENSTNIP00000001954  ........AQYKCTVAMEES.DDVVPPSSTFCKVFTVTPFLAN....................NR......DKRGLAL
ENSTNIP00000019946  ........------------.----------------------....................--......-----KI
ENSTNIP00000014157  ........AQYKCTVAMEES.DDVVPPSSTFCKVFTVTPFLAN....................NR......DKRGLAL
ENSTNIP00000010486  ........AQYKCPVAQLEA.DDQVSSSSTFCKVYTLTPTLDK....................NR......EKRGLAL
ENSTNIP00000010899  ........QCRSSYVA----.----------------------....................--......-------
ENSTNIP00000003800  ........------------.----------------------....................--......-------
ENSTNIP00000008976  ........------------.----------------------....................--......-------
ENSTNIP00000010244  ........------------.----------------------....................--......-------
ENSTNIP00000000824  ........GQRFQDVMKLHK.GRYKVDYSLF------------....................--......-------
ENSTNIP00000007048  ........------------.----------------------....................--......-------
ENSTNIP00000009940  ........------------.----------------------....................--......------L
ENSTNIP00000019946  ........DTYTKTVCLEEF.GETVNSNSTLEKSFQLTPLLSN....................NK......EKRGLSV
ENSTNIP00000005358  ........DSYIKCVAIEET.GDTVSPGASLQKTYSLLPLLAN....................NR......ERRGIAL
ENSTNIP00000014413  ........------------.----------------------....................--......-------
ENSTNIP00000019221  ........------------.----------------------....................--......-------
ENSTNIP00000022950  ........------------.----------------------....................--......-------
ENSTNIP00000005358  ........------------.----------------------....................--......-------
ENSTNIP00000002561  ........DKYTKTVLNKEF.GETVEPNGTYENTLSITPMLNE....................NK......EKRGLAL
ENSTNIP00000009083  ........DKYTKTVLNKEF.GETVEPNGTYENTLSITPMLNE....................NK......EKRGLAL
ENSTNIP00000006156  ........------------.----------------------....................--......-------
ENSTNIP00000004888  ........------------.----------------------....................--......-------
ENSTNIP00000014127  ........DKYVKSVAKEET.SDQVAPGTSLKKDYALYPLLAY....................NR......ERRGIAL
ENSTNIP00000020787  ........------------.----------------------....................--......-------
ENSTNIP00000002395  ........------------.----------------------....................--......-------
ENSTNIP00000013223  ........------------.----------------------....................--......-------
ENSTNIP00000005835  ........------------.----------------------....................--......-------
ENSTNIP00000009178  ........------------.----------------------....................--......-------
ENSTNIP00000010775  ........RAEHHTDLYHGD.ELIIRRGQTFQIEMELSRPFS-....................--......-------
ENSTNIP00000005251  ........------------.----------------------....................--......-------
ENSTNIP00000005249  ........------------.----------------------....................--......-------
ENSTNIP00000005250  ........------------.----------------------....................--......-------
ENSTNIP00000016350  ........------------.----------------------....................--......-------
ENSTNIP00000015973  ........------------.----------------------....................--......-------
ENSTNIP00000010563  ........------------.----------------------....................--......-------
ENSTNIP00000021888  ........------------.----------------------....................--......---A---
ENSTNIP00000021411  ........------------.----------------------....................A-......-------
ENSTNIP00000020537  ........--------CPIQ.PCQLHKGQSYSVNVTFNSLVES....................QK......SKAVVYG
ENSTNIP00000005012  ........------------.-------------V--------....................--......-------
ENSTNIP00000019109  ........------------.-------------V--------....................--......-------
ENSTNIP00000000464  ........------------.-------------V--------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000001789  ........-----TVFNYQT.SCMMVSVKTAKSEDYTLTPLSA....................NE......YTSCLCG
ENSTNIP00000002977  ........-----TVFNYQT.SCMMVSVKTAKSEDYTLTPLSA....................NE......YTSCLCG
ENSTNIP00000001513  ........-----TVFNYQT.SCMMVSVKTAKSEDYTLTPLSA....................NE......YTSCLCG
ENSTNIP00000017397  ........-----TVFNYQT.SCMMVSVKTAKSEDYTLTPLSA....................NE......YTSCLCG
ENSTNIP00000017377  ........------------.------------------L---....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000008895  ........-D----------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000006628  ........------------.----------------------....................--......-------
ENSTNIP00000008517  ........------------.----------------------....................--......-------
ENSTNIP00000017383  ........------------.----------------------....................--......-------
ENSTNIP00000008384  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------V-----....................--......-------
ENSTNIP00000007897  ........------------.T---------------------....................--......-------
ENSTNIP00000015072  ........------------.----------------------....................--......-------
ENSTNIP00000003494  ........------------.----------------------....................--......-------
ENSTNIP00000006950  ........------------.----------------------....................--......-------
ENSTNIP00000006734  ........------------.----------------------....................--......-----AF
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......------L
ENSTNIP00000003313  ........------------.----------------------....................--......------L
ENSTNIP00000002488  ........------------.----------------------....................--......------L
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000014961  ........NTDHRTDRYGDK.RLVVRRGQPFTLFFLLKPG---....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000012789  ........MKEVKQLVANLR.GESLSSGKTETWSGKM------....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------S-----------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........------------.---------G------------....................--......-------
ENSTNIP00000019109  ........------------.---------G------------....................--......-------
ENSTNIP00000009333  ........---T--------.----------------------....................--......-------
ENSTNIP00000013084  ........MKQKRAVVSTLC.GD--------------------....................--......-VVGAKC
ENSTNIP00000005012  ........------------.--Q-------------------....................--......-------
ENSTNIP00000000464  ........------------.--Q-------------------....................--......-------
ENSTNIP00000019109  ........------------.--Q-------------------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000016574  ........GKQIQQLVSNLR.GEPLPQGKSQSWEGKL------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------T-----------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000021564  ........------------.----------------------....................--......-------
ENSTNIP00000015432  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.------------T---------....................--......-------
ENSTNIP00000002488  ........------------.------------T---------....................--......-------
ENSTNIP00000007616  ........------------.------------T---------....................--......-------
ENSTNIP00000007616  ........------------.-V--------------------....................--......-------
ENSTNIP00000002488  ........------------.-V--------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000006675  ........AQYKCQVAHLEA.DDQISPSSTSCHIYTLTPLLRN....................NR......EKRGLAL
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000021437  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.---------GTYTITYIPLY--....................--......-------
ENSTNIP00000002488  ........------------.---------GTYTITYIPLY--....................--......-------
ENSTNIP00000003313  ........------------.---------GTYTITYIPLY--....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000014295  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000014296  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........RKPVKHTAMISW.GGVNIPDS--------------....................--......-------
ENSTNIP00000002488  ........RKPVKHTAMISW.GGVNIPDS--------------....................--......-------
ENSTNIP00000007616  ........RKPVKHTAMISW.GGVNIPDS--------------....................--......-------
ENSTNIP00000008895  ........GNYIINIK----.----------------------....................--......-------
ENSTNIP00000002599  ........AQYKCQVAHLEA.DDQISPSSTSCHIYTLTPLLRN....................NR......EKRGLAL
ENSTNIP00000005012  ........----C-------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........----C-------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.-----------Y----------....................--......-------
ENSTNIP00000005012  ........------------.-I--------------------....................--......-------
ENSTNIP00000008895  ........------------.------------------AGKA....................QP......EVHFTAA
ENSTNIP00000019109  ........------------.-I--------------------....................--......-------
ENSTNIP00000009333  ........------------.--------T-------------....................--......-------
ENSTNIP00000013288  ........------------.----------------------....................--......AIVDLPE
ENSTNIP00000005012  ........VKPIKHTIIITW.GEVNVPNS--------------....................--......-------
ENSTNIP00000000464  ........VKPIKHTIIITW.GEVNVPNS--------------....................--......-------
ENSTNIP00000019109  ........VKPIKHTIIITW.GEVNVPNS--------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.------N---------------....................--......-------
ENSTNIP00000005012  ........GNYNVNIKFAEK.H---------------------....................--......-------
ENSTNIP00000000464  ........GNYNVNIKFAEK.H---------------------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........GNYNVNIKFAEK.H---------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.------NDNDTFTVKYTPPGSG....................QY......TIMVLFA
ENSTNIP00000003313  ........------------.----------------------....................--......-V-----
ENSTNIP00000002488  ........------------.----------------------....................--......-V-----
ENSTNIP00000007616  ........------------.----------------------....................--......-V-----
ENSTNIP00000006011  ........SSWAMEEQYFNS.TLSV------------------....................-A......DKGTLAA
ENSTNIP00000013084  ...staytQNYSDEVEYLNR.RE------------VL--LQAD....................NG......EVSVLPA
ENSTNIP00000009333  ........-------M----.----------------------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000009872  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.------DKSRTYTVTYVPKVEG....................VH......KV-----
ENSTNIP00000005012  ........------------.------DKSRTYTVTYVPKVEG....................VH......KV-----
ENSTNIP00000019109  ........------------.------DKSRTYTVTYVPKVEG....................VH......KV-----
ENSTNIP00000000464  ........G-----------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.-----P----------------....................--......-------
ENSTNIP00000016574  ........NTTYTQNYTEEV.E-------YLHHYDTL--IGEE....................RDedcpdeNVTVLHT
ENSTNIP00000018364  ........------------.--EVYISGSFNNWSTKIPLNKS....................HNdfv...AILDLPE
ENSTNIP00000000464  ........--------I---.----------------------....................--......-------
ENSTNIP00000009333  ........------------.---V------------------....................--......-------
ENSTNIP00000003313  ........------------.E---------------------....................--......-------
ENSTNIP00000002488  ........------------.E---------------------....................--......-------
ENSTNIP00000007616  ........------------.E---------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........GNYIINIKFADQ.HVPA------------------....................--......-------
ENSTNIP00000002488  ........GNYIINIKFADQ.HVPA------------------....................--......-------
ENSTNIP00000007616  ........GNYIINIKFADQ.HVPA------------------....................--......-------
ENSTNIP00000018732  ........------------.E---------------------....................--......-------
ENSTNIP00000003313  ........-A----------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000008895  ........--------V---.----------------------....................--......-------
ENSTNIP00000001925  ........RRVHTKDLLKEV.GNPIPPSASEKVTRVI------....................--......-------
ENSTNIP00000001568  ........RRVHTKDLLKEV.GNPIPPSASEKVTRVI------....................--......-------
ENSTNIP00000014417  ........------------.--------SFNNWATKIPLNRS....................QNnfv...AIVDLPE
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.KVTANNDKNRTYSVFYTPRVTG....................MH......KVTVLFA
ENSTNIP00000002488  ........------------.KVTANNDKNRTYSVFYTPRVTG....................MH......KVTVLFA
ENSTNIP00000007616  ........------------.KVTANNDKNRTYSVFYTPRVTG....................MH......KVTVLFA
ENSTNIP00000005497  ........------------.----------------------....................--......-------
ENSTNIP00000012789  ........NTAYTQNYTEEV.EYLNHKDILIGHERDD---DNS....................EE......GLTTIHS
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........-----------N.----------------------....................--......-------
ENSTNIP00000019109  ........-----------N.----------------------....................--......-------
ENSTNIP00000009333  ........--------E---.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000006205  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........-----------T.----------------------....................--......-------
ENSTNIP00000002488  ........-----------T.----------------------....................--......-------
ENSTNIP00000003313  ........-----------T.----------------------....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.---N------------------....................--......-------
ENSTNIP00000005012  ........--R---------.----------------------....................--......-------
ENSTNIP00000000464  ........--R---------.----------------------....................--......-------
ENSTNIP00000019109  ........--R---------.----------------------....................--......-------
ENSTNIP00000003313  ........-------T----.----------------------....................--......-------
ENSTNIP00000002488  ........-------T----.----------------------....................--......-------
ENSTNIP00000007616  ........-------T----.----------------------....................--......-------
ENSTNIP00000001133  ........DTSWNVEEQYFN.ST-----------IS-----V-....................-A......DKGTLKQ
ENSTNIP00000012114  ........------------.----------------------....................--......-------
ENSTNIP00000002873  ........DTSWNVEEQYFN.ST-----------IS-----V-....................-A......DKGTLKQ
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........------------.---H------------------....................--......-------
ENSTNIP00000000464  ........------------.---H------------------....................--......-------
ENSTNIP00000019109  ........------------.---H------------------....................--......-------
ENSTNIP00000008895  ........------------.-D--------------------....................--......-------
ENSTNIP00000019406  ........------------.---------------W------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......--N----
ENSTNIP00000005012  ........------------.----------------------....................--......--N----
ENSTNIP00000002873  ........THDVRTIAEVEG.GV--------------------....................--......---VKPG
ENSTNIP00000019109  ........------------.----------------------....................--......--N----
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000001133  ........THDVRTIAEVEG.GV-----------------VK-....................--......-----LG
ENSTNIP00000007616  ........------------.-----------F----------....................--......-------
ENSTNIP00000003313  ........------------.-----------F----------....................--......-------
ENSTNIP00000002488  ........------------.-----------F----------....................--......-------
ENSTNIP00000005680  ........------------.----------------------....................--......-E-----
ENSTNIP00000005012  ........G-----------.----------------------....................--......-------
ENSTNIP00000019109  ........G-----------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000000464  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000005012  ........GARGVVDAKVHT.----------------------....................--......-------
ENSTNIP00000000464  ........GARGVVDAKVHT.----------------------....................--......-------
ENSTNIP00000019109  ........GARGVVDAKVHT.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000015515  ........------------.----------------------....................--......-------
ENSTNIP00000020196  ........------------.----------------------....................--......-------
ENSTNIP00000019366  ........---------A--.----------------------....................--......-------
ENSTNIP00000019239  ........------------.----------------------....................--......-------
ENSTNIP00000009911  ........------------.---------------------S....................--......-------
ENSTNIP00000018930  ........------------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.--------------------A-....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-----D-
ENSTNIP00000005679  ........------------.----------------------....................--......-E-----
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002618  ....taytQNYSDEVEYLNRrEV----------------LLQA....................DN......GEVSVLA
ENSTNIP00000012827  ........------------.----------------------....................--......-------
ENSTNIP00000004899  ....taytQNYSDEVEYLNRrEV------LLQAVKDQ--WVKS....................GDeit...ARSRSSA
ENSTNIP00000007675  ........KQRCRQEAEYLR.HEELLRLES------Q--PTDS....................DG......SVLLRPG
ENSTNIP00000001568  ........HGNTT-VVYHSK.EK------YFTFKNYFIRDKKA....................TG......DN-VVAP
ENSTNIP00000018500  .......qQQYQQNEKYYKI.KHYIL-------------KESR....................QD......GTEVIGK
ENSTNIP00000004388  ........------------.----------------------....................--......-----FN
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000003898  ........RLYSQT------.------------------LASV....................NG......HTISPHS
ENSTNIP00000000963  ........--------H---.----------------------....................--......-------
ENSTNIP00000010401  ........--------H---.----------------------....................--......-------
ENSTNIP00000006011  ........LFDLRTIAEVEGaGV--------------------....................--......----KAG
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000006954  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000007675  ........TKVFRQKLSSVR.GNHIISGM--------------....................--......-------
ENSTNIP00000005012  ........------------.---------------F------....................--......-------
ENSTNIP00000000464  ........------------.---------------F------....................--......-------
ENSTNIP00000006346  ........------------.----------------------....................--......-------
ENSTNIP00000019109  ........------------.---------------F------....................--......-------
ENSTNIP00000003898  ........GKNRRRRNYSARlDYFHIKSSILEDSSGMPPPRQFapelrfkslkgkysmfppaaAV......GGLRLQA
ENSTNIP00000005012  ........------------.----------------------....................N-......-------
ENSTNIP00000000464  ........------------.----------------------....................N-......-------
ENSTNIP00000003313  ........------------.----------------------....................--......-------
ENSTNIP00000002488  ........------------.----------------------....................--......-------
ENSTNIP00000007616  ........------------.----------------------....................--......-------
ENSTNIP00000008895  ........-----H------.----------------------....................--......-------
ENSTNIP00000018500  ........RTVHARNILKVM.AEAIEGGKKKAVTQL-------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000010401  ........------------.----------------------....................--......-------
ENSTNIP00000000963  ........------------.----------------------....................--......-------
ENSTNIP00000008895  ........------------.----------------------....................--......-------
ENSTNIP00000009333  ........------------.----------------------....................--......-------
ENSTNIP00000001925  ........V-----V-YHSK.EK------YFTFKNYF--IRDKkatdddaealittetg....EY......YSNVVAP
ENSTNIP00000019147  ........------------.----------------------....................--......-------
ENSTNIP00000019148  ........------------.----------------------....................--......-------
ENSTNIP00000003258  ........------------.----------------------....................--......-------
ENSTNIP00000011053  ........------------.----------------------....................--......-------
ENSTNIP00000007602  ........------------.----------------------....................--......-------
ENSTNIP00000008163  ........------ATDTEL.KC--------------------....................--......-------
ENSTNIP00000019109  ........------------.----------------------....................--......D------
ENSTNIP00000006767  ........-------QVAGV.RCSSVPSQYVSAERVV------....................--......-------
ENSTNIP00000006766  ........-------QVAGV.RCSSVPSQYVSAERVV------....................--......-------
ENSTNIP00000008162  ........------ATDTEL.KC--------------------....................--......-------
ENSTNIP00000019061  ........------------.----------------------....................--......-------
ENSTNIP00000007602  ........--L---------.----------------------....................--......-------
ENSTNIP00000012220  ........--L---------.----------------------....................--......-------
ENSTNIP00000008162  ........------------.----------------------....................--......-------
ENSTNIP00000010401  ........------------.----------------------....................--......-------
ENSTNIP00000000963  ........------------.----------------------....................--......-------
ENSTNIP00000002265  ........------------.-----S----------------....................--......-------
ENSTNIP00000017783  ........------------.-----S----------------....................--......-------
ENSTNIP00000006767  ........------------.----------------------....................--......-------
ENSTNIP00000006766  ........------------.----------------------....................--......-------
ENSTNIP00000021085  ........------------.----------------------....................--......-------
ENSTNIP00000013222  ........------------.----------------------....................--......-------
ENSTNIP00000008163  ........------------.H---------------------....................--......-------
ENSTNIP00000006767  ........------------.----------------------....................--......-------
ENSTNIP00000006766  ........------------.----------------------....................--......-------
ENSTNIP00000008162  ........------------.----------------------....................--......-------
ENSTNIP00000008162  ........------------.H---------------------....................--......-------
ENSTNIP00000008003  ........------------.----------------------....................--......-------
ENSTNIP00000009803  ........------------.----------------------....................--......-------
ENSTNIP00000008163  ........------------.----------------------....................--......-------
ENSTNIP00000010138  ........------------.---I------------------....................--......-------
ENSTNIP00000008162  ........------------.----------------------....................--......-------
ENSTNIP00000006346  ........------------.NCTVY-----------------....................--......-------
ENSTNIP00000021085  ........------------.----------------------....................--......-------
ENSTNIP00000002265  ........--------V---.----------------------....................--......-------
ENSTNIP00000017783  ........--------V---.----------------------....................--......-------
ENSTNIP00000008003  ........------------.----------------------....................--......-------
ENSTNIP00000021085  ........GRTTCGVISNNTiHCPSHPSSESQQ----------....................--......-------
ENSTNIP00000008163  ........------------.----------------------....................--......-------
ENSTNIP00000019061  ........------------.----------------------....................--......-------
ENSTNIP00000008163  ........-----R------.----------------------....................--......-------
ENSTNIP00000007472  ........------------.----------------------....................--......-------
ENSTNIP00000009146  ........------------.----------------------....................--......-------
ENSTNIP00000008163  ........------------.---------------------S....................--......-------
ENSTNIP00000002804  ........------------.----------------------....................--......-------
ENSTNIP00000008162  ........------------.----------------------....................--......-------
ENSTNIP00000008162  ........----N-------.----------------------....................--......-------
ENSTNIP00000007744  ........------------.----------------------....................--......-------
ENSTNIP00000008163  ........------------.----------------------....................--......-------
ENSTNIP00000007714  ........------------.----------------------....................--......-------
ENSTNIP00000008162  ........------------.---------------------S....................--......-------
ENSTNIP00000008163  ........------------.----------------------....................--......-------
ENSTNIP00000010138  ........------------.----------------------....................--......-------
ENSTNIP00000019147  ........------------.----------------------....................--......-------
ENSTNIP00000019148  ........------------.----------------------....................--......-------
ENSTNIP00000018520  ........------------.----------------------....................--......-------
ENSTNIP00000020566  ........------------.----------------------....................--......-------
ENSTNIP00000008162  ........------------.----------------------....................--......-------
ENSTNIP00000009105  ........------------.----------------------....................--......-------
ENSTNIP00000008162  ........------------.----------------------....................--......-------
ENSTNIP00000005417  ........------------.----------------------....................--......-------
ENSTNIP00000004483  ........------------.----------------------....................--......-------
ENSTNIP00000001542  ........------------.----------------------....................--......-------
ENSTNIP00000018046  ........------------.----------------------....................--......-------
ENSTNIP00000010138  ........------------.-C--------------------....................--......-------
ENSTNIP00000002265  ........------------.-T--------------------....................--......-------
ENSTNIP00000017783  ........------------.-T--------------------....................--......-------
ENSTNIP00000006346  ........------------.--Y-------------------....................--......-------
ENSTNIP00000008162  ........------------.----------------------....................--......-------
ENSTNIP00000006857  ........------------.----------------------....................--......-------
ENSTNIP00000019147  ........------------.-----Y----------------....................--......-------
ENSTNIP00000019148  ........------------.-----Y----------------....................--......-------
ENSTNIP00000006521  ........------------.----------------------....................--......-------
ENSTNIP00000019061  ........------------.----------------------....................--......-------
ENSTNIP00000004388  ........------------.----A-----------------....................--......-------
ENSTNIP00000016904  ........------------.----------------------....................--......-------
ENSTNIP00000022219  ........---S--------.----------------------....................--......-------
ENSTNIP00000002960  ........---S--------.----------------------....................--......-------
ENSTNIP00000010459  .....eafYNSVKPIQLISS.NIEVAKAGK-------------....................--......----VPP
ENSTNIP00000008492  ........------------.----------------------....................--......-------
ENSTNIP00000011929  ........------------.----------------------....................--......-------
ENSTNIP00000010401  ........------------.----------------------....................--......-------
ENSTNIP00000000963  ........------------.----------------------....................--......-------


                         120       130               140       150       160       170       180    
                           |         |                 |         |         |         |         |    
d1g4ma2               DGKLKHEDTNLASSTLLREGA........NREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEE
ENSTNIP00000015820  -----------PST-------........-------------------------------------------------
ENSTNIP00000014157  GEHAHPFTFKIPLNL---PCS........VTLQP--------------------------------------------
ENSTNIP00000001954  GEHAHPFTFKIPLNL---PCS........VTLQP--------------------------------------------
ENSTNIP00000014574  DYAFFHKTFEVPSTP---RC-........-------------------------------------------------
ENSTNIP00000014544  ---------------------........-------------------------------------------------
ENSTNIP00000010486  GQHAHPFYFTIPQNL---PCS........VTLQP--------------------------------------------
ENSTNIP00000013758  DYARFHKTYEVPSTP------........-------------------------------------------------
ENSTNIP00000012673  DYSRFDNTYEVPSTP---V--........-------------------------------------------------
ENSTNIP00000022103  ---------------------........-------------------------------------------------
ENSTNIP00000010457  ---------------------........-------------------------------------------------
ENSTNIP00000017993  ---------------------........-------------------------------------------------
ENSTNIP00000006675  GQNAYPFTFTIPQNL---PCSvtlqpgpqDSGKAC-GVDYELQAFC--------------------------------
ENSTNIP00000002599  GQNAYPFTFTIPQNL---PCSvtlqpgpqDSGKAC-GVDYELQAFC--------------------------------
ENSTNIP00000007179  -----HKTYEVPSTP------........-------------------------------------------------
ENSTNIP00000019582  ---------------------........-------------------------------------PLTICHVIDT--
ENSTNIP00000009102  ---------------------........-------------------------------------P-----------
ENSTNIP00000017145  ---------------------........--------VEYKIKISFRVNR----------------------------
ENSTNIP00000009422  ---------------------........-------------------------------------------------
ENSTNIP00000009249  ---------------------........-------------------------------------------------
ENSTNIP00000005244  ---------------------........-------------------------------------------------
ENSTNIP00000005246  ---------------------........-------------------------------------------------
ENSTNIP00000014127  GDNAFPFFFEFPDNL---PCS........VAL----------------------------------------------
ENSTNIP00000006368  ---------------------........---------------------------------------------N---
ENSTNIP00000009083  GDNAYPFTFEIPNNL---PCS........VSLQP--------------------------------------------
ENSTNIP00000002561  GDNAYPFTFEIPNNL---PCS........VSLQP--------------------------------------------
ENSTNIP00000001954  DGKLKHEDTNLASSTLLGEGA........SKEILGIIVSYKVKVKLVVSR--LLGDLTMSDVSIELPFTLMHPKPLNF
ENSTNIP00000019946  GEQGYAFSFQMPTDL---PCS........VSLQP--------------------------------------------
ENSTNIP00000014157  DGKLKHEDTNLASSTLLGEGA........SKEILGIIVSYKVKVKLVVSR--------GGDVSIELPFTLMHPKPLED
ENSTNIP00000010486  DGKLKHEDTNLASSTIVKDVT........NKEVLGILVSYRVKVKLVVSR--------GGDVSVELPFILMHPKPVEP
ENSTNIP00000010899  ---------------------........-------------------------------------------------
ENSTNIP00000003800  ---------------------........--------------------------------PFLILPLTFYHV-----
ENSTNIP00000008976  ---------------------........-----------------DQKNVSFQVDTSSDSPFLILPLTFYHLIDDNS
ENSTNIP00000010244  ---------------------........-----------------------------------IIPLTFYHVID---
ENSTNIP00000000824  ---------------------........-------------------------------------------------
ENSTNIP00000007048  ---------------------........-------------------------------------EFTVGNRPLNH-
ENSTNIP00000009940  EEWFFEFGFVIPNSTN-----........-------------------------------------------------
ENSTNIP00000019946  NGRLKDGDTHLASTTL--SQG........EKEMQGIIVSYKVKVNLMVSGGGLLGGLTGSDVTVELPLTLMSPKP---
ENSTNIP00000005358  DGKLKHEDTNLASSSMTKAGV........LKEVMGIMVSYRVTVKLVVAGMM-----GSSEVGLEVPFKLMHPKPDSV
ENSTNIP00000014413  GRLLKSFDFDFGFCI------........-------------------------------------------------
ENSTNIP00000019221  ---------------------........---------------------------------GATVEFTVGDLPIENF
ENSTNIP00000022950  ---------------------........----------------------------------ATVEFTVGDTPINNF
ENSTNIP00000005358  ----------V----------........-------------------------------------------------
ENSTNIP00000002561  DGRLKDEDTNLASTTMLRQGI........EKEVLGILVSYKIKINLIVAGGGLLGGLTASDVTVELPLMLMHPKP---
ENSTNIP00000009083  DGRLKDEDTNLASTTMLRQGI........EKEVLGILVSYKIKINLIVAGGGLLGGLTASDVTVELPLMLMHPKP---
ENSTNIP00000006156  ---------------------........-------------------------GTFSQADVHRQVAIVFRTPPYRHA
ENSTNIP00000004888  ---------------------........-------------------------------CPFLILPLTFYHVLD---
ENSTNIP00000014127  DGRLRHEDTNLASSSIVKQEV........LKEVQGMLVSYKLVVRMMACGTI-----GSSEVSLELPFRLMHPKPEPA
ENSTNIP00000020787  ---------------------........-----G-------------------------------------------
ENSTNIP00000002395  ---------------------........----------------------------GKDNLFFVCPLTLYHVIDKSS
ENSTNIP00000013223  ---------------------........----------------------------GKDNLFFVCPLTLYHVIDKSS
ENSTNIP00000005835  ---------------------........----------FQVKITFNRPY--------KPKDKFALEFVIGTNPDYNK
ENSTNIP00000009178  ---IFPLTFYHPPGP------........-------------------------------------------------
ENSTNIP00000010775  ---------------------........-------------------------------------------------
ENSTNIP00000005251  ---------------------........---------------------------FSPTDVHRQFAIVFKTPKYRDQ
ENSTNIP00000005249  ---------------------........---------------------------FSPTDVHRQFAIVFKTPKYRDQ
ENSTNIP00000005250  ---------------------........---------------------------FSPTDVHRQFAIVFKTPKYRDQ
ENSTNIP00000016350  ---------------------........-----------------------AFGDFSPTDVHKQYAIVFKTPPYHSA
ENSTNIP00000015973  ---------------------........-----------------------------W-------------------
ENSTNIP00000010563  ---------------------........------------------------------TDVHRQIAIVFKTPPY---
ENSTNIP00000021888  ---------------------........-------------------------------------------------
ENSTNIP00000021411  ---------------------........-------------------------------------------------
ENSTNIP00000020537  IVAGIPVHFNIPSDD------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000003313  --R------------------........-------------------------------------------------
ENSTNIP00000001789  NERKTLSWTMLPSVI------........-------------------------------------------------
ENSTNIP00000002977  NERKTLSWTMLPSVI------........-------------------------------------------------
ENSTNIP00000001513  NERKTLSWTMLPSVI------........-------------------------------------------------
ENSTNIP00000017397  NERKTLSWTMLPSVI------........-------------------------------------------------
ENSTNIP00000017377  ---------------------........-------------------------------------------------
ENSTNIP00000007616  --R------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000002488  -I-------------------........-------------------------------------------------
ENSTNIP00000006628  ---------------------........-----------------------------Q-------------------
ENSTNIP00000008517  ---------------------........-------------------------------------------------
ENSTNIP00000017383  ---------------------........--S----------------------------------------------
ENSTNIP00000008384  ---------------------........--S----------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000007897  ---------------------........-------------------------------------------------
ENSTNIP00000015072  ---------------------........-------------------------------------------------
ENSTNIP00000003494  ---------------------........-------------------------------------------------
ENSTNIP00000006950  ---------------------........-------------------------------------------------
ENSTNIP00000006734  NQHLHPLTITAATGPQ--PSE........TRG----------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000014961  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------P-----------
ENSTNIP00000012789  --------LKIPPVS---PSI........LD-CSIIRVEYSLMVYVDIPG--------AINLSLNLPLVIGTIPLHPF
ENSTNIP00000008895  ------------------V--........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000013084  RETWHGRAIKIPPVG---PSI........-LHCRIIKVEYMLKVCVDVPG--------TSKLFLELPLVIGTIPLHPF
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000016574  --------LKIPPVS---PSI........-LDCPIIRVEYALVVYVDVPG--------GLNLSVSLPLVIGTIPLN--
ENSTNIP00000009333  ---------------------........-------------------------------------------R-----
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000021564  ---------------------........--------------VPAYRDA--------SVCHAVKVNF----------
ENSTNIP00000015432  ---------------------........--------------VPAYRDA--------SVCHAVKVNF----------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000003313  -------------------PV........QQGPLGIGVTY------------------GGDHVPKSPFTVT-------
ENSTNIP00000002488  -------------------PV........QQGPLGIGVTY------------------GGDHVPKSPFTVT-------
ENSTNIP00000007616  -------------------PV........QQGPLGIGVTY------------------GGDHVPKSPFTVT-------
ENSTNIP00000006675  DGKLKHEDTNLASSTIIKEGA........SKEMMGILVSYRVKVKLVVSL----------------------------
ENSTNIP00000008895  ---------------------........--------------------D----------------------------
ENSTNIP00000021437  ---------------------........--------------------K----------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000014295  ---------------------........--------------------------------I----------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000014296  ---------------------........--------------------------------I----------------
ENSTNIP00000003313  -----P---------------........-------------------------------------------------
ENSTNIP00000002488  -----P---------------........-------------------------------------------------
ENSTNIP00000007616  -----P---------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000002599  DGKLKHEDTNLASSTIIKEGA........SKEMMGILVSYRVKVKLVVSL----------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000008895  GKGSVVQDFEIIDNH------........-------NYSYTVRYTAVQQG----------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000013288  GEHQYKF--------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........----------Y--------------------------------------
ENSTNIP00000000464  ---------------------........----------Y--------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........----------Y--------------------------------------
ENSTNIP00000008895  DQQIPIS--------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000006011  GEHCFPFQFVIPVAV---PTS........FEGPFG-KVSYRVKAVIDTPR-------FSKDYKAQKPFYLLNLLNLNE
ENSTNIP00000013084  GRHEFPFSFQLPEETL--VTS........FEGKHG-SIRYWVKVKLHRPR--------ATVKKIKKDFTVIEPIDINT
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000005012  --------------------P........FHGAHTITIKY--------------------------------------
ENSTNIP00000000464  --------------------P........FHGAHTITIKY--------------------------------------
ENSTNIP00000019109  --------------------P........FHGAHTITIKY--------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000009872  -------------------S-........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000016574  GLHEFAFNFNLPQMAL--ATS........FEGKHG-SVRYWVKAELHRPW--------LVPVRVKKEFIVFEHIDINM
ENSTNIP00000018364  GEHQYKF--------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........----------Y--------------------------------------
ENSTNIP00000005012  ---------------------........----------Y--------------------------------------
ENSTNIP00000000464  ---------------------........----------Y--------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000018732  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------Q-----------------------------------
ENSTNIP00000009333  ---------------------........---------------TIVVTF--------GGDPISKSPFTVG-------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000001925  ---------TIPQDI---EPS........IFNCSIIKAEHRLRVYLDVKY--------ASDPEIKFPIVILRAPTVSA
ENSTNIP00000001568  ---------TIPQDI---EPS........IFNCSIIKAEHRLRVYLDVKY--------ASDPEIKFPIVILRAPTVSA
ENSTNIP00000014417  GEHQYKFS-------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000003313  GQHI-----------------........-------------------------------------------------
ENSTNIP00000002488  GQHI-----------------........-------------------------------------------------
ENSTNIP00000007616  GQHI-----------------........-------------------------------------------------
ENSTNIP00000005497  ---------------------........-------------------------------------------------
ENSTNIP00000012789  GRHEYAFSLELPQTPL--ATS........FEGKHG-SVRYWVKAELHRPW--------LLPMKTKKEFTVFEHIDINT
ENSTNIP00000008895  ---------------------........-------N-----------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000006205  ---------------------........-------------------------------------PV----------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------K-----------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000001133  GKHVFPFKFLLPASC---PTS........FEGKYG-RIIYRVRAVIDTPR-------FVTDYSAEKPFYLLNLLNLNQ
ENSTNIP00000012114  ---------------------........-------------------------------------------------
ENSTNIP00000002873  GKHVFPFKFLLPASC---PTS........FEGKYG-RIIYRVRAVIDTPR-------FVTDYSAEKPFYLLNLLNLNQ
ENSTNIP00000008895  ------------------PNN........DKNRTY-SVVY--------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000019406  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000002873  KEVEWKEQIIVPPLP---QSS........LAGCELIKVEYYVKVRLK-----------FPDVLLTLPIHIGNVSL---
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000001133  KEVEWKEQIIVPPLP---QSS........LAGCELIKVEYYVKVRLK-----------FPDVLLTLPIHIGNVSL---
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000005680  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........---------------------------------------K---------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........--------V----------------------------------------
ENSTNIP00000003313  ---------------------........--------V----------------------------------------
ENSTNIP00000002488  ---------------------........--------V----------------------------------------
ENSTNIP00000009333  ---------------------........-EGVHAINVTY--------------------------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000002488  -------------------P-........-------------------------------------------------
ENSTNIP00000007616  -------------------P-........-------------------------------------------------
ENSTNIP00000003313  -------------------P-........-------------------------------------------------
ENSTNIP00000015515  ------------A--------........-------------------------------------------------
ENSTNIP00000020196  ---------------------........---------------------------------------------R---
ENSTNIP00000019366  ---------------------........-------------------------------------------------
ENSTNIP00000019239  ---------------------........---------------------------------------------R---
ENSTNIP00000009911  ---------------------........-------------------------------------------------
ENSTNIP00000018930  ---------------------........---------------------------------------------R---
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000005679  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002618  GRHEFPFSFQLPEETL--VTS........FEGKHG-SIRYWVKVKLHPRA---------TVKKIKKDFTVIEPIDINT
ENSTNIP00000012827  ---------------------........-------------------------------------------------
ENSTNIP00000004899  GRHEFPFSFQLPEETL--VTS........FEGKHG-SIRYWVKVKLHPRA---------TVKKIKKDFTVIEPIDINT
ENSTNIP00000007675  NKYEYSFGFELPQNGQL-VSS........YKGKFG-YVHYCVKAVMERPQ--------QPALECKKAFEVEEPLDVNT
ENSTNIP00000001568  GCHVYPFTFQIPYQIM--PPS........FKGADG-KIVYSLEARLSRSM--------RIDQ----------------
ENSTNIP00000018500  GRHVFPFSFQIPDRNI--PST........FKSSVG-KIVHKLKAELKQSL--------RLTKKARTHFTFVSKANLAL
ENSTNIP00000004388  DEHIPDSPFIVP---------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------QHI---------------
ENSTNIP00000003898  SEVHTELLLTIPSSA---PCS........ISNCSILEVQYVVEV----------------------------------
ENSTNIP00000000963  ---------------------........-------------------------------------------------
ENSTNIP00000010401  ---------------------........-------------------------------------------------
ENSTNIP00000006011  KHAEWREQIIVPPLP---QSA........LAGCSLIDIEYFIQVSLK-----------SPDAVVTLPIYIGNIPV---
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000006954  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000007675  CDAWQGKTIRVPKIK---PSM........-LSCNIIRVEYALMIYVHIPG--------SEKLILELPLVIGT------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000006346  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000003898  GTHVYPFTLQIPEGDF--PST........FRGIHG-TVTYNLTVTIDRPW--------H-------------------
ENSTNIP00000005012  ---------------------........-------------------------------------------------
ENSTNIP00000000464  ---------------------........-------------------------------------------------
ENSTNIP00000003313  ---------------------........-------------------------------------------------
ENSTNIP00000002488  ---------------------........-------------------------------------------------
ENSTNIP00000007616  ---------------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000018500  --------INLPMEL---PSS........IFNCSIIKLEYRLKAYLDNKC--------ARDPEVTIPIVVL-------
ENSTNIP00000009333  --HIKYNGTHIPESP------........-------------------------------------------------
ENSTNIP00000010401  -------T-------------........-------------------------------------------------
ENSTNIP00000000963  -------T-------------........-------------------------------------------------
ENSTNIP00000008895  ---------------------........-------------------------------------------------
ENSTNIP00000009333  ---------------------........-------------------------------------------------
ENSTNIP00000001925  GCHVYPFTFQIPYQIM--PPS........FKGADG-KIVYSLEARLSRSM--------RIDQ----------------
ENSTNIP00000019147  ---------------------........-------------------------------------------------
ENSTNIP00000019148  ---------------------........-------------------------------------------------
ENSTNIP00000003258  ---------------------........-------------------------------------------------
ENSTNIP00000011053  ---------------------........-------------------------------------------------
ENSTNIP00000007602  ---------------------........--------------------S----------------------------
ENSTNIP00000008163  ---------------------........-------------------------------------------------
ENSTNIP00000019109  ---------------------........-------------------------------------------------
ENSTNIP00000006767  ---CDMAEALLPHSP---GGP........VELCIG-------------------------------------------
ENSTNIP00000006766  ---CDMAEALLPHSP---GGP........VELCIG-------------------------------------------
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000019061  ---------------------........-------------------------------------------------
ENSTNIP00000007602  ---------------------........-------------------------------------------------
ENSTNIP00000012220  ---------------------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000010401  ---------------------........-------------------------------------------------
ENSTNIP00000000963  ---------------------........-------------------------------------------------
ENSTNIP00000002265  ---------------------........-------------------------------------------------
ENSTNIP00000017783  ---------------------........-------------------------------------------------
ENSTNIP00000006767  ---------------------........---K---------------------------------------------
ENSTNIP00000006766  ---------------------........---K---------------------------------------------
ENSTNIP00000021085  ---------------------........-------------------------------------------------
ENSTNIP00000013222  ---------------------........-----------------------------GFDTGDDRLFLVSPLIISHE
ENSTNIP00000008163  ---------------------........-------------------------------------------------
ENSTNIP00000006767  ---------------------........-------------------------------------------------
ENSTNIP00000006766  ---------------------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000008003  ---------------------........---------------------------------------TVAGVDCVHQ
ENSTNIP00000009803  ---------------------........-------------------------------------W-----------
ENSTNIP00000008163  ---------------------........-------------------------------------------------
ENSTNIP00000010138  ---------------------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000006346  ---------------------........-------------------------------------------------
ENSTNIP00000021085  ---------------------........-------------------------------------------------
ENSTNIP00000002265  ---------------------........-------------------------------------------------
ENSTNIP00000017783  ---------------------........-------------------------------------------------
ENSTNIP00000008003  ---------------------........--------------------------------SKEDISITVGGVPC---
ENSTNIP00000021085  ---------------------........-------------------------------------------------
ENSTNIP00000008163  ---------------------........-------------------------------------------------
ENSTNIP00000019061  ---------------------........----------------------------F--------------------
ENSTNIP00000008163  ---------------------........-------------------------------------------------
ENSTNIP00000007472  ---------------------........-------------------------------------------------
ENSTNIP00000009146  ---------------------........-------------------------------------------------
ENSTNIP00000008163  ---------------------........-------------------------------------------------
ENSTNIP00000002804  ---------------------........-----------------------------IRGEQTKVPLTVYNYLPTCA
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000007744  ---------------------........---------------------------------K---------------
ENSTNIP00000008163  ---------------------........-----IVSVNY--------------------------------------
ENSTNIP00000007714  ---------------------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........-------------------------------------------------
ENSTNIP00000008163  ---------------------........----------------------------------------V--------
ENSTNIP00000010138  ---------------------........-------------------------------------------------
ENSTNIP00000019147  ------ESFKVPLV-------........-------------------------------------------------
ENSTNIP00000019148  ------ESFKVPLV-------........-------------------------------------------------
ENSTNIP00000018520  ---------------------........------------------YSL--------IRGEQTKVPLTVYNYLPTCA
ENSTNIP00000020566  ------------V--------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........-----IVSVNY--------------------------------------
ENSTNIP00000009105  --------IHVP------PPL........DRQDGSFLVRYRL------------------------------------
ENSTNIP00000008162  ---------------------........----------------------------------------V--------
ENSTNIP00000005417  ---------------------........-------------------------------------------------
ENSTNIP00000004483  ---------------------........-------------------------------------------------
ENSTNIP00000001542  ---------------------........-------------------------------------------------
ENSTNIP00000018046  ---------------------........-------------------------------------------------
ENSTNIP00000010138  ---------------------........-------------------------------------------------
ENSTNIP00000002265  ---------------------........-------------------------------------------------
ENSTNIP00000017783  ---------------------........-------------------------------------------------
ENSTNIP00000006346  ---------------------........-------------------------------------------------
ENSTNIP00000008162  ---------------------........--------------------------------------F----------
ENSTNIP00000006857  ---------------------........---------------------------------------------C---
ENSTNIP00000019147  ---------------------........-------------------------------------------------
ENSTNIP00000019148  ---------------------........-------------------------------------------------
ENSTNIP00000006521  ---------------------........--------------------------------------------P----
ENSTNIP00000019061  ---------------------........-------------------------------------------------
ENSTNIP00000004388  ---------------------........-------------------------------------------------
ENSTNIP00000016904  --------------H------........-------------------------------------------------
ENSTNIP00000022219  ---------------------........-------------------------------------------------
ENSTNIP00000002960  ---------------------........-------------------------------------------------
ENSTNIP00000010459  GKTEIPFEFPLNTKS-----Nkvlyet..YHGVFV-NIQYTLRCDLKRPL-------LAKDLSKNCEFIVHC------
ENSTNIP00000008492  ---------------------........-------------------------------------------------
ENSTNIP00000011929  ---------------------........-------------------------------------------------
ENSTNIP00000010401  ---------------------........-----------T-------------------------------------
ENSTNIP00000000963  ---------------------........-----------T-------------------------------------


                            190       200               210                                         
                              |         |                 |                                         
d1g4ma2               PPHR...EVPEHETPVDTNLIELDTN........DDDIVFEDFAR.................................
ENSTNIP00000015820  ----...-------------------........-----------prcsakdm.........................
ENSTNIP00000014157  ----...-------------------........-----------gpedtgkacgvdfevkafcaenpeekihkrnsv
ENSTNIP00000001954  ----...-------------------........-----------gpedtgkacgvdfevkafcaenpeekihkrnsv
ENSTNIP00000014574  ----...-------------------........-----------sakdmeerk........................
ENSTNIP00000014544  ----...-------------------........-----------eivsglkyvqqtfrkgvkvdktdymvgsygprp
ENSTNIP00000010486  ----...-------------------........-----------gpedtgkacgvdfeirafcaksieekihkrnsv
ENSTNIP00000013758  ----...-------------------........-----------hlsakeldeag......................
ENSTNIP00000012673  ----...-------------------........-----------csarelaek........................
ENSTNIP00000022103  ----...-------------------........-----------qartsytedevlwghrflpvmsleegffrvdys
ENSTNIP00000010457  ----...-------------------........-----------gmtcqarssyvsseikwgyrftpvltledgfye
ENSTNIP00000017993  ----...-------------------........-----------qartsytedevlwghrflpvmsleegffrvdys
ENSTNIP00000006675  ----...-------------------........-----------aksadekihhrnsvhlvirkvqfap........
ENSTNIP00000002599  ----...-------------------........-----------aksadekihhrnsvhlvirkvqfap........
ENSTNIP00000007179  ----...-------------------........-----------lcsarelnq........................
ENSTNIP00000019582  ----...-------------------........-----------kspfydlsqrsmqteqfeivvilegivettgmt
ENSTNIP00000009102  ----...-------------------........-----------lvisheidthspfwdmsqaqlekedfeivvile
ENSTNIP00000017145  ----...-------------------........-----------eivsglkyvqqtyrkglridksdymvgsygprd
ENSTNIP00000009422  ----...-------------------........-----------lwgqrfvptvseeegayavdyskfgntvrvptp
ENSTNIP00000009249  ----...-------------------........-----------ittqartsyvseeilwghrfvpivteeegvysv
ENSTNIP00000005244  ----...-------------------........-----------ivilegvvettgitmqartsytpeeilwgrrfv
ENSTNIP00000005246  ----...-------------------........-----------ivilegvvettgitmqartsytpeeilwgrrfv
ENSTNIP00000014127  ----...-------------------........-----------qpgpsdvgkkcavefevkgfcgqnqddrqdkqs
ENSTNIP00000006368  ----...-------------------........-----------rsspfyelsadslphqdfelvvflegtaestss
ENSTNIP00000009083  ----...-------------------........-----------gpddkgkacgvdfevktylakeksnpdekiekk
ENSTNIP00000002561  ----...-------------------........-----------gpddkgkacgvdfevktylakeksnpdekiekk
ENSTNIP00000001954  HLLL...-------------------........-----------lsdddiifedfarqrltgvvdek..........
ENSTNIP00000019946  ----...-------------------........-----------gpndsgkacgvdfevkaylanaphnvdeviekk
ENSTNIP00000014157  VDADdp.NPAPGEAQTDRNLIEFDTNnfhllllsDDDIIFEDFARqrltgvvdek.......................
ENSTNIP00000010486  PASRpqsAVPEMDPPIDTNLIEFDTNsvsq....DDDFVFEDFARlrlkgvvddk.......................
ENSTNIP00000010899  ----...-------------------........-----------seilwghrfepvlferkecyqvrkae.......
ENSTNIP00000003800  ----...-------------------........-----------ldehsplaglnarnlrrhdfellvtlnatmest
ENSTNIP00000008976  P---...-------------------........-----------lrawaakdpelaefellvimsatieptsatcqv
ENSTNIP00000010244  ----...-------------------........-----------dssplrawaakgggwtdpeladfellvimsatv
ENSTNIP00000000824  ----...-------------------........-----------natvwvpvpllsakefgr...............
ENSTNIP00000007048  ----...-------------------........-----------frmierhyfrdhllksfdfdfgfcipnsrntce
ENSTNIP00000009940  ----...-------------------........-----------twqslieaapesqmmpanvltgnviietkfydd
ENSTNIP00000019946  ----...-------------------........-----------.................................
ENSTNIP00000005358  ----...-------------------........-----------reseveeevefqefkraylkgmmdde.......
ENSTNIP00000014413  ----...-------------------........-----------pnsrntcehiyefpqlpddlirqmvarpyetrs
ENSTNIP00000019221  ----...-------------------........-----------rmierhyfrerllksfdfefgfcmprskntceh
ENSTNIP00000022950  R---...-------------------........-----------mierhyfrdqllksfdfefgfcmpsskntcehi
ENSTNIP00000005358  ----...-------------------........-----------pqplqnsrstprarrrllrklgeeefpyfnrgf
ENSTNIP00000002561  ----...-------------------........-----------e................................
ENSTNIP00000009083  ----...-------------------........-----------e................................
ENSTNIP00000006156  HLS-...-------------------........-----------epvrvkmqlrrpsdrevsepvdfqylpaepdey
ENSTNIP00000004888  ----...-------------------........-----------ehsplaglnarnlrrhdfellvtlnatmestaa
ENSTNIP00000014127  ----...-------------------........-----------kdsesgdmvfeefkraylkgvv...........
ENSTNIP00000020787  ----...-------------------........-----------aavvkqegnrihlsvnssataavgryqltvett
ENSTNIP00000002395  PFFD...MAVDTLHKQ----------........-----------efelvvfldgtaestssscqvrtsfipqeimwg
ENSTNIP00000013223  PFFD...MAVDTLHKQ----------........-----------efelvvfldgtaestssscqvrtsfipqeimwg
ENSTNIP00000005835  GTYI...PIFPN--------------........-----------kdrksrwpgritntsdsvltigitplancivgk
ENSTNIP00000009178  ----...-------------------........-----------splyptlcegrnnhfelvvflsalregtgdicq
ENSTNIP00000010775  ----...-------------------........-----------tdadrlhldmktgplptvskgthatiplvdslk
ENSTNIP00000005251  ----...-------------------........-----------nlqkptsvfvqlkrksdnetsepkpftyhpqvi
ENSTNIP00000005249  ----...-------------------........-----------nlqkptsvfvqlkrksdnetsepkpftyhpqvi
ENSTNIP00000005250  ----...-------------------........-----------nlqkptsvfvqlkrksdnetsepkpftyhpqvi
ENSTNIP00000016350  E---...-------------------........-----------ierpvtvflqlkrkkagdssdpkqftyiphvqd
ENSTNIP00000015973  ----...-------------------........-----------vrqpvqvpvtlvrndgiiysttltftytp....
ENSTNIP00000010563  ----...-------------------........-----------qdqdiaeevevsvslrrisdqmesepigftylp
ENSTNIP00000021888  ----...-------------------........-----------vfglsaiinnscwsaavtsppgdtlalsicsap
ENSTNIP00000021411  ----...-------------------........-----------ppppgrawawklwelqaplppgaqeleivckav
ENSTNIP00000020537  ----...-------------------........-----------gcksgihcpilvqhsysyindlpvkseypaikl
ENSTNIP00000005012  ----...-------------------........-----------eyipftpgdydvnitygghpipgspfqvpvkdp
ENSTNIP00000019109  ----...-------------------........-----------eyipftpgdydvnitygghpipgspfqvpvkdp
ENSTNIP00000000464  ----...-------------------........-----------eyipftpgdydvnitygghpipgspfqvpvkdp
ENSTNIP00000007616  ----...-------------------........-----------vpyepgtynlnityggqpitgspfsvpvsdtvd
ENSTNIP00000003313  ----...-------------------........-----------vpyepgtynlnityggqpitgspfsvpvsdtvd
ENSTNIP00000002488  ----...-------------------........-----------yvpyepgtynlnityggqpitgspfsvpvsdtv
ENSTNIP00000003313  ----...-------------------........-----------dnhdgtylvsyvpdmtgrytilikyggdeipys
ENSTNIP00000001789  ----...-------------------........-----------gvvsvtvtaeavashascdneivsvpergrtdt
ENSTNIP00000002977  ----...-------------------........-----------gvvsvtvtaeavashascdneivsvpergrtdt
ENSTNIP00000001513  ----...-------------------........-----------gvvsvtvtaeavashascdneivsvpergrtdt
ENSTNIP00000017397  ----...-------------------........-----------gvvsvtvtaeavashascdneivsvpergrtdt
ENSTNIP00000017377  ----...-------------------........-----------sgdqyssclcggerktvswnlvasttgvvevsv
ENSTNIP00000007616  ----...-------------------........-----------dnhdgtylvsyvpdmtgrytilikyggdeipys
ENSTNIP00000008895  ----...-------------------........-----------gsctveyipfnsgeydvnitfgglpipgspfsv
ENSTNIP00000002488  ----...-------------------........-----------rdnhdgtylvsyvpdmtgrytilikyggdeipy
ENSTNIP00000006628  ----...-------------------........-----------wrvqdetvltlhspadaaighyrlsvsvmsagg
ENSTNIP00000008517  ----...-------------------........-----------qgsvvtvsvtpatdaivgryrvyvniltasgvi
ENSTNIP00000017383  ----...-------------------........-----------cdgcrytaclcgeesatftwivtpaalgipvkl
ENSTNIP00000008384  ----...-------------------........-----------cdgcrytaclcgeesatftwivtpaalgipvkl
ENSTNIP00000009333  ----...-------------------........-----------pfspglydinityggehipgspfrvpvtd....
ENSTNIP00000007897  ----...-------------------........-----------mfrsprsllcvvpdvsvfvdgwrcarqpvtvpl
ENSTNIP00000015072  -V--...-------------------........-----------tspvsvgifvmtnagrsneaqtftyvpdsvdns
ENSTNIP00000003494  -V--...-------------------........-----------tspvsvgifvmtnagrsneaqtftyvpdsvdns
ENSTNIP00000006950  ----...-------------------........-----------gpviaplfpqkreegwwvvigdpksnslisikr
ENSTNIP00000006734  ----...-------------------........-----------tlsrvripplpasrpakaawkmdldgsssasrg
ENSTNIP00000009333  D---...-------------------........-----------gkakqpsigdngdgtycvsyvpdrtgrytivik
ENSTNIP00000000464  ----...-----D-------------........-----------nrdgtytvsyvpdstgpytitikyggdeipysp
ENSTNIP00000007616  ----...-------------------........-----------gdgvygfeyyptspgtysititwggqhiprspi
ENSTNIP00000003313  ----...-------------------........-----------gdgvygfeyyptspgtysititwggqhiprspi
ENSTNIP00000002488  ----...-------------------........-----------gdgvygfeyyptspgtysititwggqhiprspi
ENSTNIP00000003313  ----...-------------------........-----------htvnyvptregpysinvlyddeeiprspykvkv
ENSTNIP00000002488  ----...-------------------........-----------htvnyvptregpysinvlyddeeiprspykvkv
ENSTNIP00000007616  ----...-------------------........-----------htvnyvptregpysinvlyddeeiprspykvkv
ENSTNIP00000014961  ----...-------------------........-----------stalkpsetsftvqtgplpqkksntkvsfglsg
ENSTNIP00000008895  ----...-------------------........-----------itvtdnndgthtanyspandgpytvcvkyadqe
ENSTNIP00000012789  G---...-------------------........-----------srtssvss.........................
ENSTNIP00000008895  ----...-------------------........-----------pdmtgrytitikyggdeipyspycihaiptgd.
ENSTNIP00000000464  ----...-------------------........-----------csvyylptepgeyainilfadqhipgspfkapv
ENSTNIP00000005012  ----...----------T--------........-----------ytvsyvpdstgpytitikyggdeipyspyriqs
ENSTNIP00000019109  ----...----------T--------........-----------ytvsyvpdstgpytitikyggdeipyspyriqs
ENSTNIP00000005012  ----...-------------------........-----------scsvyylptepgeyainilfadqhipgspfkap
ENSTNIP00000019109  ----...-------------------........-----------scsvyylptepgeyainilfadqhipgspfkap
ENSTNIP00000009333  ----...-------------------........-----------csvsylptepgeylvnilfedvpipgspfradi
ENSTNIP00000013084  GSRT...SSVSSQYSVNLEW------........-----------lrmaipeqpepp.....................
ENSTNIP00000005012  ----...-------------------........-----------dagnavynceyyplkpgkytvsitwgghpiprs
ENSTNIP00000000464  ----...-------------------........-----------dagnavynceyyplkpgkytvsitwgghpiprs
ENSTNIP00000019109  ----...-------------------........-----------dagnavynceyyplkpgkytvsitwgghpiprs
ENSTNIP00000005012  ----...-------------------........-----------hytpaqdgpytvavkyaeqevphspfkvmsqpg
ENSTNIP00000000464  ----...-------------------........-----------hytpaqdgpytvavkyaeqevphspfkvmsqpg
ENSTNIP00000019109  ----...-------------------........-----------hytpaqdgpytvavkyaeqevphspfkvmsqpg
ENSTNIP00000016574  ----...-------------------........-----------acasrtssis.......................
ENSTNIP00000009333  ----...-------------------........-----------kagvaplavdvtgpkglreavevtdggdgqhlv
ENSTNIP00000009333  ----...-------------------........-----------ysvaytpfenglhsvqvlyddtpvpkspfqvsv
ENSTNIP00000009333  ----...-------------------........-----------ywptepgeyavhvtcdnvdiehspfmalivpd.
ENSTNIP00000021564  ----...-------------------........-----------cvingkrkrsqpqhftftp..............
ENSTNIP00000015432  ----...-------------------........-----------cvingkrkrsqpqhftftp..............
ENSTNIP00000007616  ----...-------------------........-----------isdlgdgtysvaytpyeegphsvevcydgmpvp
ENSTNIP00000003313  ----...-------------------........-----------isdlgdgtysvaytpyeegphsvevcydgmpvp
ENSTNIP00000002488  ----...-------------------........-----------isdlgdgtysvaytpyeegphsvevcydgmpvp
ENSTNIP00000005012  ----...------N------------........-----------kdgtclvsylptapgdyniivkfdnkhipgspf
ENSTNIP00000000464  ----...------N------------........-----------kdgtclvsylptapgdyniivkfdnkhipgspf
ENSTNIP00000019109  ----...------N------------........-----------kdgtclvsylptapgdyniivkfdnkhipgspf
ENSTNIP00000003313  ----...-------------------........-----------vsylpvlpgdysilvkyndkhipgspfsaritg
ENSTNIP00000002488  ----...-------------------........-----------vsylpvlpgdysilvkyndkhipgspfsaritg
ENSTNIP00000007616  ----...-------------------........-----------vsylpvlpgdysilvkyndkhipgspfsaritg
ENSTNIP00000007616  ----...-------------------........-----------venedgtfdifytapqpgeyvicvrfggehipn
ENSTNIP00000002488  ----...-------------------........-----------venedgtfdifytapqpgeyvicvrfggehipn
ENSTNIP00000003313  ----...-------------------........-----------vaptldl..........................
ENSTNIP00000002488  ----...-------------------........-----------vaptldl..........................
ENSTNIP00000007616  ----...-------------------........-----------vaptldl..........................
ENSTNIP00000006675  ----...-------------------........-----------.................................
ENSTNIP00000008895  ----...-------------------........-----------ngdgscsvsylptepgeyainilfaeqhvpgsp
ENSTNIP00000021437  ----...-------------------........-----------tqanmlfvevppyrdrfishpakvnffvingkk
ENSTNIP00000007616  ----...-------------------........-----------pgsytltiryggqdvpnfparlnvepavdasgv
ENSTNIP00000002488  ----...-------------------........-----------pgsytltiryggqdvpnfparlnvepavdasgv
ENSTNIP00000003313  ----...-------------------........-----------pgsytltiryggqdvpnfparlnvepavdasgv
ENSTNIP00000008895  ----...-------------------........-----------scdvrywptepgdyavhvicddedikdspfmah
ENSTNIP00000014295  ----...-------------------........-----------vvevppyhsktvasavqvqfyvcngkrkrsqsq
ENSTNIP00000005012  ----...-------------------........-----------esyltdkgdgtyrveytafedgihlievlyddv
ENSTNIP00000000464  ----...-------------------........-----------esyltdkgdgtyrveytafedgihlievlyddv
ENSTNIP00000019109  ----...-------------------........-----------esyltdkgdgtyrveytafedgihlievlyddv
ENSTNIP00000014296  ----...-------------------........-----------vvevppyhsktvasavqvqfyvcngkrkrsqsq
ENSTNIP00000003313  ----...-------------------........-----------frmnigagchpnkvkvsgpgv............
ENSTNIP00000002488  ----...-------------------........-----------frmnigagchpnkvkvsgpgv............
ENSTNIP00000007616  ----...-------------------........-----------frmnigagchpnkvkvsgpgv............
ENSTNIP00000008895  ----...-------------------........-----------fadqhvpgspftvkvfgeg..............
ENSTNIP00000002599  ----...-------------------........-----------.................................
ENSTNIP00000005012  ----...-------------------........-----------dvhywptepgdyavhvicddedikdspfiahil
ENSTNIP00000008895  ----...-----P-------------........-----------skaeiackdnkdgtctvsylptacgdynivvkf
ENSTNIP00000019109  ----...-------------------........-----------dvhywptepgdyavhvicddedikdspfiahil
ENSTNIP00000008895  ----...-------------------........-----------sityiplfqglytitikyggcavpnfpsrllvd
ENSTNIP00000005012  ----...-------------------........-----------ikndndtftvkytppapgrytimvlfaeqeipi
ENSTNIP00000008895  ----...-------------------........-----------nmsiavchggdpipkspfhimvapll.......
ENSTNIP00000019109  ----...-------------------........-----------ikndndtftvkytppapgrytimvlfaeqeipi
ENSTNIP00000009333  ----...-------------------........-----------fdifytapapgnyviyvrfggeniphspfnvva
ENSTNIP00000013288  ----...-------------------........-----------yvdgqwthdpaepvvtnqmgtvnniiqvk....
ENSTNIP00000005012  ----...-------------------........-----------pfrvlvgegsh......................
ENSTNIP00000000464  ----...-------------------........-----------pfrvlvgegsh......................
ENSTNIP00000019109  ----...-------------------........-----------pfrvlvgegsh......................
ENSTNIP00000009333  ----...-------------------........-----------epgdyeisvkfneqhipdspflvpvaap.....
ENSTNIP00000009333  ----...-------------------........-----------psspgkysvsiswggtqipkspfevavgeea..
ENSTNIP00000000464  ----...-------------------........-----------dtftvkytppapgrytimvlfaeqeipispfkv
ENSTNIP00000005012  ----...-------------------........-----------ipgspftvkvtgeg...................
ENSTNIP00000000464  ----...-------------------........-----------ipgspftvkvtgeg...................
ENSTNIP00000005012  ----...-------------------........-----------tvkytalqqgnmsisvthggdpipkspfhitva
ENSTNIP00000000464  ----...-------------------........-----------tvkytalqqgnmsisvthggdpipkspfhitva
ENSTNIP00000019109  ----...-------------------........-----------ipgspftvkvtgeg...................
ENSTNIP00000019109  ----...-------------------........-----------tvkytalqqgnmsisvthggdpipkspfhitva
ENSTNIP00000008895  ----...-------------------........-----------pfrikvepsh.......................
ENSTNIP00000003313  ----...-------------------........-----------sirfndehipdspfivpvasps...........
ENSTNIP00000002488  ----...-------------------........-----------sirfndehipdspfivpvasps...........
ENSTNIP00000007616  ----...-------------------........-----------sirfndehipdspfivpvasps...........
ENSTNIP00000006011  VPDI...EHPNY--------------........-----------avi..............................
ENSTNIP00000013084  PAL-...-------------------........-----------lap..............................
ENSTNIP00000009333  ----...-------------------........-----------medkgdgvyrctyrptqagthgvtvtfggvgip
ENSTNIP00000005012  ----...-------------------........-----------gghmiphfpkvlqvdpsvdtsgvhvygpgve..
ENSTNIP00000000464  ----...-------------------........-----------gghmiphfpkvlqvdpsvdtsgvhvygpgve..
ENSTNIP00000019109  ----...-------------------........-----------gghmiphfpkvlqvdpsvdtsgvhvygpgve..
ENSTNIP00000008895  ----...-------------------........-----------yvptkaikhtiiitwagvtvpnspfrvmvgegs
ENSTNIP00000009333  ----...-------------------........-----------sycptepgnyfvsirfaeehipgspftvhvtge
ENSTNIP00000009872  ----...-------------------........-----------tfcysfkpssarwqayfkpegldlhrpsiwifs
ENSTNIP00000000464  ----...-------------------........-----------kvlfagqdidkspytvnvak.............
ENSTNIP00000005012  ----...-------------------........-----------kvlfagqdidkspytvnvak.............
ENSTNIP00000019109  ----...-------------------........-----------kvlfagqdidkspytvnvak.............
ENSTNIP00000000464  ----...-------------------........-----------meldmdvvenhdgtfdiyytapepgkyvitirf
ENSTNIP00000009333  ----...-------------------........-----------nandtftvkyippaagkmtvkvlftdkevpqsp
ENSTNIP00000016574  PLLLa..PQTGTKEKTLCCWFC----........-----------.................................
ENSTNIP00000018364  ----...-------------------........-----------fvdgqwvhdiseptvtselgtinnliqvk....
ENSTNIP00000000464  ----...-------------------........-----------lenkgesvfrctyrpvlegphtihvlfaeqeip
ENSTNIP00000009333  ----...-------------------........-----------sylptlpgdysiivkynqdhipgspftaritg.
ENSTNIP00000003313  ----...-------------------........-----------dkgnnsyrctykptqegqhiisvtfaggqisrs
ENSTNIP00000002488  ----...-------------------........-----------dkgnnsyrctykptqegqhiisvtfaggqisrs
ENSTNIP00000007616  ----...-------------------........-----------dkgnnsyrctykptqegqhiisvtfaggqisrs
ENSTNIP00000019109  ----...-------------------........-----------ivkepgdyevsikfnnehipdspfivpia....
ENSTNIP00000005012  ----...-------------------........-----------ivkepgdyevsikfnnehipdspfivpia....
ENSTNIP00000000464  ----...-------------------........-----------ivkepgdyevsikfnnehipdspfivpia....
ENSTNIP00000003313  ----...-------------------........-----------gsaftvkvtgeg.....................
ENSTNIP00000002488  ----...-------------------........-----------gsaftvkvtgeg.....................
ENSTNIP00000007616  ----...-------------------........-----------gsaftvkvtgeg.....................
ENSTNIP00000018732  ----...-------------------........-----------ttvvdnsdgtysvsytpdqegaysvwvcvraqh
ENSTNIP00000003313  ----...-------------------........-----------eldvdvvenedgtfdifytapqpgeyvicvrfg
ENSTNIP00000008895  ----...-------------------........-----------gpgdyeisikfndehipdspftvpis.......
ENSTNIP00000009333  ----...-------------------........-----------vaapld...........................
ENSTNIP00000003313  ----...-------------------........-----------dvrywptepgeyavhvlcnnediqhspfmaeiv
ENSTNIP00000002488  ----...-------------------........-----------dvrywptepgeyavhvlcnnediqhspfmaeiv
ENSTNIP00000007616  ----...-------------------........-----------dvrywptepgeyavhvlcnnediqhspfmaeiv
ENSTNIP00000008895  ----...-------------------........-----------vemgndmfecsyypvsrgkyvvtiswgghnip.
ENSTNIP00000001925  APPF...PTASAPYPAAAFG------........-----------fgntalpqpppappnpfd...............
ENSTNIP00000001568  APPF...PTASAPYPAAAFG------........-----------fgntalpqpppappnp.................
ENSTNIP00000014417  ----...-------------------........-----------vdghwmldpngavatsrtgvvnntiqvkrtdfe
ENSTNIP00000008895  ----...-------------------........-----------gaeldvdvvenadgtfdvyytapepgkyvitir
ENSTNIP00000000464  ----...-------------------........-----------ywptepgdyavhvicddedikdspfiahilpaa
ENSTNIP00000009333  ----...-------------------........-----------hytpmapgnylisvkyggpyhvsgspfkakvtg
ENSTNIP00000003313  ----...-------------------........-----------skspfevei........................
ENSTNIP00000002488  ----...-------------------........-----------skspfevei........................
ENSTNIP00000007616  ----...-------------------........-----------skspfevei........................
ENSTNIP00000005497  ----...--R----------------........-----------lstrvhvnfyvcngkkkrsqhqhftfvp.....
ENSTNIP00000012789  ----...-------------------........-----------pll..............................
ENSTNIP00000008895  ----...-------------------........-----------vtytvkeqgsyilivkwgddnvpgspfhvtv..
ENSTNIP00000005012  ----...-------------------........-----------kgesvfrctyrpvlegphtihvlfaeqeipksp
ENSTNIP00000019109  ----...-------------------........-----------kgesvfrctyrpvlegphtihvlfaeqeipksp
ENSTNIP00000009333  ----...-------------------........-----------leqdkyairfiprenglhtidvkfngshipgsp
ENSTNIP00000009333  ----...-------------------........-----------tgkgdglysccytpaapikhtlaltwggvsipk
ENSTNIP00000006205  ----...-------------------........-----------svslyvsngkrkrssthcfkflps.........
ENSTNIP00000009333  ----...-------------------........-----------gvqaktevldnqdgtqtvtyvplssgmytlllr
ENSTNIP00000007616  ----...-------------------........-----------ytpmapgsylisikyggpyhivgspfkaris..
ENSTNIP00000002488  ----...-------------------........-----------ytpmapgsylisikyggpyhivgspfkaris..
ENSTNIP00000003313  ----...-------------------........-----------ytpmapgsylisikyggpyhivgspfkaris..
ENSTNIP00000008895  ----...-------------------........-----------vsytptapgnylisikyggpqhivgspfkakvt
ENSTNIP00000009333  ----...-------------------........-----------egkkthsvsyvpqvtgphrvtvlfagqqipksp
ENSTNIP00000005012  ----...-------------------........-----------ecpegykitytpmapgnyliaikyggpqhivgs
ENSTNIP00000000464  ----...-------------------........-----------ecpegykitytpmapgnyliaikyggpqhivgs
ENSTNIP00000019109  ----...-------------------........-----------ecpegykitytpmapgnyliaikyggpqhivgs
ENSTNIP00000003313  ----...-------------------........-----------eidqdkyavrfiprenglylidvkfngshipgs
ENSTNIP00000002488  ----...-------------------........-----------eidqdkyavrfiprenglylidvkfngshipgs
ENSTNIP00000007616  ----...-------------------........-----------eidqdkyavrfiprenglylidvkfngshipgs
ENSTNIP00000001133  VPD-...-------------------........-----------i................................
ENSTNIP00000012114  ---E...-------------------........-----------vtdhqngsytvsylpkcegehlvsvlvcnrhiq
ENSTNIP00000002873  VPD-...-------------------........-----------i................................
ENSTNIP00000008895  ----...-------------------........-----------lpkvegfhqvkvlfagqdidrspfrvnvsk...
ENSTNIP00000009333  ----...-------------------........-----------khegnlrycvsyqlreagsyslvvkwgedhipg
ENSTNIP00000005012  ----...-------------------........-----------mgnklynvtyaikdkgsyqiivkwgddnvpgsp
ENSTNIP00000000464  ----...-------------------........-----------mgnklynvtyaikdkgsyqiivkwgddnvpgsp
ENSTNIP00000019109  ----...-------------------........-----------mgnklynvtyaikdkgsyqiivkwgddnvpgsp
ENSTNIP00000008895  ----...-------------------........-----------svfrctyipvleglhmvhvtfagqqiprspfaa
ENSTNIP00000019406  ----...-------------------........-----------qnkskgakktakskkkkltkkkttpapakskqa
ENSTNIP00000000464  ----...-------------------........-----------vkyrgqhvpgspfqftvgpmgeggahkvraggp
ENSTNIP00000005012  ----...-------------------........-----------vkyrgqhvpgspfqftvgpmgeggahkvraggp
ENSTNIP00000002873  ----...-------------------........-----------dkklqpsn.........................
ENSTNIP00000019109  ----...-------------------........-----------vkyrgqhvpgspfqftvgpmgeggahkvraggp
ENSTNIP00000008895  ----...-------------------........-----------sgattdayitdkgdgtyrveytphedglhliev
ENSTNIP00000001133  ----...-------------------........-----------dkklqpsn.........................
ENSTNIP00000007616  ----...-------------------........-----------tvkytppgagsytimvlfadqaipmtpirikvd
ENSTNIP00000003313  ----...-------------------........-----------tvkytppgagsytimvlfadqaipmtpirikvd
ENSTNIP00000002488  ----...-------------------........-----------tvkytppgagsytimvlfadqaipmtpirikvd
ENSTNIP00000005680  ----...-------------------........-----------lvdhnngtyefvyvipregdfslalrlydqhik
ENSTNIP00000005012  ----...-------------------........-----------meldmdvvenhdgtfdiyytapepgkyvitirf
ENSTNIP00000019109  ----...-------------------........-----------meldmdvvenhdgtfdiyytapepgkyvitirf
ENSTNIP00000008895  ----...-------------------........-----------ilspsrrpipcklesgvnnevytvtyippeega
ENSTNIP00000000464  ----...-------------------........-----------rpipcklesdkakgihsvkyippeeghykvdvs
ENSTNIP00000005012  ----...-------------------........-----------rpipcklesdkakgihsvkyippeeghykvdvs
ENSTNIP00000019109  ----...-------------------........-----------rpipcklesdkakgihsvkyippeeghykvdvs
ENSTNIP00000007616  ----...-------------------........-----------syqlkekgeyilvvkwgdehipgspyhitv...
ENSTNIP00000003313  ----...-------------------........-----------syqlkekgeyilvvkwgdehipgspyhitv...
ENSTNIP00000002488  ----...-------------------........-----------syqlkekgeyilvvkwgdehipgspyhitv...
ENSTNIP00000009333  ----...-------------------........-----------dghtvpgspfpvdaqlppdpskvkasgpglk..
ENSTNIP00000005012  ----...-------------------........-----------psgsseecyvteldsdknairfiprengvhsid
ENSTNIP00000000464  ----...-------------------........-----------psgsseecyvteldsdknairfiprengvhsid
ENSTNIP00000019109  ----...-------------------........-----------psgsseecyvteldsdknairfiprengvhsid
ENSTNIP00000002488  ----...-------------------........-----------tetgvhtvsvkyqgshvpgspfqftvgplgegg
ENSTNIP00000007616  ----...-------------------........-----------tetgvhtvsvkyqgshvpgspfqftvgplgegg
ENSTNIP00000003313  ----...-------------------........-----------tetgvhtvsvkyqgshvpgspfqftvgplgegg
ENSTNIP00000015515  ----...-------------------........-----------sliqpgvlrcycpahdtglvtlqvaisnqiisn
ENSTNIP00000020196  ----...-------------------........-----------hipgvvevtlsykskqfckgapgrfvyta....
ENSTNIP00000019366  ----...-------------------........-----------lraeilsadgtcteaevvdnkngtyevgytirs
ENSTNIP00000019239  ----...-------------------........-----------hipgvvevtlsykskqfckgtpgrfiyt.....
ENSTNIP00000009911  ----...-------------------........-----------sdgskgegeildnkngtyeylftapkegtfnls
ENSTNIP00000018930  ----...-------------------........-----------hipgvvevtlsykskqfckgapgrfiyt.....
ENSTNIP00000008895  ----...-------------------........-----------htvnvryrdqhvpgspfqftvgplgeggahkvr
ENSTNIP00000008895  ----...-------------------........-----------adqhairfiprenglhtidvrfngshipgspfk
ENSTNIP00000005679  ----...-------------------........-----------lvdhnngtyefvyvipregdflgvrlydqhikg
ENSTNIP00000002488  ----...-------------------........-----------gvpipgspfsptaysasd...............
ENSTNIP00000007616  ----...-------------------........-----------gvpipgspfsptaysasd...............
ENSTNIP00000003313  ----...-------------------........-----------gvpipgspfsptaysasd...............
ENSTNIP00000002618  PAL-...-------------------........-----------lap..............................
ENSTNIP00000012827  ----...-------------------........-----------sdnkngtyevgytlhsegeysfslmlygqpvrg
ENSTNIP00000004899  PAL-...-------------------........-----------lap..............................
ENSTNIP00000007675  PDL-...-------------------........-----------lsp..............................
ENSTNIP00000001568  ----...-------------------........-----------kdltk............................
ENSTNIP00000018500  L---...-------------------........-----------tlmep............................
ENSTNIP00000004388  ----...-------------------........-----------vaspsd...........................
ENSTNIP00000009333  ----...-------------------........-----------anspitimvvqsevgnasqvraygdgleq....
ENSTNIP00000003898  ----...-------------------........-----------.................................
ENSTNIP00000000963  ----...-------------------........-----------aslhgygnvsvsvsidkahlqkdlrfeyv....
ENSTNIP00000010401  ----...-------------------........-----------aslhgygnvsvsvsidkahlqkdlrfeyv....
ENSTNIP00000006011  ----...-------------------........-----------nlspsrttp........................
ENSTNIP00000003313  ----...------E------------........-----------epcllkmlrnghvgisfvpkeigehlvnikkng
ENSTNIP00000002488  ----...------E------------........-----------epcllkmlrnghvgisfvpkeigehlvnikkng
ENSTNIP00000006954  ----...-------------------........-----------saskivcrvgpakddkgeiivttksgglgtstv
ENSTNIP00000007616  ----...------E------------........-----------epcllkmlrnghvgisfvpkeigehlvnikkng
ENSTNIP00000007675  ----...-------------------........-----------aglgs............................
ENSTNIP00000005012  ----...-------------------........-----------tpkevgehevsvrkngvhvanspfkimvgq...
ENSTNIP00000000464  ----...-------------------........-----------tpkevgehevsvrkngvhvanspfkimvgq...
ENSTNIP00000006346  ----...-------------------........-----------llndatnyrvqeahvevcvkdcindyralsprp
ENSTNIP00000019109  ----...-------------------........-----------tpkevgehevsvrkngvhvanspfkimvgq...
ENSTNIP00000003898  ----...-------------------........-----------lsksfvtelmf......................
ENSTNIP00000005012  ----...-------------------........-----------kdgtitikyqpterglhemdikyegnqipgspl
ENSTNIP00000000464  ----...-------------------........-----------kdgtitikyqpterglhemdikyegnqipgspl
ENSTNIP00000003313  ----...-------------------........-----------kyegihipgsplqffvdyinsgnvsaygpgl..
ENSTNIP00000002488  ----...-------------------........-----------kyegihipgsplqffvdyinsgnvsaygpgl..
ENSTNIP00000007616  ----...-------------------........-----------kyegihipgsplqffvdyinsgnvsaygpgl..
ENSTNIP00000008895  ----...-------------------........-----------vvsvkktgkhvsnspfrimvgqseigdaskvkv
ENSTNIP00000018500  ----...-------------------........-----------p................................
ENSTNIP00000009333  ----...-------------------........-----------lqfyvnhanspsmtahgpgl.............
ENSTNIP00000010401  ----...-------------------........-----------lnlcqvlsptsmlcqapelpislarqqevlekp
ENSTNIP00000000963  ----...-------------------........-----------lnlcqvlsptsmlcqapelpislarqqevlekp
ENSTNIP00000008895  ----...-------------------........-----------taygpglth........................
ENSTNIP00000009333  ----...-------------------........-----------vhsvsvtadgehvpgspfqftvgplgeggaskv
ENSTNIP00000001925  ----...-------------------........-----------kdltk............................
ENSTNIP00000019147  -S--...-------------------........-----------lsptmltcktspyavpckqpvkltvdsverqap
ENSTNIP00000019148  -S--...-------------------........-----------lsptmltcktspyavpckqpvkltvdsverqap
ENSTNIP00000003258  ----...-------------------........-----------saskivcrvgpakddkgeiivttksgglgtstv
ENSTNIP00000011053  ----...-------------------........-----------saskivcrvgpakddkgeiivttksgglgtstv
ENSTNIP00000007602  ----...-------------------........-----------viaslyeissrivcrtkasggeksgqvsvkvsg
ENSTNIP00000008163  ----...-------------------........-----------rtpagtagsqtitvtvskmsqaasssfty....
ENSTNIP00000019109  ----...-------------------........-----------gtitikyqpterglhemdikyegnqipgsplqf
ENSTNIP00000006767  ----...-------------------........-----------vcsaefrtlssqtysfvs...............
ENSTNIP00000006766  ----...-------------------........-----------vcsaefrtlssqtysfvs...............
ENSTNIP00000008162  ----...-------------------........-----------rtpagtagsqtitvtvskmsqaasssfty....
ENSTNIP00000019061  ---Y...-------------------........-----------svstsivceigpinpssqhwgqvevevkgekrg
ENSTNIP00000007602  ----...-------------------........-----------kcvtgssnrtgqhgvtlhynsgqrhlhssayty
ENSTNIP00000012220  ----...-------------------........-----------kdtkvifqenvadekswkaeaeidmelfhq...
ENSTNIP00000008162  ----...-------------------........-----------tdtqvycktgnnpggtyrvmlyhkekghaqsdv
ENSTNIP00000010401  ----...-------------------........---------I-paeqivcemgkaeksqytgnvqvcvgvgecrpe
ENSTNIP00000000963  ----...-------------------........---------I-paeqivcemgkaeksqytgnvqvcvgvgecrpe
ENSTNIP00000002265  ----...-------------------........-----------ssiicrtaaaedvgsvpvtvlidsfqvtttktf
ENSTNIP00000017783  ----...-------------------........-----------ssiicrtaaaedvgsvpvtvlidsfqvtttktf
ENSTNIP00000006767  ----...-------------------........-----------yggvetsnfctlvndstmtclapglvynklapp
ENSTNIP00000006766  ----...-------------------........-----------yggvetsnfctlvndstmtclapglvynklapp
ENSTNIP00000021085  ----...-------T-----------........-----------vslelvcitgpsaddktdivqvdvdqsgtgtsk
ENSTNIP00000013222  INE-...-------------------........-----------kspfwemslaqmekeefeivvilegmveat...
ENSTNIP00000008163  ----...-------------------........-----------citpphvegqvrtdiwvlstqyppltfn.....
ENSTNIP00000006767  ----...-------------------........-----------icitpaslsgsgpasirlmidkaevtssetkyv
ENSTNIP00000006766  ----...-------------------........-----------icitpaslsgsgpasirlmidkaevtssetkyv
ENSTNIP00000008162  ----...-------------------........-----------thiicvtnaqrqsqetkvrvsikdqgvakmdna
ENSTNIP00000008162  ----...-------------------........-----------citpphvegqvrtdiwvlstqyppltfn.....
ENSTNIP00000008003  ED--...-------------------........-----------rysvstsvvceigpakrvppsdvpfepthagvv
ENSTNIP00000009803  ----...-------------------........-----------lqvldrkdgsflvryrmyatysdlhihvllkne
ENSTNIP00000008163  ----...-------------------........-----------qvcrlgsatagtypvtvsfpslghs........
ENSTNIP00000010138  ----...-------------------........-----------krvtqpkgnvssiiclsqhisevrdvplsvfid
ENSTNIP00000008162  ----...-------------------........-----------qvcrlgsatagtypvtvsfpslghs........
ENSTNIP00000006346  ----...-------------------........-----------nnsvmvclapsvadselgfsesgtdpdeigfyl
ENSTNIP00000021085  ----...-------------------........-----------itektdnviectmpaitqahadsvsvcvefenl
ENSTNIP00000002265  ----...-------------------........-----------gsttcavlpekssseklvckiqeknkpgqdlk.
ENSTNIP00000017783  ----...-------------------........-----------gsttcavlpekssseklvckiqeknkpgqdlk.
ENSTNIP00000008003  ----...-------------------........-----------pvlsfgdvitcttgryseq..............
ENSTNIP00000021085  ----...-------------------........-----------tavqfflngvlytd...................
ENSTNIP00000008163  ----...-------------------........-----------itcrtakqdpaskktvypggrglkieawndtrs
ENSTNIP00000019061  ----...-------------------........-----------gvnitcrtgeyraltpsrstvkygksttttipn
ENSTNIP00000008163  ----...-------------------........-----------vffgdaecevkdasenelqcilqteqkt.....
ENSTNIP00000007472  --R-...-------------------........-----------sppglsaalsvvcelqpsgkqregpvqvrvgaa
ENSTNIP00000009146  --R-...-------------------........-----------sppglsaalsvvcelqpsgkqregpvqvrvgaa
ENSTNIP00000008163  ----...-------------------........-----------ntelritnvndgnisarvdalpagdhpikvivr
ENSTNIP00000002804  EVSP...-------------------........-----------rtlgvvaskqgqrkkcvppgeatptsivfsvte
ENSTNIP00000008162  ----...-------------------........-----------itcrtakqdpaskktvypggrglkieawndtrs
ENSTNIP00000008162  ----...-------------------........-----------rvffgdaecevkdasenelqcilqteqk.....
ENSTNIP00000007744  ----...-------------------........-----------sqrrdgraqaprfpklkdegwflvlgevehrql
ENSTNIP00000008163  ----...-------------------........-----------tsvicdtspsqphggdvifqigniqsschsnc.
ENSTNIP00000007714  ----...-------------------........-----------rrtymlgsfvllfnpwlke..............
ENSTNIP00000008162  ----...-------------------........-----------ntelritnvndgnisarvdalpagdhpikvivr
ENSTNIP00000008163  ----...-------------------........-----------ggqpcevinstnadimcrlrydnrlpigvahav
ENSTNIP00000010138  ----...-------------------........-----------trecvgnssptrmecftpafprdeteegelsfd
ENSTNIP00000019147  ----...-------------------........-----------tvevagahckllrqdyinrwteiqcspmsagnf
ENSTNIP00000019148  ----...-------------------........-----------tvevagahckllrqdyinrwteiqcspmsagnf
ENSTNIP00000018520  EVHV...KV-----------------........-----------svpkgikfv........................
ENSTNIP00000020566  ----...-------------------........-----------tqevlqepesnvvkvaftvrkagryevavklgg
ENSTNIP00000008162  ----...-------------------........-----------tsvicdtspsqphggdvifqigniqsschsnc.
ENSTNIP00000009105  ----...-------------------........-----------ygtvqgglkvevhhqgvhvaespysl.......
ENSTNIP00000008162  ----...-------------------........-----------ggqpcevinstnadimcrlrydnrlpigvahav
ENSTNIP00000005417  ----...-------------------........-----------vepvevqrmtcrtprvtpdlkikgvwfqmdnvr
ENSTNIP00000004483  ----...------------------S........-----------ssgpdltfgglptpkleatyepvivkearyiai
ENSTNIP00000001542  ----...------------------S........-----------ssgpdltfgglptpkleatyepvivkearyiai
ENSTNIP00000018046  ----...------------------S........-----------ssgpdltfgglptpkleatyepvivkearyiai
ENSTNIP00000010138  ----...-------------------........-----------tvlpaksnnthlvckirirttelftpvnitv..
ENSTNIP00000002265  ----...-------------------........-----------nlhqlqrvcngstnathmecwapafpeempdek
ENSTNIP00000017783  ----...-------------------........-----------nlhqlqrvcngstnathmecwapafpeempdek
ENSTNIP00000006346  ----...-------------------........-----------lnagsyvsvrfaqrpcffkrkvk..........
ENSTNIP00000008162  ----...-------------------........-----------nngsqdtlsctvvvsnklktvnisngfty....
ENSTNIP00000006857  ----...-------------------........-----------vltlsetqlvcewpnltgehkvtvrvggfeysp
ENSTNIP00000019147  ----...-------------------........-----------gengtsihcttpslaklalqppvvtkvafvldg
ENSTNIP00000019148  ----...-------------------........-----------gengtsihcttpslaklalqppvvtkvafvldg
ENSTNIP00000006521  ----...-------------------........-----------cvltlsetqlvcewpnltgehkvtvrvggfeys
ENSTNIP00000019061  ----...----------P--------........-----------dyvahekndtviqfrsptvnsslnqhvrtyiql
ENSTNIP00000004388  ----...-------------------........-----------kgmidakvhspsgaleecciteid.........
ENSTNIP00000016904  ----...-------------------........-----------spelgagvagrvldhrngfysalfpllwvgpaq
ENSTNIP00000022219  ----...-------------------........-----------hpyskrdfgkweltlppkh..............
ENSTNIP00000002960  ----...-------------------........-----------hpyskrdfgkweltlppkh..............
ENSTNIP00000010459  ----...-------------------........-----------qpq..............................
ENSTNIP00000008492  ----...-------------------........-----------dsvlgagvagrvvdhlngsysalfslpwegsaq
ENSTNIP00000011929  ----...-------------------........-----------cvspllyrtglvsleisyngsaf..........
ENSTNIP00000010401  ----...-------------------........-----------vligekpcmltvsetqllcespnltgrhkvlvs
ENSTNIP00000000963  ----...-------------------........-----------vligekpcmltvsetqllcespnltgrhkvlvs


                                                                                                    
                                                                                                    
d1g4ma2               ..............................................................................
ENSTNIP00000015820  ..............................................................................
ENSTNIP00000014157  rlvirkvqyap...................................................................
ENSTNIP00000001954  rlvirkvqyap...................................................................
ENSTNIP00000014574  ..............................................................................
ENSTNIP00000014544  aeeydylttaeeapkgmlargtynikskftdddkhdhlswewsltikkdwkd..........................
ENSTNIP00000010486  rlvirkvqyap...................................................................
ENSTNIP00000013758  ..............................................................................
ENSTNIP00000012673  ..............................................................................
ENSTNIP00000022103  qfhntfevptppysvkeqeeks........................................................
ENSTNIP00000010457  vdynsfhdvyetntppysakeladi.....................................................
ENSTNIP00000017993  qfhstfevptpphsvkehaekn........................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000007179  ..............................................................................
ENSTNIP00000019582  cqartsytedevlwghrffpvisleegffkvdysqfhatfevptppysvkeqee........................
ENSTNIP00000009102  gmveatagmtcqarssylaeevlwghrfspmmslaegffdvdygafhhtfevdtpscsarelsl..............
ENSTNIP00000017145  ceydfvtsmeeaptglmargqyaikskftdddkhdhlswewnlnikkdwt............................
ENSTNIP00000009422  lcsarkldeag...................................................................
ENSTNIP00000009249  dyskfgntvkvntplcsareldekp.....................................................
ENSTNIP00000005244  siiseedgrycvdyskfgntvpvrmpllsakeldqs..........................................
ENSTNIP00000005246  siiseedgrycvdyskfgntvpvrmpllsakeldqs..........................................
ENSTNIP00000014127  svrlsirkvqfsp.................................................................
ENSTNIP00000006368  acqvrtsyipqeiqwgytflpiisciqtgkyrvdfsnfsksvrvstphcvhcceadsdq...................
ENSTNIP00000009083  dtarliirkiqyap................................................................
ENSTNIP00000002561  dtarliirkiqyap................................................................
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000019946  dtcrlmirkiqfap................................................................
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000010899  ..............................................................................
ENSTNIP00000003800  aatcqsrtsyipqeilfgyefrpvlfsttggryvadfnffdkv...................................
ENSTNIP00000008976  rtsylpdeilwgyefppvvslsssgkyvanftffdkvskaktmpi.................................
ENSTNIP00000010244  eptsatcqvrtsylpdeilwgyefppvvslspsgkyvadfaffdkvaktktpplfkqtl...................
ENSTNIP00000000824  ..............................................................................
ENSTNIP00000007048  hiyefpqlseslvrqmvecpyetrsdsfyfadnrlvmhnkadyay.................................
ENSTNIP00000009940  dlhvstsrvrlfyv................................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000014413  dsfyfvdnklimhnkadyaf..........................................................
ENSTNIP00000019221  iyefpplsedsiqemilhpyetqsdsfyfvdnklvmhnkadysy..................................
ENSTNIP00000022950  yefpalseeimhemilhpyetqsdsfyfvdnklvmhnkadysy...................................
ENSTNIP00000005358  rtltcasgewlwqpaphdvgndrcavefeikafsaesqdakvrkrstvklmirkvqfap...................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000006156  rltekrkrtgdvfqslkl............................................................
ENSTNIP00000004888  tcqsrtsyipqeilfgyefrpvlfsttggryvadfnffdkv.....................................
ENSTNIP00000014127  ..............................................................................
ENSTNIP00000020787  ctgghavsthhpdndvyilfnpwcee....................................................
ENSTNIP00000002395  ynflpiisrskegryrvdfsnfskvvpvatahcaycfhnikghhh.................................
ENSTNIP00000013223  ynflpiisrskegryrvdfsnfskvvpvatahcaycfhnikghhh.................................
ENSTNIP00000005835  yhmyvavmtpfgirrtkkestrdlyilfnpwsp.............................................
ENSTNIP00000009178  krtsylrqeiqfdrrflpalvldeqgryltklqhfd..........................................
ENSTNIP00000010775  gkrweakiveqsgnkvklsvnspasavcgqyrltvtcgsaegeattthdcsknivmlfnpwcee..............
ENSTNIP00000005251  gsdkeevqrkrqktlpnfhdflhrg.....................................................
ENSTNIP00000005249  gsdkeevqrkrqktlpnfhdflhrg.....................................................
ENSTNIP00000005250  gsdkeevqrkrqktlpnfhdfhhrg.....................................................
ENSTNIP00000016350  keevlrkkqkplphyepwfgg.........................................................
ENSTNIP00000015973  ..............................................................................
ENSTNIP00000010563  hnpdpyevkrkrkqtappwqsspstsqt..................................................
ENSTNIP00000021888  dapigrysltlgqltriefillfnpwcp..................................................
ENSTNIP00000021411  dssynvqpdsvlpiwnlrgvlsnawhrvrvkv..............................................
ENSTNIP00000020537  vvkwellddnqkdlfcikfpvqiv......................................................
ENSTNIP00000005012  vd............................................................................
ENSTNIP00000019109  vd............................................................................
ENSTNIP00000000464  v.............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  pyriralptgd...................................................................
ENSTNIP00000001789  vtrslivk......................................................................
ENSTNIP00000002977  vtrslivk......................................................................
ENSTNIP00000001513  vtrslivk......................................................................
ENSTNIP00000017397  vtrslivk......................................................................
ENSTNIP00000017377  taaavasevscnneivtvpmrgrvdkvtrtlivk............................................
ENSTNIP00000007616  pyriralpt.....................................................................
ENSTNIP00000008895  pvr...........................................................................
ENSTNIP00000002488  spyriralp.....................................................................
ENSTNIP00000006628  nvvelvekvqfhllfnpwckd.........................................................
ENSTNIP00000008517  rspknsntdlyllfnawcpd..........................................................
ENSTNIP00000017383  kvsaealktdvlcgnevatvpktgqidtvvrtllve..........................................
ENSTNIP00000008384  kvsaealktdvlcgnevatvpktgqidtvvrtllve..........................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007897  sliradgliyrssfsftytp..........................................................
ENSTNIP00000015072  esqavkteepsllepcifdgqpksiss...................................................
ENSTNIP00000003494  esqavkteepsllepcifdgqpksiss...................................................
ENSTNIP00000006950  ltlqqkakvkldfvapamgihnytlyfmsdaymgcdqeykfsvdvke...............................
ENSTNIP00000006734  vvplavtppadapvgeysltaafreescllgrltllfnpwcpd...................................
ENSTNIP00000009333  yggddipaspyrvrava.............................................................
ENSTNIP00000000464  yriqs.........................................................................
ENSTNIP00000007616  evkispe.......................................................................
ENSTNIP00000003313  evkispe.......................................................................
ENSTNIP00000002488  evkispe.......................................................................
ENSTNIP00000003313  lpthdaskvrasgpgln.............................................................
ENSTNIP00000002488  lpthdaskvrasgpgln.............................................................
ENSTNIP00000007616  lpthdaskvrasgpgln.............................................................
ENSTNIP00000014961  stpdtewrasatdgpsektvcvsitsaptapvglyalsvklegqktklgefvllfnawc...................
ENSTNIP00000008895  vpcspfkiktlpa.................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  r.............................................................................
ENSTNIP00000005012  lptgd.........................................................................
ENSTNIP00000019109  lptgd.........................................................................
ENSTNIP00000005012  v.............................................................................
ENSTNIP00000019109  v.............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000005012  pfevevggea....................................................................
ENSTNIP00000000464  pfevevggea....................................................................
ENSTNIP00000019109  pfevevggea....................................................................
ENSTNIP00000005012  hdaskvrasgpgl.................................................................
ENSTNIP00000000464  hdaskvrasgpgl.................................................................
ENSTNIP00000019109  hdaskvrasgpgl.................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000009333  sytptvegpyavavkyaeedvprspfrfrvlpth............................................
ENSTNIP00000009333  regcd.........................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000021564  ..............................................................................
ENSTNIP00000015432  ..............................................................................
ENSTNIP00000007616  kspfhvavtegcn.................................................................
ENSTNIP00000003313  kspfhvavtegcn.................................................................
ENSTNIP00000002488  kspfhvavtegcn.................................................................
ENSTNIP00000005012  takitgd.......................................................................
ENSTNIP00000000464  takitgd.......................................................................
ENSTNIP00000019109  takitgd.......................................................................
ENSTNIP00000003313  d.............................................................................
ENSTNIP00000002488  d.............................................................................
ENSTNIP00000007616  d.............................................................................
ENSTNIP00000007616  spfqvtatd.....................................................................
ENSTNIP00000002488  spfqvtaleg....................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000008895  fkavvq........................................................................
ENSTNIP00000021437  krsqpqhflytp..................................................................
ENSTNIP00000007616  rvfgpgve......................................................................
ENSTNIP00000002488  rvfgpgve......................................................................
ENSTNIP00000003313  rvfgpgve......................................................................
ENSTNIP00000008895  vlsa..........................................................................
ENSTNIP00000014295  rftyl.........................................................................
ENSTNIP00000005012  pvpkspfrvsvvegc...............................................................
ENSTNIP00000000464  pvpkspfrvsvvegc...............................................................
ENSTNIP00000019109  pvpkspfrvsvvegc...............................................................
ENSTNIP00000014296  rftyl.........................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000005012  paa...........................................................................
ENSTNIP00000008895  ddkqipgspftakitg..............................................................
ENSTNIP00000019109  paa...........................................................................
ENSTNIP00000008895  pavdttgvkvygpgve..............................................................
ENSTNIP00000005012  spfkvkvdpsh...................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  spfkvkvdpsh...................................................................
ENSTNIP00000009333  sde...........................................................................
ENSTNIP00000013288  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  kvdpshd.......................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ppld..........................................................................
ENSTNIP00000000464  ppld..........................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000019109  ppld..........................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000009333  kspfsvdvgpa...................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  hpenvkvygpgve.................................................................
ENSTNIP00000009333  g.............................................................................
ENSTNIP00000009872  pasasvgsygfqlcvftlgkirrcmmgqfvllcnpwcpe.......................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ggqnipkspfhvvvgk..............................................................
ENSTNIP00000009333  fqvtvdpsh.....................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000018364  ..............................................................................
ENSTNIP00000000464  kspytvniaea...................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  pftvsvgeacn...................................................................
ENSTNIP00000002488  pftvsvgeacn...................................................................
ENSTNIP00000007616  pftvsvgeacn...................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000018732  vqgspfaltv....................................................................
ENSTNIP00000003313  gehipnspfqvtaleg..............................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  tp............................................................................
ENSTNIP00000002488  tp............................................................................
ENSTNIP00000007616  tp............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000014417  ..............................................................................
ENSTNIP00000008895  fggenipnspfhvvvekg............................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  p.............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000005497  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ytvniaea......................................................................
ENSTNIP00000019109  ytvniaea......................................................................
ENSTNIP00000009333  fqvrvgepgq....................................................................
ENSTNIP00000009333  spfrvnvgkgs...................................................................
ENSTNIP00000006205  ..............................................................................
ENSTNIP00000009333  yggrpvpgfpakvmahpavdtsgvrafgpgld..............................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  gp............................................................................
ENSTNIP00000009333  fevnvdk.......................................................................
ENSTNIP00000005012  pfkakitg......................................................................
ENSTNIP00000000464  pfkakitg......................................................................
ENSTNIP00000019109  pfkakitg......................................................................
ENSTNIP00000003313  pfkirvgetg....................................................................
ENSTNIP00000002488  pfkirvgetg....................................................................
ENSTNIP00000007616  pfkirvgetg....................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000012114  gspfkvtvksg...................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  spfhvtv.......................................................................
ENSTNIP00000005012  ykvv..........................................................................
ENSTNIP00000000464  ykvv..........................................................................
ENSTNIP00000019109  ykvv..........................................................................
ENSTNIP00000008895  hiseacn.......................................................................
ENSTNIP00000019406  ngnvagaeaattaaatakedeeeasdkgsesdegeankdspserdedsdkqsdtevdemagddeeewealqqsiqrre
ENSTNIP00000000464  gler..........................................................................
ENSTNIP00000005012  gler..........................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000019109  gler..........................................................................
ENSTNIP00000008895  lfdevllpkspfrvlvtegcdp........................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000007616  pah...........................................................................
ENSTNIP00000003313  pah...........................................................................
ENSTNIP00000002488  pah...........................................................................
ENSTNIP00000005680  gspfrlkv......................................................................
ENSTNIP00000005012  ggqnipkspfhvvvgk..............................................................
ENSTNIP00000019109  ggqnipkspfhvvvgk..............................................................
ENSTNIP00000008895  yrvdisydgnpvpgspfav...........................................................
ENSTNIP00000000464  ydgnpvmgspfgvea...............................................................
ENSTNIP00000005012  ydgnpvmgspfgvea...............................................................
ENSTNIP00000019109  ydgnpvmgspfgvea...............................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  vkfngchipgspfnvrvgdp..........................................................
ENSTNIP00000000464  vkfngchipgspfnvrvgdp..........................................................
ENSTNIP00000019109  vkfngchipgspfnvrvgdp..........................................................
ENSTNIP00000002488  ahkvraggpgler.................................................................
ENSTNIP00000007616  ahkvraggpgler.................................................................
ENSTNIP00000003313  ahkvraggpgler.................................................................
ENSTNIP00000015515  svvfey........................................................................
ENSTNIP00000020196  ..............................................................................
ENSTNIP00000019366  egeftfslllyeqpvrgspfrlra......................................................
ENSTNIP00000019239  ..............................................................................
ENSTNIP00000009911  lrlyeqhikgspfrikv.............................................................
ENSTNIP00000018930  ..............................................................................
ENSTNIP00000008895  aggtgldr......................................................................
ENSTNIP00000008895  irvgel........................................................................
ENSTNIP00000005679  spfrlka.......................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002618  ..............................................................................
ENSTNIP00000012827  spfrlra.......................................................................
ENSTNIP00000004899  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000003313  rhipnspisvmire................................................................
ENSTNIP00000002488  rhipnspisvmire................................................................
ENSTNIP00000006954  sfkl..........................................................................
ENSTNIP00000007616  rhipnspisvmire................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000006346  ftfvt.........................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000005012  qffvdavntgvvtaygpgl...........................................................
ENSTNIP00000000464  qffvdavntgvvtaygpgl...........................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  fgqgl.........................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000010401  defgfklddvqslmalnntnfiyypn....................................................
ENSTNIP00000000963  defgfklddvqslmalnntnfiyypn....................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  raggqgl.......................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000019147  llftynr.......................................................................
ENSTNIP00000019148  llftynr.......................................................................
ENSTNIP00000003258  sfkl..........................................................................
ENSTNIP00000011053  sfkl..........................................................................
ENSTNIP00000007602  gdlglstdlftyqdp...............................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019109  fvdavntgvvtaygpgls............................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000019061  msfinftyrdp...................................................................
ENSTNIP00000007602  th............................................................................
ENSTNIP00000012220  ..............................................................................
ENSTNIP00000008162  tfty..........................................................................
ENSTNIP00000010401  fmaksskyyy....................................................................
ENSTNIP00000000963  fmaksskyyy....................................................................
ENSTNIP00000002265  hyk...........................................................................
ENSTNIP00000017783  hyk...........................................................................
ENSTNIP00000006767  egalhpeefgfifdqvssllvlnstpfthypn..............................................
ENSTNIP00000006766  egalhpeefgfifdqvssllvlnstpfthypn..............................................
ENSTNIP00000021085  esfsyl........................................................................
ENSTNIP00000013222  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000006767  yte...........................................................................
ENSTNIP00000006766  yte...........................................................................
ENSTNIP00000008162  dffyi.........................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008003  evlveggrsgmsefnftyrdp.........................................................
ENSTNIP00000009803  qvanspfll.....................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  kspipttkvfyyken...............................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006346  dnvnalvvvnktfsyypd............................................................
ENSTNIP00000021085  tcq...........................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000008163  nqlsdvf.......................................................................
ENSTNIP00000019061  vfqfven.......................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007472  ppgrslqvftyqdp................................................................
ENSTNIP00000009146  ppgrslqvftyqdp................................................................
ENSTNIP00000008163  skglas........................................................................
ENSTNIP00000002804  lgpanitaraiaysepsccsdefqa.....................................................
ENSTNIP00000008162  nqlsdvf.......................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000007744  lalkrlghvqarsstalafytpert.....................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007714  ..............................................................................
ENSTNIP00000008162  skglas........................................................................
ENSTNIP00000008163  vvrian........................................................................
ENSTNIP00000010138  mdgdlglwnrefsyhp..............................................................
ENSTNIP00000019147  tpsghtvkvt....................................................................
ENSTNIP00000019148  tpsghtvkvt....................................................................
ENSTNIP00000018520  ..............................................................................
ENSTNIP00000020566  lnvayspyykifqpg...............................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000009105  ..............................................................................
ENSTNIP00000008162  vvrian........................................................................
ENSTNIP00000005417  ih............................................................................
ENSTNIP00000004483  tmmkayenysfeelrfasptpkrpsenmlirantdgtysanwtpgavglytihvtidgieid................
ENSTNIP00000001542  tmmkayenysfeelrfasptpkrpsenmlirantdgtysanwtpgavglytihvtidgieid................
ENSTNIP00000018046  tmmkayenysfeelrfasptpkrpsenmlirantdgtysanwtpgavglytihvtidgieid................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000002265  esgqisihmedqrevwnssfeyhsn.....................................................
ENSTNIP00000017783  esgqisihmedqrevwnssfeyhsn.....................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006857  gtlqiys.......................................................................
ENSTNIP00000019147  ymteqk........................................................................
ENSTNIP00000019148  ymteqk........................................................................
ENSTNIP00000006521  pgtlqiys......................................................................
ENSTNIP00000019061  dnwvkelkpfdy..................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000016904  vevtl.........................................................................
ENSTNIP00000022219  ..............................................................................
ENSTNIP00000002960  ..............................................................................
ENSTNIP00000010459  ..............................................................................
ENSTNIP00000008492  vevtl.........................................................................
ENSTNIP00000011929  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................


                                                                                                    
                                                                                                    
d1g4ma2               ..............................................................................
ENSTNIP00000015820  ..............................................................................
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000014574  ..............................................................................
ENSTNIP00000014544  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000013758  ..............................................................................
ENSTNIP00000012673  ..............................................................................
ENSTNIP00000022103  ..............................................................................
ENSTNIP00000010457  ..............................................................................
ENSTNIP00000017993  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000007179  ..............................................................................
ENSTNIP00000019582  ..............................................................................
ENSTNIP00000009102  ..............................................................................
ENSTNIP00000017145  ..............................................................................
ENSTNIP00000009422  ..............................................................................
ENSTNIP00000009249  ..............................................................................
ENSTNIP00000005244  ..............................................................................
ENSTNIP00000005246  ..............................................................................
ENSTNIP00000014127  ..............................................................................
ENSTNIP00000006368  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000001954  ..............................................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000014157  ..............................................................................
ENSTNIP00000010486  ..............................................................................
ENSTNIP00000010899  ..............................................................................
ENSTNIP00000003800  ..............................................................................
ENSTNIP00000008976  ..............................................................................
ENSTNIP00000010244  ..............................................................................
ENSTNIP00000000824  ..............................................................................
ENSTNIP00000007048  ..............................................................................
ENSTNIP00000009940  ..............................................................................
ENSTNIP00000019946  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000014413  ..............................................................................
ENSTNIP00000019221  ..............................................................................
ENSTNIP00000022950  ..............................................................................
ENSTNIP00000005358  ..............................................................................
ENSTNIP00000002561  ..............................................................................
ENSTNIP00000009083  ..............................................................................
ENSTNIP00000006156  ..............................................................................
ENSTNIP00000004888  ..............................................................................
ENSTNIP00000014127  ..............................................................................
ENSTNIP00000020787  ..............................................................................
ENSTNIP00000002395  ..............................................................................
ENSTNIP00000013223  ..............................................................................
ENSTNIP00000005835  ..............................................................................
ENSTNIP00000009178  ..............................................................................
ENSTNIP00000010775  ..............................................................................
ENSTNIP00000005251  ..............................................................................
ENSTNIP00000005249  ..............................................................................
ENSTNIP00000005250  ..............................................................................
ENSTNIP00000016350  ..............................................................................
ENSTNIP00000015973  ..............................................................................
ENSTNIP00000010563  ..............................................................................
ENSTNIP00000021888  ..............................................................................
ENSTNIP00000021411  ..............................................................................
ENSTNIP00000020537  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000001789  ..............................................................................
ENSTNIP00000002977  ..............................................................................
ENSTNIP00000001513  ..............................................................................
ENSTNIP00000017397  ..............................................................................
ENSTNIP00000017377  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006628  ..............................................................................
ENSTNIP00000008517  ..............................................................................
ENSTNIP00000017383  ..............................................................................
ENSTNIP00000008384  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007897  ..............................................................................
ENSTNIP00000015072  ..............................................................................
ENSTNIP00000003494  ..............................................................................
ENSTNIP00000006950  ..............................................................................
ENSTNIP00000006734  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000014961  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000021564  ..............................................................................
ENSTNIP00000015432  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006675  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000021437  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000014295  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000014296  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000002599  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000013288  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000013084  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009872  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000016574  ..............................................................................
ENSTNIP00000018364  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000018732  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000014417  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000005497  ..............................................................................
ENSTNIP00000012789  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000006205  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000012114  ..............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000019406  ralletkskvthpayslyfpeekqewwwlyiadrrdqslvsmphhvctlkdteevelkfpapsktgnyqysvilrsds
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000002873  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000001133  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000005680  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000015515  ..............................................................................
ENSTNIP00000020196  ..............................................................................
ENSTNIP00000019366  ..............................................................................
ENSTNIP00000019239  ..............................................................................
ENSTNIP00000009911  ..............................................................................
ENSTNIP00000018930  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000005679  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002618  ..............................................................................
ENSTNIP00000012827  ..............................................................................
ENSTNIP00000004899  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000001568  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000006011  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000006954  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000007675  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000003898  ..............................................................................
ENSTNIP00000005012  ..............................................................................
ENSTNIP00000000464  ..............................................................................
ENSTNIP00000003313  ..............................................................................
ENSTNIP00000002488  ..............................................................................
ENSTNIP00000007616  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000018500  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000008895  ..............................................................................
ENSTNIP00000009333  ..............................................................................
ENSTNIP00000001925  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000003258  ..............................................................................
ENSTNIP00000011053  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019109  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000007602  ..............................................................................
ENSTNIP00000012220  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000013222  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000006767  ..............................................................................
ENSTNIP00000006766  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000009803  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000008003  ..............................................................................
ENSTNIP00000021085  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007472  ..............................................................................
ENSTNIP00000009146  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000002804  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000007744  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000007714  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000008163  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000018520  ..............................................................................
ENSTNIP00000020566  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000009105  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000005417  ..............................................................................
ENSTNIP00000004483  ..............................................................................
ENSTNIP00000001542  ..............................................................................
ENSTNIP00000018046  ..............................................................................
ENSTNIP00000010138  ..............................................................................
ENSTNIP00000002265  ..............................................................................
ENSTNIP00000017783  ..............................................................................
ENSTNIP00000006346  ..............................................................................
ENSTNIP00000008162  ..............................................................................
ENSTNIP00000006857  ..............................................................................
ENSTNIP00000019147  ..............................................................................
ENSTNIP00000019148  ..............................................................................
ENSTNIP00000006521  ..............................................................................
ENSTNIP00000019061  ..............................................................................
ENSTNIP00000004388  ..............................................................................
ENSTNIP00000016904  ..............................................................................
ENSTNIP00000022219  ..............................................................................
ENSTNIP00000002960  ..............................................................................
ENSTNIP00000010459  ..............................................................................
ENSTNIP00000008492  ..............................................................................
ENSTNIP00000011929  ..............................................................................
ENSTNIP00000010401  ..............................................................................
ENSTNIP00000000963  ..............................................................................


                                      
                                      
d1g4ma2               ................
ENSTNIP00000015820  ................
ENSTNIP00000014157  ................
ENSTNIP00000001954  ................
ENSTNIP00000014574  ................
ENSTNIP00000014544  ................
ENSTNIP00000010486  ................
ENSTNIP00000013758  ................
ENSTNIP00000012673  ................
ENSTNIP00000022103  ................
ENSTNIP00000010457  ................
ENSTNIP00000017993  ................
ENSTNIP00000006675  ................
ENSTNIP00000002599  ................
ENSTNIP00000007179  ................
ENSTNIP00000019582  ................
ENSTNIP00000009102  ................
ENSTNIP00000017145  ................
ENSTNIP00000009422  ................
ENSTNIP00000009249  ................
ENSTNIP00000005244  ................
ENSTNIP00000005246  ................
ENSTNIP00000014127  ................
ENSTNIP00000006368  ................
ENSTNIP00000009083  ................
ENSTNIP00000002561  ................
ENSTNIP00000001954  ................
ENSTNIP00000019946  ................
ENSTNIP00000014157  ................
ENSTNIP00000010486  ................
ENSTNIP00000010899  ................
ENSTNIP00000003800  ................
ENSTNIP00000008976  ................
ENSTNIP00000010244  ................
ENSTNIP00000000824  ................
ENSTNIP00000007048  ................
ENSTNIP00000009940  ................
ENSTNIP00000019946  ................
ENSTNIP00000005358  ................
ENSTNIP00000014413  ................
ENSTNIP00000019221  ................
ENSTNIP00000022950  ................
ENSTNIP00000005358  ................
ENSTNIP00000002561  ................
ENSTNIP00000009083  ................
ENSTNIP00000006156  ................
ENSTNIP00000004888  ................
ENSTNIP00000014127  ................
ENSTNIP00000020787  ................
ENSTNIP00000002395  ................
ENSTNIP00000013223  ................
ENSTNIP00000005835  ................
ENSTNIP00000009178  ................
ENSTNIP00000010775  ................
ENSTNIP00000005251  ................
ENSTNIP00000005249  ................
ENSTNIP00000005250  ................
ENSTNIP00000016350  ................
ENSTNIP00000015973  ................
ENSTNIP00000010563  ................
ENSTNIP00000021888  ................
ENSTNIP00000021411  ................
ENSTNIP00000020537  ................
ENSTNIP00000005012  ................
ENSTNIP00000019109  ................
ENSTNIP00000000464  ................
ENSTNIP00000007616  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000003313  ................
ENSTNIP00000001789  ................
ENSTNIP00000002977  ................
ENSTNIP00000001513  ................
ENSTNIP00000017397  ................
ENSTNIP00000017377  ................
ENSTNIP00000007616  ................
ENSTNIP00000008895  ................
ENSTNIP00000002488  ................
ENSTNIP00000006628  ................
ENSTNIP00000008517  ................
ENSTNIP00000017383  ................
ENSTNIP00000008384  ................
ENSTNIP00000009333  ................
ENSTNIP00000007897  ................
ENSTNIP00000015072  ................
ENSTNIP00000003494  ................
ENSTNIP00000006950  ................
ENSTNIP00000006734  ................
ENSTNIP00000009333  ................
ENSTNIP00000000464  ................
ENSTNIP00000007616  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000014961  ................
ENSTNIP00000008895  ................
ENSTNIP00000012789  ................
ENSTNIP00000008895  ................
ENSTNIP00000000464  ................
ENSTNIP00000005012  ................
ENSTNIP00000019109  ................
ENSTNIP00000005012  ................
ENSTNIP00000019109  ................
ENSTNIP00000009333  ................
ENSTNIP00000013084  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000016574  ................
ENSTNIP00000009333  ................
ENSTNIP00000009333  ................
ENSTNIP00000009333  ................
ENSTNIP00000021564  ................
ENSTNIP00000015432  ................
ENSTNIP00000007616  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000007616  ................
ENSTNIP00000002488  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000006675  ................
ENSTNIP00000008895  ................
ENSTNIP00000021437  ................
ENSTNIP00000007616  ................
ENSTNIP00000002488  ................
ENSTNIP00000003313  ................
ENSTNIP00000008895  ................
ENSTNIP00000014295  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000014296  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000008895  ................
ENSTNIP00000002599  ................
ENSTNIP00000005012  ................
ENSTNIP00000008895  ................
ENSTNIP00000019109  ................
ENSTNIP00000008895  ................
ENSTNIP00000005012  ................
ENSTNIP00000008895  ................
ENSTNIP00000019109  ................
ENSTNIP00000009333  ................
ENSTNIP00000013288  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000009333  ................
ENSTNIP00000009333  ................
ENSTNIP00000000464  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000019109  ................
ENSTNIP00000008895  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000006011  ................
ENSTNIP00000013084  ................
ENSTNIP00000009333  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000008895  ................
ENSTNIP00000009333  ................
ENSTNIP00000009872  ................
ENSTNIP00000000464  ................
ENSTNIP00000005012  ................
ENSTNIP00000019109  ................
ENSTNIP00000000464  ................
ENSTNIP00000009333  ................
ENSTNIP00000016574  ................
ENSTNIP00000018364  ................
ENSTNIP00000000464  ................
ENSTNIP00000009333  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000019109  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000018732  ................
ENSTNIP00000003313  ................
ENSTNIP00000008895  ................
ENSTNIP00000009333  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000008895  ................
ENSTNIP00000001925  ................
ENSTNIP00000001568  ................
ENSTNIP00000014417  ................
ENSTNIP00000008895  ................
ENSTNIP00000000464  ................
ENSTNIP00000009333  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000005497  ................
ENSTNIP00000012789  ................
ENSTNIP00000008895  ................
ENSTNIP00000005012  ................
ENSTNIP00000019109  ................
ENSTNIP00000009333  ................
ENSTNIP00000009333  ................
ENSTNIP00000006205  ................
ENSTNIP00000009333  ................
ENSTNIP00000007616  ................
ENSTNIP00000002488  ................
ENSTNIP00000003313  ................
ENSTNIP00000008895  ................
ENSTNIP00000009333  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000001133  ................
ENSTNIP00000012114  ................
ENSTNIP00000002873  ................
ENSTNIP00000008895  ................
ENSTNIP00000009333  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000008895  ................
ENSTNIP00000019406  ylgldqikplklevhe
ENSTNIP00000000464  ................
ENSTNIP00000005012  ................
ENSTNIP00000002873  ................
ENSTNIP00000019109  ................
ENSTNIP00000008895  ................
ENSTNIP00000001133  ................
ENSTNIP00000007616  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000005680  ................
ENSTNIP00000005012  ................
ENSTNIP00000019109  ................
ENSTNIP00000008895  ................
ENSTNIP00000000464  ................
ENSTNIP00000005012  ................
ENSTNIP00000019109  ................
ENSTNIP00000007616  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000009333  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000019109  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000003313  ................
ENSTNIP00000015515  ................
ENSTNIP00000020196  ................
ENSTNIP00000019366  ................
ENSTNIP00000019239  ................
ENSTNIP00000009911  ................
ENSTNIP00000018930  ................
ENSTNIP00000008895  ................
ENSTNIP00000008895  ................
ENSTNIP00000005679  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000003313  ................
ENSTNIP00000002618  ................
ENSTNIP00000012827  ................
ENSTNIP00000004899  ................
ENSTNIP00000007675  ................
ENSTNIP00000001568  ................
ENSTNIP00000018500  ................
ENSTNIP00000004388  ................
ENSTNIP00000009333  ................
ENSTNIP00000003898  ................
ENSTNIP00000000963  ................
ENSTNIP00000010401  ................
ENSTNIP00000006011  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000006954  ................
ENSTNIP00000007616  ................
ENSTNIP00000007675  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000006346  ................
ENSTNIP00000019109  ................
ENSTNIP00000003898  ................
ENSTNIP00000005012  ................
ENSTNIP00000000464  ................
ENSTNIP00000003313  ................
ENSTNIP00000002488  ................
ENSTNIP00000007616  ................
ENSTNIP00000008895  ................
ENSTNIP00000018500  ................
ENSTNIP00000009333  ................
ENSTNIP00000010401  ................
ENSTNIP00000000963  ................
ENSTNIP00000008895  ................
ENSTNIP00000009333  ................
ENSTNIP00000001925  ................
ENSTNIP00000019147  ................
ENSTNIP00000019148  ................
ENSTNIP00000003258  ................
ENSTNIP00000011053  ................
ENSTNIP00000007602  ................
ENSTNIP00000008163  ................
ENSTNIP00000019109  ................
ENSTNIP00000006767  ................
ENSTNIP00000006766  ................
ENSTNIP00000008162  ................
ENSTNIP00000019061  ................
ENSTNIP00000007602  ................
ENSTNIP00000012220  ................
ENSTNIP00000008162  ................
ENSTNIP00000010401  ................
ENSTNIP00000000963  ................
ENSTNIP00000002265  ................
ENSTNIP00000017783  ................
ENSTNIP00000006767  ................
ENSTNIP00000006766  ................
ENSTNIP00000021085  ................
ENSTNIP00000013222  ................
ENSTNIP00000008163  ................
ENSTNIP00000006767  ................
ENSTNIP00000006766  ................
ENSTNIP00000008162  ................
ENSTNIP00000008162  ................
ENSTNIP00000008003  ................
ENSTNIP00000009803  ................
ENSTNIP00000008163  ................
ENSTNIP00000010138  ................
ENSTNIP00000008162  ................
ENSTNIP00000006346  ................
ENSTNIP00000021085  ................
ENSTNIP00000002265  ................
ENSTNIP00000017783  ................
ENSTNIP00000008003  ................
ENSTNIP00000021085  ................
ENSTNIP00000008163  ................
ENSTNIP00000019061  ................
ENSTNIP00000008163  ................
ENSTNIP00000007472  ................
ENSTNIP00000009146  ................
ENSTNIP00000008163  ................
ENSTNIP00000002804  ................
ENSTNIP00000008162  ................
ENSTNIP00000008162  ................
ENSTNIP00000007744  ................
ENSTNIP00000008163  ................
ENSTNIP00000007714  ................
ENSTNIP00000008162  ................
ENSTNIP00000008163  ................
ENSTNIP00000010138  ................
ENSTNIP00000019147  ................
ENSTNIP00000019148  ................
ENSTNIP00000018520  ................
ENSTNIP00000020566  ................
ENSTNIP00000008162  ................
ENSTNIP00000009105  ................
ENSTNIP00000008162  ................
ENSTNIP00000005417  ................
ENSTNIP00000004483  ................
ENSTNIP00000001542  ................
ENSTNIP00000018046  ................
ENSTNIP00000010138  ................
ENSTNIP00000002265  ................
ENSTNIP00000017783  ................
ENSTNIP00000006346  ................
ENSTNIP00000008162  ................
ENSTNIP00000006857  ................
ENSTNIP00000019147  ................
ENSTNIP00000019148  ................
ENSTNIP00000006521  ................
ENSTNIP00000019061  ................
ENSTNIP00000004388  ................
ENSTNIP00000016904  ................
ENSTNIP00000022219  ................
ENSTNIP00000002960  ................
ENSTNIP00000010459  ................
ENSTNIP00000008492  ................
ENSTNIP00000011929  ................
ENSTNIP00000010401  ................
ENSTNIP00000000963  ................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046920 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Atopobium parvulum DSM 20469
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
No