SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Voltage-gated potassium channels alignments in Gorilla gorilla 76_3.1

These alignments are sequences aligned to the 0041998 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                   10        20         30                          
                                                    |         |          |                          
d1orqc_               .................igdv----MEHPLVELGVSYAALLSVIVVVVE.CTM.Q.......................
ENSGGOP00000011420  ..................sgp------ARIIAIVSVMVILISIVSFCLE.TLP.Ifrdenedmhgsgvtfhtysnsti
ENSGGOP00000021753  ..................sgp------ARVIAIVSVMVILISIVIFCLE.TLP.Elkddkdftgtvhridnttviy..
ENSGGOP00000000656  .................argi----------AIVSVLVILISIVIFCLE.TLP.Efrdekdypastsqdsfeaagnst
ENSGGOP00000011744  ...................sa-------RAIAIVSVLVILISIITFCLE.TLP.Efrderellrhppaphqppapapg
ENSGGOP00000003210  ..................sva------AKILAIVSILFIVLSTIALSLN.TLP.E.......................
ENSGGOP00000027568  ....................a-----------IVSVLVILISIVIFCLE.TLP.-.......................
ENSGGOP00000007168  .................sspa-------RGIAIVSVLVILISIVIFCLE.TLP.Efrddrdlvmalsagghggllndt
ENSGGOP00000024337  .................sspa-------RGIAIVSVLVILISIVIFCLE.TLP.Efrddrdlvmalsagghggllndt
ENSGGOP00000002688  ..................sta------ALVFYYVTGFFIAVSVIANVVE.TIP.Crgsarrssreqp...........
ENSGGOP00000009305  ..................scp------ARVVAVLSFLLILVSSVVMCMG.TIP.E.......................
ENSGGOP00000006737  ....................i------------ISIMFIVLSTIALSLN.TLP.E.......................
ENSGGOP00000015335  ....................s----RYARYVAFASLFFILVSITTFCLE.THE.Rfnpivnkteienvrngtqvryy.
ENSGGOP00000015202  ..................stl------ALVFYYVTGFFIAVSVITNVVE.TVP.Cgtvpgskelp.............
ENSGGOP00000003820  ...................sr-----AARFIAFASLFFILVSITTFCLE.THE.Afnivknktepvingtsvvlq...
ENSGGOP00000008219  ..................ssa------ARAVAVVSVLVVVISITIFCLE.TLP.Efredrelkvvrdpnlnmsktvl.
ENSGGOP00000022687  ...................sr-----AARFIAFASLFFILVSITTFCLE.THE.Afnivknktepvingtsvvlq...
ENSGGOP00000013400  ..................sqa------ARVLAVVSVLVILVSIVVFCLE.TLP.Dfrddrdgtglaavaaagpfparl
ENSGGOP00000027450  ...................sr-----AARVVAFASLFFILVSITTFCLE.THE.Afnidgnvteilrvgnitsvhfr.
ENSGGOP00000000227  ...............kaigva-------------SSIFVLVSVVALALN.TVE.E.......................
ENSGGOP00000012818  ...................sr-----AARVVAFASLFFILVSITTFCLE.THE.Afnidgnvteilrvgnitsvhfr.
ENSGGOP00000008276  .....................PGSSTAARIFGVISIIFVVVSIINMALM.SAE.-.......................
ENSGGOP00000019798  .....................DPYSSRAARVAFASLFFILVSITTFCLE.THE.Afnidgnvteilrvgnitsvhfr.
ENSGGOP00000006085  ....................s----RAARYVAFASLFFILISITTFCLE.THE.Gfihisnktvtqaspipgappeni
ENSGGOP00000000958  ...............liaiss--------------LSVVLASIVAMCIH.SMS.E.......................
ENSGGOP00000002752  .....................PGYSVLSRVFSILSILVVMGSIITMCLN.SLP.Dfqipdsq................
ENSGGOP00000000831  .................glpg-------KVFACLSVLFVTVTAVNLSVS.TLP.S.......................
ENSGGOP00000002953  .....................PGYSLPSKLFSCVSISVVLASIAAMCIH.SLP.Eyqareaaaavaavaagrsp....
ENSGGOP00000023230  .....................PGYSLPSKLFSCVSISVVLASIAAMCIH.SLP.Eyqareaaaavaavaagrsp....
ENSGGOP00000001534  ..................lpg-------KVFACLSILFVATTAVSLCVS.TMP.Dlraeedqg...............
ENSGGOP00000005162  ...................kc----------------------------.---.-.......................
ENSGGOP00000001664  ..................aqi---------LASVSVVFVIVSMVVLCAS.TLP.Dwrnaaadnrslddrsr.......
ENSGGOP00000025520  ...................wa-------FIYHAYVFLLVFSCLVLSVFS.TIK.E.......................
ENSGGOP00000016408  .....................-HYSPFKAVWDWLILLLVIYTAVFTPYS.AAF.L.......................
ENSGGOP00000020811  ...................wa-------FIYHAYVFLLVFSCLVLSVFS.TIK.E.......................
ENSGGOP00000008202  ...................wa-------FIYHAYVFLLVFSCLVLSVFS.TIK.E.......................
ENSGGOP00000012351  .....................-HYSPFKAVWDWLILLLVIYTAIFTPYS.AAF.L.......................
ENSGGOP00000028732  ...................fk-------TTWDWVILILTFYTAIMVPYN.VSF.-.......................
ENSGGOP00000011126  ....................f---------------LLVFGCLILSVFS.TIP.E.......................
ENSGGOP00000012234  ...................hn--------WFETFIVFMILLSSGALAFEdIYI.E.......................
ENSGGOP00000024945  ...................hn--------WFETFIVFMILLSSGALAFEdIYI.E.......................
ENSGGOP00000008980  ...................hn--------WFETFIIFMILLSSGALAFEdIYI.E.......................
ENSGGOP00000013052  ....................p--TGWKCFVYHFAVFLIVLVCLIFSVLS.TIE.Q.......................
ENSGGOP00000012641  ....................h-------SWFETFIIFMILLSSGALAFEdIYL.E.......................
ENSGGOP00000028610  ...................fk-------TTWDWIILILTFYTAILVPYN.VSF.-.......................
ENSGGOP00000006310  ....................h-------SWFESFIIFMILLSSGSLAFEdYYL.D.......................
ENSGGOP00000001711  ....................i-----------------VLGCLILAVLT.TFK.E.......................
ENSGGOP00000017557  .....................------HKLFDYVVLAFIFLNCITIALErPQI.E.......................
ENSGGOP00000024463  .....................------HKLFDYVVLAFIFLNCITIALErPQI.E.......................
ENSGGOP00000009882  .....................------HKLFDYVVLAFIFLNCITIALErPQI.E.......................
ENSGGOP00000023204  ....................h-------KMFDHVVLVIIFLNCITIAMErPKI.D.......................
ENSGGOP00000003342  ....................h-------KMFDHVVLVIIFLNCITIAMErPKI.D.......................
ENSGGOP00000000352  ...................hn--------WFETFIVFMILLSSGALAFEdIYI.E.......................
ENSGGOP00000028147  ...................hn--------WFETFIVFMILLSSGALAFEdIYI.E.......................
ENSGGOP00000016440  ...................hn--------WFETFIVFMILLSSGALAFEdIYI.E.......................
ENSGGOP00000008980  ....................q--------AFDIVIMMLICLNMVTMMVE.TDT.-.......................
ENSGGOP00000024463  ....................s-------KYFNRGIMMAILVNTVSMGIE.HHE.-.......................
ENSGGOP00000017557  ....................s-------KYFNRGIMMAILVNTVSMGIE.HHE.-.......................
ENSGGOP00000001541  ...................ra--------TWDGFILLATLYVAVTVPYS.VCV.S.......................
ENSGGOP00000009882  ....................s-------KYFNRGIMMAILVNTVSMGIE.HHE.-.......................
ENSGGOP00000013701  ....................h-------KMFDHVVLVFIFLNCVTIALErPDI.D.......................
ENSGGOP00000021319  ....................h-------KMFDHVVLVFIFLNCVTIALErPDI.D.......................
ENSGGOP00000027513  ....................h-------KMFDHVVLVFIFLNCVTIALErPDI.D.......................
ENSGGOP00000023417  ....................r-------QVFDISIMILICLNMVTMMVE.TDD.-.......................
ENSGGOP00000005331  ....................r-------QVFDISIMILICLNMVTMMVE.TDD.-.......................
ENSGGOP00000025522  .....................DPSGNTYYNWLFCITLPVMYNWTMVIARaCFD.E.......................
ENSGGOP00000013502  .....................DPSGNTYYNWLFCITLPVMYNWTMVIARaCFD.E.......................
ENSGGOP00000025809  ....................h-------SWFESFIVLMILLSSGALAFEdIYI.E.......................
ENSGGOP00000024945  ....................q--------AFDITIMILICLNMVTMMVE.TDD.-.......................
ENSGGOP00000012234  ....................q--------AFDITIMILICLNMVTMMVE.TDD.-.......................
ENSGGOP00000000352  ....................k-------QVFDISIMILICLNMVTMMVE.TDD.-.......................
ENSGGOP00000013701  ....................s-------KYFSRGIMMAILVNTLSMGVE.YHE.-.......................
ENSGGOP00000021319  ....................s-------KYFSRGIMMAILVNTLSMGVE.YHE.-.......................
ENSGGOP00000027513  ....................s-------KYFSRGIMMAILVNTLSMGVE.YHE.-.......................
ENSGGOP00000003602  ...................wk--------PFDIFILLAIFANCVALAIY.IPF.P.......................
ENSGGOP00000017118  ..................stf------KAGWDWLILLATFYVAVTVPYN.VCF.Ign.....................
ENSGGOP00000016440  ....................r-------QVFDISIMILICLNMVTMMVE.TDD.-.......................
ENSGGOP00000015188  ....................y---SVPKAIWDGLILLATFYVAVTVPYN.VCF.S.......................
ENSGGOP00000019923  ....................s-------QVFYWIVLSLVALNTACVAIV.HHN.-.......................
ENSGGOP00000003342  ....................s-------KYFGRGIMIAILVNTLSMGIE.YHE.-.......................
ENSGGOP00000023204  ....................s-------KYFGRGIMIAILVNTLSMGIE.YHE.-.......................
ENSGGOP00000010829  ....................s-------QVFYWIVLSLVALNTACVAIV.HHN.-.......................
ENSGGOP00000027293  ....................i----------------------------.---.-.......................
ENSGGOP00000026337  .....................DPAGDWYYCWLFVIAMPVLYNWCLLVARaCFS.D.......................
ENSGGOP00000012641  ....................q--------AFDVTIMFLICLNMVTMMVE.TDD.-.......................
ENSGGOP00000026186  .....................HPYSDFRFYWDLTMLLLMVGNLIIIPVG.ITF.-.......................
ENSGGOP00000008627  .....................HPYSDFRFYWDLTMLLLMVGNLIIIPVG.ITF.-.......................
ENSGGOP00000012593  .....................DPAGDWYYCWLFVIAMPVLYNWCLLVARaCFS.D.......................
ENSGGOP00000013701  .....................-------PWFEHVSMLVIMLNCVTLGMF.RPC.Edve....................
ENSGGOP00000021319  .....................-------PWFEHVSMLVIMLNCVTLGMF.RPC.Edve....................
ENSGGOP00000022082  ....................s-------TYFEYLMFVLILLNTICLAMQ.HYG.-.......................
ENSGGOP00000028147  ....................k-------QVFDISIMILICLNMVTMMVE.TDD.-.......................
ENSGGOP00000000898  ....................k--------PFDILILLTIFANCVALGVY.IPF.P.......................
ENSGGOP00000022765  .....................DPSSNLYYRWLTAIALPVFYNWCLLICRaCFD.E.......................
ENSGGOP00000003013  .....................DPSSNLYYRWLTAIALPVFYNWCLLICRaCFD.E.......................
ENSGGOP00000006428  ....................s-------QIFDIIIISLIILNMISMMAE.SYN.-.......................
ENSGGOP00000006310  ....................r-------QAFDITIMVLICLNMITMMVE.TDD.-.......................
ENSGGOP00000017309  ....................t-------QAFYWTVLSLVALNTLCVAIV.HYN.-.......................
ENSGGOP00000015727  .....................HPYSDFRFYWDLIMLLLMVGNLIVLPVG.ITF.-.......................
ENSGGOP00000008481  ....................t-------QAFYWTVLSLVALNTLCVAIV.HYN.-.......................
ENSGGOP00000006428  ....................h-------SWFESFIIFVILLSSGALIFEdVHL.E.......................
ENSGGOP00000004729  ....................a-------QSFYWVVLCVVALNTLCVAMV.HYN.-.......................
ENSGGOP00000003342  .....................-------PWFERISMLVILLNCVTLGMF.RPC.Edia....................
ENSGGOP00000001513  .....................HPYSDFRFYWDLIMLIMMVGNLVIIPVG.ITF.-.......................
ENSGGOP00000021823  ....................k--------PFDILILLTIFANCVALGVY.IPF.P.......................
ENSGGOP00000021537  .....................--------YWDLTMLLLMVGNLIIIPVG.ITF.-.......................
ENSGGOP00000018103  ...................aq---------TLTGRVLVVLVFALSIGAL.VIY.F.......................
ENSGGOP00000003602  ....................p---------FEYMMFVLIMLNTLCLAMQ.HYE.-.......................
ENSGGOP00000013701  ....................s-------HYLDIFITFIICVNVITMSME.HYN.-.......................
ENSGGOP00000021319  ....................s-------HYLDIFITFIICVNVITMSME.HYN.-.......................
ENSGGOP00000027513  ....................s-------HYLDIFITFIICVNVITMSME.HYN.-.......................
ENSGGOP00000002713  ....................n--------VFYWLVIFLVFLNTLTIASE.HYN.-.......................
ENSGGOP00000002713  ....................t--------YFEYLMFVLILLNTICLAMQ.HYG.-.......................
ENSGGOP00000000898  ....................a---------FEYLMFLLILLNTVALAMQ.HYE.-.......................
ENSGGOP00000005331  .................afed----------------------------.IYI.D.......................
ENSGGOP00000021823  ....................a--------AFEYLMFLLILLNTVALAMQ.HYE.-.......................
ENSGGOP00000001185  ....................s-------KVFYWLVILIVALNTLSIASE.HHN.-.......................
ENSGGOP00000008481  ....................s-------PPFEYTIMAMIALNTIVLMMK.FYG.-.......................
ENSGGOP00000001185  ....................s-------SYFEYLMFALIMLNTICLGMQ.HYN.-.......................
ENSGGOP00000023924  ....................s-------SYFEYLMFALIMLNTICLGMQ.HYN.-.......................
ENSGGOP00000022383  ...................lr-------FYWDLIMLLLMVGNLIVLPVG.ITF.-.......................
ENSGGOP00000023204  ....................p------YTWFERISMLVILLNCVTLGMF.RPC.Ediac...................
ENSGGOP00000023417  ..............yftiffl-------------FFKHIFPSFFFFAFEdIYI.D.......................
ENSGGOP00000024463  ....................s-------HYLDIFITFIICLNVVTMSLE.HYN.-.......................
ENSGGOP00000016442  ....................r----------------------------.---.-.......................
ENSGGOP00000009882  ....................s-------HYLDIFITFIICLNVVTMSLE.HYN.-.......................
ENSGGOP00000019923  ....................s-------PSFEYTIMAMIALNTVVLMMK.YYS.-.......................
ENSGGOP00000017309  ....................s-------PPFEYTIMAMIALNTIVLMMK.FYG.-.......................
ENSGGOP00000017557  ....................s-------HYLDIFITFIICLNVVTMSLE.HYN.-.......................
ENSGGOP00000010829  ....................s-------PSFEYTIMAMIALNTVVLMMK.YYS.-.......................
ENSGGOP00000001185  ....................a-------TWFTNFILLFILLSSAALAAE.DPI.R.......................
ENSGGOP00000019172  ....................r----------------------------.---.-.......................
ENSGGOP00000019923  ....................l-------RYFEMCILLVIAASSIALAAE.DPV.L.......................
ENSGGOP00000003342  ...................sh--------YLDLFITGVIGLNVVTMAME.HYQ.-.......................
ENSGGOP00000023204  ...................sh--------YLDLFITGVIGLNVVTMAME.HYQ.-.......................
ENSGGOP00000008481  .....................---------FEYMILATIIANCIVLALE.QHL.P.......................
ENSGGOP00000000501  ....................a----------------------------.---.-.......................
ENSGGOP00000023924  ....................a-------TWFTNFILLFILLSSAALAAE.DPI.R.......................
ENSGGOP00000004729  ....................m-------RYFEMVILVVITLSSIALAAE.DPV.H.......................
ENSGGOP00000027513  .....................-------YWFEHVSMLVIMLNCVTLGMF.RPC.Edve....................
ENSGGOP00000010829  ....................l-------RYFEMCILLVIAASSIALAAE.DPV.L.......................
ENSGGOP00000004729  ....................s-------PPFEYFIMAMIALNTVVLMMK.FYD.-.......................
ENSGGOP00000001185  ...................kp---------FETIILLTIFANCVALAMY.LPM.P.......................
ENSGGOP00000023924  ...................kp---------FETIILLTIFANCVALAMY.LPM.P.......................
ENSGGOP00000000352  .....................-------PFVDLAITICIVLNTLFMAME.HYP.-.......................
ENSGGOP00000007211  ....................l----------------LVFSCLVLSVLS.TIQ.E.......................
ENSGGOP00000028147  .....................-------PFVDLAITICIVLNTLFMAME.HYP.-.......................
ENSGGOP00000020299  ....................p---------FEYMMFVLIMLNTLCLAMQ.HYE.-.......................
ENSGGOP00000013354  ...................sl--------AFETFIFFIVCLNTVMLVAQ.TFA.E.......................
ENSGGOP00000008980  .....................-------PFVDLAITICIVLNTLFMAME.HHP.-.......................
ENSGGOP00000010829  ....................w-------PPFEYMILATIIANCIVLALEqHLP.E.......................
ENSGGOP00000024945  .....................-------PFVDLGITICIVLNTLFMAME.HYP.-.......................
ENSGGOP00000012234  .....................-------PFVDLGITICIVLNTLFMAME.HYP.-.......................
ENSGGOP00000021390  ....................l----------------LVFSCLVLSVLS.TIQ.E.......................
ENSGGOP00000023417  .....................-------PFVDLAITICIVLNTLFMAME.HYP.-.......................
ENSGGOP00000005331  .....................-------PFVDLAITICIVLNTLFMAME.HYP.-.......................
ENSGGOP00000002713  ....................r----------------------------.---.-.......................
ENSGGOP00000020299  ....................v--------TFYWLVIILVFLNTLTISSE.HYN.-.......................
ENSGGOP00000003602  ...................sv--------TFYWLVIILVFLNTLTISSE.HYN.-.......................
ENSGGOP00000012641  .....................-------PFTDLTITMCIVLNTLFMALE.HYN.-.......................
ENSGGOP00000010638  .....................DPSGDYYYWWLNTMVFPVMYNLIILVCRaCFP.D.......................
ENSGGOP00000020299  ................ssspa----------------------------.---.-.......................
ENSGGOP00000004729  .....................---------FEYMILATIIANCIVLALEqHLP.D.......................
ENSGGOP00000016440  ...................st--------LFSMLIMCTILTNCVFMTLS.---.-.......................
ENSGGOP00000025809  .....................-------PFVDLAITICIVLNTLFMAME.HHP.-.......................
ENSGGOP00000006736  .................ysdf-----------------------IIIPV.GIT.F.......................
ENSGGOP00000022082  ....................r----------------------------.---.-.......................
ENSGGOP00000000352  .....................------HYLFNMLIMCTILTNCVFMTMS.---.-.......................
ENSGGOP00000005331  ...................hs--------LFSMLIMCTILTNCVFMTMS.---.-.......................
ENSGGOP00000008980  ...................hs--------LFSMIIMCTILTNCVFMTFS.---.-.......................
ENSGGOP00000012641  ....................t--------LFNMLIMCTILTNCVFM---.---.-.......................
ENSGGOP00000000898  ....................y-----------WAVLLLVFLNTLTIASE.HHG.-.......................
ENSGGOP00000028147  ....................h-------SLFNMLIMCTILTNCVFMTMS.---.-.......................
ENSGGOP00000003602  ....................h-------HIFTNLILVFIMLSSAALAAE.DPI.R.......................
ENSGGOP00000023417  ...................fs--------IFSMLIMCTILTNCVFMTMS.---.-.......................
ENSGGOP00000006310  ....................h-------SWFSLFITVTILVNCVCMTRT.DLP.-.......................
ENSGGOP00000006310  ..................pfa----------ELTITLCIVVNTIFMAME.HHG.-.......................
ENSGGOP00000020299  ....................h-------HIFTNLILVFIMLSSAALAAE.DPI.R.......................
ENSGGOP00000023924  ....................s-------KVFYWLVILIVALNTLSIASE.HHN.-.......................
ENSGGOP00000011260  .................tfvg-------------QVLVILVFVLSIGSL.IIY.F.......................
ENSGGOP00000012234  ....................h-------ALFSMFIMITILTNCVFMTMS.DPP.-.......................
ENSGGOP00000024945  ....................h-------TLFSMFIMITILTNCVFMTMS.DPP.-.......................
ENSGGOP00000021823  ....................y-----------WAVLLLVFLNTLTIASE.HHG.-.......................
ENSGGOP00000021823  ....................h-------HVFTNLILVFIILSSVSLAAE.DPI.R.......................
ENSGGOP00000008481  ....................l-------RYFEMCILMVIAMSSIALAAE.DPV.Q.......................
ENSGGOP00000000898  ....................h-------HVFTNLILVFIILSSVSLAAE.DPI.R.......................
ENSGGOP00000017309  ....................l-------RYFEMCILMVIAMSSIALAAE.DPV.Q.......................
ENSGGOP00000016440  .....................-------PFVDLAITICIVLNTLFMAME.HYP.-.......................
ENSGGOP00000022082  ....................n--------VFYWLVIFLVFLNTLTIASE.HYN.-.......................
ENSGGOP00000009838  ....................d----RLYLLWLLLVTLAYNWNCWFIPLRlVFP.Y.......................
ENSGGOP00000006428  ...................hs--------LFSMFIIGTVIINCVFMATG.PAK.-.......................
ENSGGOP00000005127  ....................l----------------------------.---.-.......................
ENSGGOP00000016918  ....................l----------------------------.---.-.......................
ENSGGOP00000001687  ...................ia----------------------------.---.-.......................
ENSGGOP00000015184  .....................----------------------------.---.-.......................
ENSGGOP00000017557  ....................c-------TWFECVSMLVILLNCVTLGMY.QPC.D.......................
ENSGGOP00000022082  ....................i---------FTNLILFFILLSSISLAAE.DPV.Q.......................
ENSGGOP00000006428  .....................-------PFTELAITICIIINTVFLAME.HHK.-.......................
ENSGGOP00000027687  ....................l----------------------------.---.-.......................
ENSGGOP00000002713  ...................lg----------------------------.---.-.......................
ENSGGOP00000007339  ...................vt--------YLDWVMIIVTICSCISMMFE.SPF.-.......................
ENSGGOP00000016934  ...................vt--------YLDWVMIIVTICSCISMMFE.SPF.-.......................
ENSGGOP00000025319  ...........fmkkwnvsqt----------------------------.---.-.......................
ENSGGOP00000025813  ...................fp----------------------------.---.-.......................
ENSGGOP00000003047  ...................rt----------------------------.---.-.......................
ENSGGOP00000025809  ...................st--------LFSMLIMCTILTNCIFMTMN.---.-.......................
ENSGGOP00000008617  .................rgla----------------------------.---.-.......................
ENSGGOP00000012511  .....................----------------------------.---.-.......................
ENSGGOP00000005228  ..................gqr----------------------------.---.-.......................
ENSGGOP00000024187  ..............wnvsqtk----------------------------.---.-.......................
ENSGGOP00000007461  ....................r----------------------------.---.-.......................
ENSGGOP00000016722  ....................y-------VLWLFFVVMAWNWNCWLIPVRwAFP.Y.......................
ENSGGOP00000027288  ....................r----------------------------.---.-.......................
ENSGGOP00000005376  ..........rfrhwfvakly----------------------------.---.-.......................
ENSGGOP00000006442  .....................------HPAFQLLLALLLVINAITIALR.TNS.Y.......................
ENSGGOP00000024150  .....................----------------------------.---.-.......................
ENSGGOP00000001687  ....................t----------------------------.---.-.......................
ENSGGOP00000009882  .....................-------PLWACLFMLVILLNCVTLGMY.QPC.D.......................
ENSGGOP00000003047  .....krikkccgmrntdvsm----------------------------.---.-.......................
ENSGGOP00000002078  .....................------APFTDLFLIICIILNVCFLTLE.HYP.-.......................
ENSGGOP00000027711  .................ksqr----------------------------.---.-.......................
ENSGGOP00000000658  ................ksqry----------------------------.---.-.......................
ENSGGOP00000019229  ................vrety----------------------------.---.-.......................
ENSGGOP00000000546  .................ksqr----------------------------.---.-.......................
ENSGGOP00000007454  ....................m----------------------------.---.-.......................
ENSGGOP00000024187  ....................m----------------------------.---.-.......................
ENSGGOP00000018574  ....................a----------------------------.---.-.......................
ENSGGOP00000001313  ....................a----------------------------.---.-.......................
ENSGGOP00000022306  .................qety----------------------------.---.-.......................
ENSGGOP00000006045  ....................c-------PLFKNFIIFLIFLNTIILMVE.IQL.L.......................
ENSGGOP00000026587  .....................-GYGHTVPLSDGGKAFCIIYSVIGIPFT.LLF.L.......................
ENSGGOP00000003743  ...............nvrety----------------------------.---.-.......................
ENSGGOP00000005670  ................lysfa----------------------------.---.-.......................
ENSGGOP00000025319  ....................m----------------------------.---.-.......................
ENSGGOP00000003637  ................nireq----------------------------.---.-.......................
ENSGGOP00000010687  ........rrpvlyfhirwgf----------------------------.---.-.......................
ENSGGOP00000005951  ....................r----------------------------.---.-.......................
ENSGGOP00000013120  ....................a----------------------------.---.-.......................
ENSGGOP00000002078  ....................s-------QAFNVIVMVLICFQAIAMMID.TDV.-.......................
ENSGGOP00000008753  ................nireq----------------------------.---.-.......................
ENSGGOP00000018872  ..................raa----------------------------.---.-.......................
ENSGGOP00000017068  ..................raa----------------------------.---.-.......................
ENSGGOP00000028458  ................gsyvv----------------------------.---.-.......................
ENSGGOP00000025813  .................rldi----------------------------.---.-.......................
ENSGGOP00000019335  ...................ar----------------------------.---.-.......................
ENSGGOP00000001313  .........iflkwhvppelv----------------------------.---.-.......................
ENSGGOP00000027030  ...................ts----------------------------.---.-.......................
ENSGGOP00000012459  ................svyhv----------------------------.---.-.......................
ENSGGOP00000026172  ................svyhv----------------------------.---.-.......................
ENSGGOP00000017309  ..................gte----------------------------.---.-.......................
ENSGGOP00000018574  .........iflkwhvppelv----------------------------.---.-.......................
ENSGGOP00000004798  ...............rfiffv----------------------------.---.-.......................
ENSGGOP00000027211  ...............rfiffv----------------------------.---.-.......................
ENSGGOP00000018872  .....................--------------FFCMFYALLGIPLT.LVT.F.......................
ENSGGOP00000007946  ....................g----MTTPATVGGKIFLIFYGLVGCSST.ILF.-.......................
ENSGGOP00000009787  .................alla----------------------------.---.-.......................
ENSGGOP00000017068  .....................--------------FFCMFYALLGIPLT.LVT.F.......................
ENSGGOP00000012459  ...............lnedtg----------------------------.---.-.......................
ENSGGOP00000017225  ...................kr----------------------------.---.-.......................
ENSGGOP00000024508  ...................kr----------------------------.---.-.......................
ENSGGOP00000026172  ....................r----------------------------.---.-.......................
ENSGGOP00000007339  ...................sv---------FHMFILSMVTVDVIVAASN.YYK.G.......................
ENSGGOP00000012997  ...................ly----------------------------.---.-.......................
ENSGGOP00000016934  ...................sv---------FHMFILSMVTVDVIVAASN.YYK.G.......................
ENSGGOP00000009787  ...............lswlsm----------------------------.---.-.......................
ENSGGOP00000019335  .................vyyv----------------------------.---.-.......................
ENSGGOP00000010687  ..................ver----------------------------.---.-.......................
ENSGGOP00000007461  latierwedrprrsqvlqvlg----------------------------.---.-.......................
ENSGGOP00000005951  ....................n----------------------------.---.-.......................
ENSGGOP00000007454  ...........gtwqdpdkvr----------------------------.---.-.......................
ENSGGOP00000002078  ...................at--------FFQLFILISVLIDCVFMSLT.NLP.K.......................
ENSGGOP00000011478  ....................r----------------------------.---.-.......................
ENSGGOP00000027967  .....................------HYYFDYLGNLIALANLVTICVF.LVL.D.......................
ENSGGOP00000027288  .latierwedrprrsqvlqvl----------------------------.---.-.......................
ENSGGOP00000010343  .....................------HYYFDYLGNLIALANLVTICVF.LVL.D.......................
ENSGGOP00000021593  ..................kqe----------------------------.---.-.......................
ENSGGOP00000007339  .....................-------PWVHSLLRICAIISVISVCMN.TPM.T.......................
ENSGGOP00000016934  .....................-------PWVHSLLRICAIISVISVCMN.TPM.T.......................
ENSGGOP00000004744  ....................e----------------------------.---.-.......................
ENSGGOP00000010343  ....................y---SNVCQRTLSFTIFLILFLAFIETPS.SLT.Stadvryraa..............
ENSGGOP00000027967  ....................y---SNVCQRTLSFTIFLILFLAFIETPS.SLT.Stadvryraa..............
ENSGGOP00000025809  ....................q--------AFDISIMVLICLNMVTMMVE.KEG.-.......................
ENSGGOP00000024463  .....................----------------------------.---.-.......................
ENSGGOP00000002078  .....................--------WFKCFIGLVTLLSTGTLAFEdIYI.D.......................
ENSGGOP00000010207  ....................s-------KAFQYFMYLVVAVNGVWILVE.TFM.L.......................
ENSGGOP00000010203  ....................s-------KAFQYFMYLVVAVNGVWILVE.TFM.L.......................
ENSGGOP00000003957  ...................sh--------RFQVIIICLVVLDALLVLAE.LIL.Dlkiiqpd................
ENSGGOP00000011478  ..............raallqa----------------------------.---.-.......................
ENSGGOP00000010203  .................yvha----------------------------.---.-.......................
ENSGGOP00000010207  .................yvha----------------------------.---.-.......................
ENSGGOP00000001755  ........eiprstldsfmqp----------------------------.---.-.......................
ENSGGOP00000018945  ...................st----------------------------.---.-.......................
ENSGGOP00000022444  ................flaac----------------------------.---.-.......................
ENSGGOP00000018177  ...................hr---------FQVIIICLVVLDALLVLAE.LIL.Dlkiiqpd................
ENSGGOP00000003268  ................flaac----------------------------.---.-.......................
ENSGGOP00000001590  ...................fa---------FGIFGVFLVLLDVTLLLAD.LIFtD.......................
ENSGGOP00000020483  ................vgcev----------------------------.---.-.......................
ENSGGOP00000020927  ................vgcev----------------------------.---.-.......................
ENSGGOP00000001815  ................vgcev----------------------------.---.-.......................
ENSGGOP00000007339  .....ffkrtiallvlaqsvl--------------------------LS.VKW.D.......................
ENSGGOP00000001254  ....................f----------EHVGYLVILMNIFPFIIS.WIS.Q.......................
ENSGGOP00000000981  ....................s-------FAFGLFGVFLVLLDVTLVLAD.LIFtD.......................
ENSGGOP00000026559  ................fayig----------------------------.---.-.......................
ENSGGOP00000000982  ....................s-------FAFGIFGVFLVLLDVTLLLAD.LIFtD.......................
ENSGGOP00000009351  ................fayig----------------------------.---.-.......................
ENSGGOP00000014483  ...................ns------------FLVACVILVVILLTLE.LLI.Dikllqfs................
ENSGGOP00000023496  ...................ns------------FLVACVILVVILLTLE.LLI.Dikllqfs................
ENSGGOP00000016934  ....ffkrtiallvlaqsvll---------------------------S.VKW.D.......................
ENSGGOP00000016605  .............eiwmcivf----------------------------.---.-.......................
ENSGGOP00000014493  .................yeiw----------------------------.---.-.......................
ENSGGOP00000012367  ............yeiwmcivf----------------------------.---.-.......................
ENSGGOP00000027522  ............yeiwmcivf----------------------------.---.-.......................


                                                         40        50        60                     
                                                          |         |         |                     
d1orqc_               ..................LSGE...........YLVRLYLVDLILVIILWADYAYRAYKS..................
ENSGGOP00000011420  ...............gyqQSTS...........FTDPFFIVETLCIIWFSFEFLVRFFAC..................
ENSGGOP00000021753  ..................NSNI...........FTDPFFIVETLCIIWFSFELVVRFFAC..................
ENSGGOP00000000656  .............sgaraGASS...........FSDPFFVVETLCIIWFSFELLVRFFAC..................
ENSGGOP00000011744  angsgvmappsgptvaplLPRT...........LADPFFIVETTCVIWFTFELLVRFFAC..................
ENSGGOP00000003210  ..................LQETdefgqln....DNRQLAHVEAVCIAWFTMEYLLRFLSS..................
ENSGGOP00000027568  ..................-QFR...........FTDPFFLVETLCIVWFTFELLVRFSAC..................
ENSGGOP00000007168  ..........saphlensGHTI...........FNDPFFIVETVCIVWFSFEFVVRCFAC..................
ENSGGOP00000024337  ..........saphlensGHTI...........FNDPFFIVETVCIVWFSFEFVVRCFAC..................
ENSGGOP00000002688  ..................CGER...........FPQAFFCMDTACVLIFTGEYLLRLFAA..................
ENSGGOP00000009305  ..................LQVLdaegnrv....EHPTLENVETACIGWFTLEYLLRLFSS..................
ENSGGOP00000006737  ..................LQSLdefgqst....DNPQLAHVEAVCIAWFTMEYLLRFLSS..................
ENSGGOP00000015335  ..................REAE...........TEAFLTYIEGVCVVWFTFEFLMRVIFC..................
ENSGGOP00000015202  ..................CGER...........YSVAFFCLDTACVMIFTVEYLLRLFAA..................
ENSGGOP00000003820  ..................YEIE...........TDPALTYVEGVCVVWFTFEFLVRIVFS..................
ENSGGOP00000008219  ..................SQTM...........FTDPFFMVESTCIVWFTFELVLRFVVC..................
ENSGGOP00000022687  ..................YEIE...........TDPALTYVEGVCVVWFTFEFLVRIVFS..................
ENSGGOP00000013400  ........ngssqmpgnpPRLP...........FNDPFFVVETLCICWFSFELLVRLLVC..................
ENSGGOP00000027450  ..................REVE...........TEPILTYIEGVCVLWFTLEFLVRIVCC..................
ENSGGOP00000000227  ..................MQQHseqdeggpd..LRPILEHVEMLCIGFFTLEYLLRLAST..................
ENSGGOP00000012818  ..................REVE...........TEPILTYIEGVCVLWFTLEFLVRIVCC..................
ENSGGOP00000008276  ..................LSWL...........DLQLLEILEYVCISWFTGEFVLRFLCV..................
ENSGGOP00000019798  ..................REVE...........TEPILTYIEGVCVLWFTLEFLVRIVCC..................
ENSGGOP00000006085  ................tnVEVE...........TEPFLTYVEGVCVVWFTFEFLMRITFC..................
ENSGGOP00000000958  ..................FQNEdgev.......DDPVLEGVEIACIAWFTGELAVRLAAA..................
ENSGGOP00000002752  ..................GNPG...........EDPRFEIVEHFGIAWFTFELVARFAVA..................
ENSGGOP00000000831  ..................LREEeeqghcsq...MCHNVFIVESVCVGWFSLEFLLRLIQA..................
ENSGGOP00000002953  ..................EGVR...........DDPVLRRLEYFCIAWFSFEVSSRLLLA..................
ENSGGOP00000023230  ..................EGVR...........DDPVLRRLEYFCIAWFSFEVSSRLLLA..................
ENSGGOP00000001534  ..................QCSR...........KCYYIFIVETICVAWFSLEFCLRFVQA..................
ENSGGOP00000005162  ..................----...........--RSLFVLETVCVAWFSFEFLLRSLQA..................
ENSGGOP00000001664  ..................YSAGp..........GREPSGIIEAICIGWFTAECIVRFIVS..................
ENSGGOP00000025520  ..................YEKS...........SEGALYILEIVTIVVFGVEYFVRIWAAgcccryrgw.........
ENSGGOP00000016408  ..................LKETeegppatecgyACQPLAVVDLIVDIMFIVDILINFRTTyvnaneevvshpg.....
ENSGGOP00000020811  ..................YEKS...........SEGALYILEIVTIVVFGVEYFVRIWAAgcccryrgw.........
ENSGGOP00000008202  ..................YEKS...........SEGALYILEIVTIVVFGVEYFVRIWAAgcccryrgw.........
ENSGGOP00000012351  ..................LNDReeqkrrecgy.SCSPLNVVDLIVDIMFIIDILINFRTTyvnqneevvsdpa.....
ENSGGOP00000028732  ..................KTKQ...........NNIAWLVLDSVVDVIFLVDIVLNFHTTfvgpggevisdpk.....
ENSGGOP00000011126  ..................HTKL...........ASSCLLILEFVMIVVFGLEFIIRIWSA..................
ENSGGOP00000012234  ..................QRRV...........IRTILEYADKVFTYIFIMEMLLKWVAY..................
ENSGGOP00000024945  ..................QRRV...........IRTILEYADKVFTYIFIMEMLLKWVAY..................
ENSGGOP00000008980  ..................QRKT...........IRTILEYADKVFTYIFILEMLLKWTAY..................
ENSGGOP00000013052  ..................YAAL...........ATGTLFWMEIVLVVFFGTEYVVRLWSA..................
ENSGGOP00000012641  ..................ERKT...........IKVLLEYADKMFTYVFVLEMLLKWVAY..................
ENSGGOP00000028610  ..................KTRQ...........NNVAWLVVDSIVDVIFLVDIVLNFHTTfvgpagevisdpk.....
ENSGGOP00000006310  ..................QKPT...........VKALLEYTDRVFTFIFVFEMLLKWVAY..................
ENSGGOP00000001711  ..................YETV...........SGDWLLLLETFAIFIFGAEFALRIWAAgcccrykgw.........
ENSGGOP00000017557  ..................AGST...........ERIFLTVSNYIFTAIFVGEMTLKVVSL..................
ENSGGOP00000024463  ..................AGST...........ERIFLTVSNYIFTAIFVGEMTLKVVSL..................
ENSGGOP00000009882  ..................AGST...........ERIFLTVSNYIFTAIFVGEMTLKVVSL..................
ENSGGOP00000023204  ..................PHSA...........ERIFLTLSNYIFTAVFLAEMTVKVVAL..................
ENSGGOP00000003342  ..................PHSA...........ERIFLTLSNYIFTAVFLAEMTVKVVAL..................
ENSGGOP00000000352  ..................QRKT...........IKTMLEYADKVFTYIFILEMLLKWVAY..................
ENSGGOP00000028147  ..................QRKT...........IKTMLEYADKVFTYIFILEMLLKWVAY..................
ENSGGOP00000016440  ..................QRKT...........IKTMLEYADKVFTYIFILEMLLKWVAY..................
ENSGGOP00000008980  ..................QSKQ...........MENILYWINLVFVIFFTCECVLKMFAL..................
ENSGGOP00000024463  ..................QPEE...........LTNILEICNVVFTSMFALEMILKLAAF..................
ENSGGOP00000017557  ..................QPEE...........LTNILEICNVVFTSMFALEMILKLAAF..................
ENSGGOP00000001541  ..................TAREpsa........ARSPPSVCDLAVEVLFILDIVLNFRTTfvsksgqvvfapk.....
ENSGGOP00000009882  ..................QATE...........LTNILEICNVVFTSMFALEMILKLAAF..................
ENSGGOP00000013701  ..................PGST...........ERVFLSVSNYIFTAIFVAEMMVKVVAL..................
ENSGGOP00000021319  ..................PGST...........ERVFLSVSNYIFTAIFVAEMMVKVVAL..................
ENSGGOP00000027513  ..................PGST...........ERVFLSVSNYIFTAIFVAEMMVKVVAL..................
ENSGGOP00000023417  ..................QSEY...........VTTILSRINLVFIVLFTGECVLKLISL..................
ENSGGOP00000005331  ..................QSEY...........VTTILSRINLVFIVLFTGECVLKLISL..................
ENSGGOP00000025522  ..................LQSD...........YLEYWLILDYVSDIVYLIDMFVRTRTGyleqgllvkeel......
ENSGGOP00000013502  ..................LQSD...........YLEYWLILDYVSDIVYLIDMFVRTRTGyleqgllvkeel......
ENSGGOP00000025809  ..................RKKT...........IKIILEYADKIFTYIFILEMLLKWIAY..................
ENSGGOP00000024945  ..................QSQL...........KVDILYNINMIFIIIFTGECVLKMLAL..................
ENSGGOP00000012234  ..................QSQL...........KVDILYNINMIFIIIFTGECVLKMLAL..................
ENSGGOP00000000352  ..................QSQE...........MTNILYWINLVFIVLFTGECVLKLISL..................
ENSGGOP00000013701  ..................QPEE...........LTNALEISNIVFTSMFALEMLLKLLAC..................
ENSGGOP00000021319  ..................QPEE...........LTNALEISNIVFTSMFALEMLLKLLAC..................
ENSGGOP00000027513  ..................QPEE...........LTNALEISNIVFTSMFALEMLLKLLAC..................
ENSGGOP00000003602  ..................EDDSns.........TNHNLEKVEYAFLIIFTVETFLKIIAY..................
ENSGGOP00000017118  ..................DDLS...........TTRSTTVSDIAVEILFIIDIILNFRTTyvsksgqvifear.....
ENSGGOP00000016440  ..................QGKY...........MTLVLSRINLVFIVLFTGEFVLKLVSL..................
ENSGGOP00000015188  ..................GDDDtpi........TSRHTLVSDIAVEMLFILDIILNFRTTyvsqsgqvisapr.....
ENSGGOP00000019923  ..................QPQW...........LTHLLYYAEFLFLGLFLLEMSLKMYGM..................
ENSGGOP00000003342  ..................QPEE...........LTNALEISNIVFTSLFALEMLLKLLVY..................
ENSGGOP00000023204  ..................QPEE...........LTNALEISNIVFTSLFALEMLLKLLVY..................
ENSGGOP00000010829  ..................QPQW...........LTHLLYYAEFLFLGLFLLEMSLKMYGM..................
ENSGGOP00000027293  ..................----...........-------------VVFGLEFIIRIWSA..................
ENSGGOP00000026337  ..................LQKG...........YYLVWLVLDYVSDVVYIADLFIRLRTGfleqgllvkdtk......
ENSGGOP00000012641  ..................QSPE...........KINILAKINLLFVAIFTGECIVKLAAL..................
ENSGGOP00000026186  ..................FKDE...........NTTPWIVFNVVSDTFFLIDLVLNFRTGivvednteiildpq....
ENSGGOP00000008627  ..................FKDE...........NTTPWIVFNVVSDTFFLIDLVLNFRTGivvednteiildpq....
ENSGGOP00000012593  ..................LQKG...........YYLVWLVLDYVSDVVYIADLFIRLRTGfleqgllvkdtk......
ENSGGOP00000013701  ..................CGSE...........RCNILEAFDAFIFAFFAVEMVIKMVALglf...............
ENSGGOP00000021319  ..................CGSE...........RCNILEAFDAFIFAFFAVEMVIKMVALglf...............
ENSGGOP00000022082  ..................QSCL...........FKIAMNILNMLFTGLFTVEMILKLIAF..................
ENSGGOP00000028147  ..................QSQE...........MTNILYWINLVFIVLFTGECVLKLISL..................
ENSGGOP00000000898  ..................EDDSnt.........ANHNLEQVEYVFLVIFTVETVLKIVAY..................
ENSGGOP00000022765  ..................LQSE...........YLMLWLVLDYSADVLYVLDVLVRARTGfleqglmvsdtn......
ENSGGOP00000003013  ..................LQSE...........YLMLWLVLDYSADVLYVLDVLVRARTGfleqglmvsdtn......
ENSGGOP00000006428  ..................QPKA...........MKSILDHLNWVFVVIFTLECLIKIFAL..................
ENSGGOP00000006310  ..................QSEE...........KTKILGKINQFFVAVFTGECVMKMFAL..................
ENSGGOP00000017309  ..................QPEW...........LSDFLYYAEFIFLGLFMSEMFIKMYGL..................
ENSGGOP00000015727  ..................FKEE...........NSPPWIVFNVLSDTFFLLDLVLNFRTGivveegaeillapr....
ENSGGOP00000008481  ..................QPEW...........LSDFLYYAEFIFLGLFMSEMFIKMYGL..................
ENSGGOP00000006428  ..................NQPK...........IQELLNCTDIIFTHIFILEMVLKWVAF..................
ENSGGOP00000004729  ..................QPRR...........LTTALYFAEFVFLGLFLTEMSLKMYGL..................
ENSGGOP00000003342  ..................CDSQ...........RCRILQAFDDFIFAFFAVEMVVKMVALgif...............
ENSGGOP00000001513  ..................FTEQ...........TTTPWIIFNVASDTVFLLDLIMNFRTGtvnedsseiildpk....
ENSGGOP00000021823  ..................EDDSnt.........ANHNLEQVEYVFLVIFTVETVLKIVAY..................
ENSGGOP00000021537  ..................FKDE...........NTTPWIVFNVVSDTFFLIDLVLNFRTGivvednteiildpq....
ENSGGOP00000018103  ..................IDSSnpiescqnf..YKDFTLQIDMAFNVFFLLYFGLRFIAA..................
ENSGGOP00000003602  ..................QSKM...........FNDAMDILNMVFTGVFTVEMVLKVIAF..................
ENSGGOP00000013701  ..................QPKS...........LDEALKYCNYVFTIVFVFEAALKLVAF..................
ENSGGOP00000021319  ..................QPKS...........LDEALKYCNYVFTIVFVFEAALKLVAF..................
ENSGGOP00000027513  ..................QPKS...........LDEALKYCNYVFTIVFVFEAALKLVAF..................
ENSGGOP00000002713  ..................QPHW...........LTEVQDTANKALLALFTAEMLLKMYSL..................
ENSGGOP00000002713  ..................QSCL...........FKIAMNILNMLFTGLFTVEMILKLIAF..................
ENSGGOP00000000898  ..................QTAP...........FNYAMDILNMVFTGLFTIEMVLKIIAF..................
ENSGGOP00000005331  ..................QRKT...........IKTMLEYADKVFTYIFILEMLLKWVAY..................
ENSGGOP00000021823  ..................QTAP...........FNYAMDILNMVFTGLFTIEMVLKIIAF..................
ENSGGOP00000001185  ..................QPLW...........LTRLQDIANRVLLSLFTVEMLMKMYGL..................
ENSGGOP00000008481  ..................ASVA...........YENALRVFNIVFTSLFSLECVLKVMAF..................
ENSGGOP00000001185  ..................QSEQ...........MNHISDILNVAFTIIFTLEMILKLMAF..................
ENSGGOP00000023924  ..................QSEQ...........MNHISDILNVAFTIIFTLEMILKLMAF..................
ENSGGOP00000022383  ..................FKEE...........NSPPWIVFNVLSDTFFLLDLVLNFRTGivveegaeillapr....
ENSGGOP00000023204  ..................DSQR...........CRILHQAFDDFIFAFFAVEMVVKMVALgif...............
ENSGGOP00000023417  ..................QRKT...........IKTMLEYADKVFTYIFILEMLLKWVAY..................
ENSGGOP00000024463  ..................QPTS...........LETALKYCNYMFTTVFVLEAVLKLVAF..................
ENSGGOP00000016442  ..................----...........---------------------------..................
ENSGGOP00000009882  ..................QPTS...........LETALKYCNYMFTTVFVLEAVLKLVAF..................
ENSGGOP00000019923  ..................APCT...........YELALKYLNIAFTMVFSLECVLKVIAF..................
ENSGGOP00000017309  ..................ASVA...........YENALRVFNIVFTSLFSLECVLKVMAF..................
ENSGGOP00000017557  ..................QPTS...........LETALKYCNYMFTTVFVLEAVLKLVAF..................
ENSGGOP00000010829  ..................APCT...........YELALKYLNIAFTMVFSLECVLKVIAF..................
ENSGGOP00000001185  ..................ADSM...........RNQILKHFDIGFTSVFTVEIVLKMTTYgaf...............
ENSGGOP00000019172  ..................----...........---------------------------..................
ENSGGOP00000019923  ..................TNSE...........RNKVLRYFDYVFTGVFTFEMVIKMIDQ..................
ENSGGOP00000003342  ..................QPQI...........LDEALKICNYIFTVIFVLESVFKLVAF..................
ENSGGOP00000023204  ..................QPQI...........LDEALKICNYIFTVIFVLESVFKLVAF..................
ENSGGOP00000008481  ..................DDDKtp.........MSERLDDTEPYFIGIFCFEAGIKIIAL..................
ENSGGOP00000000501  ..................----...........-----------FNVFFLLYFGLRFIAA..................
ENSGGOP00000023924  ..................ADSM...........RNQILKHFDIGFTSVFTVEIVLKMTTYgaf...............
ENSGGOP00000004729  ..................TDSP...........RNNALKYLDYIFTGVFTFEMVIKMIDL..................
ENSGGOP00000027513  ..................CGSE...........RCNIAEAFDAFIFAFFAVEMVIKMVALglf...............
ENSGGOP00000010829  ..................TNSE...........RNKVLRYFDYVFTGVFTFEMVIKMIDQ..................
ENSGGOP00000004729  ..................APYE...........YELMLKCLNIVFTSMFSMECVLKIIAF..................
ENSGGOP00000001185  ..................EDDNns.........LNLGLEKLEYFFLIVFSIEAAMKIIAY..................
ENSGGOP00000023924  ..................EDDNns.........LNLGLEKLEYFFLIVFSIEAAMKIIAY..................
ENSGGOP00000000352  ..................MTEQ...........FSSVLSVGNLVFTGIFTAEMFLKIIAM..................
ENSGGOP00000007211  ..................HQEL...........ANECLLILEFVMIVVFGLEYIVRVWSA..................
ENSGGOP00000028147  ..................MTEQ...........FSSVLSVGNLVFTGIFTAEMFLKIIAM..................
ENSGGOP00000020299  ..................QSKM...........FNDAMDILNMVFTGVFTVEMVLKVIAF..................
ENSGGOP00000013354  ..................VEIR...........GEWYFMALDSIFFCIYVVEALLKIIAL..................
ENSGGOP00000008980  ..................MTPQ...........FEHVLAVGNLVFTGIFTAEMFLKLIAM..................
ENSGGOP00000010829  ..................DDKTp..........MSRRLEKTEPYFIGIFCFEAGIKIVAL..................
ENSGGOP00000024945  ..................MTEH...........FDNVLTVGNLVFTGIFTAEMVLKLIAM..................
ENSGGOP00000012234  ..................MTEH...........FDNVLTVGNLVFTGIFTAEMVLKLIAM..................
ENSGGOP00000021390  ..................HQEL...........ANECLLILEFVMIVVFGLEYIVRVWSA..................
ENSGGOP00000023417  ..................MTDH...........FNNVLTVGNLVFTGIFTAEMFLKIIAM..................
ENSGGOP00000005331  ..................MTDH...........FNNVLTVGNLVFTGIFTAEMFLKIIAM..................
ENSGGOP00000002713  ..................----...........-------VEYLFLIIFTVEAFLKVIAY..................
ENSGGOP00000020299  ..................QPDW...........LTQIQDIANKVLLALFTCEMLVKMYSL..................
ENSGGOP00000003602  ..................QPDW...........LTQIQDIANKVLLALFTCEMLVKMYSL..................
ENSGGOP00000012641  ..................MTSE...........FEEMLQVGNLVFTGIFTAEMTFKIIAL..................
ENSGGOP00000010638  ..................LQHG...........YLVAWLVLDYTSDLLYLLDMVVRFHTGfleqgilvvdkg......
ENSGGOP00000020299  ..................----...........-PAFLEKVEYAFLIIFTVETFLKIIAY..................
ENSGGOP00000004729  ..................GDKTp..........MSERLDDTEPYFIGIFCFEAGIKIIAL..................
ENSGGOP00000016440  ..................---N...........PPDWTKNVEYTFTGIYTFESLIKILAR..................
ENSGGOP00000025809  ..................MTEE...........FKNVLAIGNLVFTGIFAAEMVLKLIAM..................
ENSGGOP00000006736  ..................FKDE...........TTALWIVFNVVSDTFFLMDLVLNFRTGiviednteiildpe....
ENSGGOP00000022082  ..................----...........-------VEYLFLIIFTVEAFLKVIAY..................
ENSGGOP00000000352  ..................---N...........PPDWTKNVEYTFTGIYTFESLIKILAR..................
ENSGGOP00000005331  ..................---N...........PPDWTKNVEYTFTGIYTFESLIKIIAR..................
ENSGGOP00000008980  ..................---N...........PPDWSKNVEYTFTGIYTFESLVKIIAR..................
ENSGGOP00000012641  ..................AQHD...........PPPWTKYVEYTFTAIYTFESLVKILAR..................
ENSGGOP00000000898  ..................QPVW...........LTQIQEYANKVLLCLFTVEMLLKLYGL..................
ENSGGOP00000028147  ..................---N...........PPDWTKNVEYTFTGIYTFESLIKILAR..................
ENSGGOP00000003602  ..................SHSF...........RNTILGYFDYAFTAIFTVEILLKMTTFgaf...............
ENSGGOP00000023417  ..................---N...........PPDWTKNVEYTFTGIYTFESLIKIIAR..................
ENSGGOP00000006310  ..................----...........-----EKIEYVFTVIYTFEALIKILAR..................
ENSGGOP00000006310  ..................MSPT...........FEAMLQIGNIVFTIFFTAEMVFKIIAF..................
ENSGGOP00000020299  ..................SHSF...........RNTILGYFDYAFTAIFTVEILLKMTTFgaf...............
ENSGGOP00000023924  ..................QPLW...........LTRLQDIANRVLLSLFTVEMLMKMYGL..................
ENSGGOP00000011260  ..................INSAdpvgscss...YEDKTIPIDLVFNAFFSFYFGLRFMAA..................
ENSGGOP00000012234  ..................----...........--PWSKNVEYTFTGIYTFESLIKILAR..................
ENSGGOP00000024945  ..................----...........--PWSKNVEYTFTGIYTFESLIKILAR..................
ENSGGOP00000021823  ..................QPVW...........LTQIQEYANKVLLCLFTVEMLLKLYGL..................
ENSGGOP00000021823  ..................AHSF...........RNHILGYFDYAFTSIFTVEILLKMTVFgaf...............
ENSGGOP00000008481  ..................PNAP...........RNNVLRYFDYVFTGVFTFEMVIKMIDL..................
ENSGGOP00000000898  ..................AHSF...........RNHILGYFDYAFTSIFTVEILLKMTVFgaf...............
ENSGGOP00000017309  ..................PNAP...........RNNVLRYFDYVFTGVFTFEMVIKMIDL..................
ENSGGOP00000016440  ..................MTEQ...........FSSVLTVGNLVFTGIFTAEMVLKIIAM..................
ENSGGOP00000022082  ..................QPHW...........LTEVQDTANKALLALFTAEMLLKMYSL..................
ENSGGOP00000009838  ..................QTAD...........NIHYWLIADIICDIIYLYDMLFIQPRLqfvrggdiivdsd.....
ENSGGOP00000006428  ..................--NS...........NSNSTDIAECVFTGIYIFEALIKILAR..................
ENSGGOP00000005127  ..................----...........---------------------------..................
ENSGGOP00000016918  ..................----...........---------------------------..................
ENSGGOP00000001687  ..................----...........---------------------------..................
ENSGGOP00000015184  ..................----...........---------------------------..................
ENSGGOP00000017557  ..................DMDClsd........RCKILQVFDDFIFIFFAMEMVLKMVALgif...............
ENSGGOP00000022082  ..................HTSF...........RNHILGNADYVFTSIFTLEIILKMTAYgaf...............
ENSGGOP00000006428  ..................MEAS...........FEKMLNIGNLVFTSIFIAEMCLKIIAL..................
ENSGGOP00000027687  ..................----...........---------------------------..................
ENSGGOP00000002713  ..................----...........------NADYVFTSIFTLEIILKMTAYgaf...............
ENSGGOP00000007339  ..................RRVM...........HAPTLQIAEYVFVIFMSIELNLKIMAD..................
ENSGGOP00000016934  ..................RRVM...........HAPTLQIAEYVFVIFMSIELNLKIMAD..................
ENSGGOP00000025319  ..................----...........---------------------------..................
ENSGGOP00000025813  ..................----...........---------------------------..................
ENSGGOP00000003047  ..................----...........---------------------------..................
ENSGGOP00000025809  ..................---N...........PADWTKNVEYTFTGIYTFESLVKILAR..................
ENSGGOP00000008617  ..................----...........---------------------------..................
ENSGGOP00000012511  ..................----...........---------------------------..................
ENSGGOP00000005228  ..................----...........---------------------------..................
ENSGGOP00000024187  ..................----...........---------------------------..................
ENSGGOP00000007461  ..................----...........---------------------------..................
ENSGGOP00000016722  ..................QTPD...........NIHLWLLMDYLCDLIYFLDITVFQTRLqfvrggdiitdkk.....
ENSGGOP00000027288  ..................----...........---------------------------..................
ENSGGOP00000005376  ..................----...........---------------------------..................
ENSGGOP00000006442  ..................LDQK...........HYELFSTIDDIVLTILLCEVLLGWLNG..................
ENSGGOP00000024150  ..................----...........---------------------------..................
ENSGGOP00000001687  ..................----...........---------------------------..................
ENSGGOP00000009882  ..................DMDClsd........RCKILQVFDDFIFIFFAMEMVLKMVALgif...............
ENSGGOP00000003047  ..................----...........---------------------------..................
ENSGGOP00000002078  ..................MSKQ...........TNTLLNIGNLVFIGIFTAEMIFKIIAM..................
ENSGGOP00000027711  ..................----...........---------------------------..................
ENSGGOP00000000658  ..................----...........---------------------------..................
ENSGGOP00000019229  ..................----...........---------------------------..................
ENSGGOP00000000546  ..................----...........---------------------------..................
ENSGGOP00000007454  ..................----...........---------------------------..................
ENSGGOP00000024187  ..................----...........---------------------------..................
ENSGGOP00000018574  ..................----...........---------------------------..................
ENSGGOP00000001313  ..................----...........---------------------------..................
ENSGGOP00000022306  ..................----...........---------------------------..................
ENSGGOP00000006045  ..................ESTNtklwp......LKLTLEVAAWFILLIFIQEILLKWLSN..................
ENSGGOP00000026587  ..................TAVV...........---------------------------..................
ENSGGOP00000003743  ..................----...........---------------------------..................
ENSGGOP00000005670  ..................----...........---------------------------..................
ENSGGOP00000025319  ..................----...........---------------------------..................
ENSGGOP00000003637  ..................----...........---------------------------..................
ENSGGOP00000010687  ..................----...........---------------------------..................
ENSGGOP00000005951  ..................----...........---------------------------..................
ENSGGOP00000013120  ..................----...........---------------------------..................
ENSGGOP00000002078  ..................KSLQ...........MSIALYWINSIFVMLYTMECILKLIAF..................
ENSGGOP00000008753  ..................----...........---------------------------..................
ENSGGOP00000018872  ..................----...........---------------------------..................
ENSGGOP00000017068  ..................----...........---------------------------..................
ENSGGOP00000028458  ..................----...........---------------------------..................
ENSGGOP00000025813  ..................----...........---------------------------..................
ENSGGOP00000019335  ..................----...........---------------------------..................
ENSGGOP00000001313  ..................----...........---------------------------..................
ENSGGOP00000027030  ..................----...........---------------------------..................
ENSGGOP00000012459  ..................----...........---------------------------..................
ENSGGOP00000026172  ..................----...........---------------------------..................
ENSGGOP00000017309  ..................----...........---------------------------..................
ENSGGOP00000018574  ..................----...........---------------------------..................
ENSGGOP00000004798  ..................----...........---------------------------..................
ENSGGOP00000027211  ..................----...........---------------------------..................
ENSGGOP00000018872  ..................QSLG...........ERLNA----------------------..................
ENSGGOP00000007946  ..................----...........---------------------------..................
ENSGGOP00000009787  ..................----...........---------------------------..................
ENSGGOP00000017068  ..................QSLG...........ERLNA----------------------..................
ENSGGOP00000012459  ..................----...........---------------------------..................
ENSGGOP00000017225  ..................----...........---------------------------..................
ENSGGOP00000024508  ..................----...........---------------------------..................
ENSGGOP00000026172  ..................----...........---------------------------..................
ENSGGOP00000007339  ..................ENFRr..........QYDEFYLAEVAFTVLFDLEALLKIWCL..................
ENSGGOP00000012997  ..................----...........---------------------------..................
ENSGGOP00000016934  ..................ENFRr..........QYDEFYLAEVAFTVLFDLEALLKIWCL..................
ENSGGOP00000009787  ..................----...........---------------------------..................
ENSGGOP00000019335  ..................----...........---------------------------..................
ENSGGOP00000010687  ..................----...........---------------------------..................
ENSGGOP00000007461  ..................----...........---------------------------..................
ENSGGOP00000005951  ..................----...........---------------------------..................
ENSGGOP00000007454  ..................----...........---------------------------..................
ENSGGOP00000002078  ..................WRPD...........L-------LNTLLGIYTFEILVKLFAR..................
ENSGGOP00000011478  ..................----...........---------------------------..................
ENSGGOP00000027967  ..................ADVLpaer.......DDFILGILNCVFIVYYLLEMLLKVFAL..................
ENSGGOP00000027288  ..................----...........---------------------------..................
ENSGGOP00000010343  ..................ADVLpaer.......DDFILGILNCVFIVYYLLEMLLKVFAL..................
ENSGGOP00000021593  ..................----...........---------------------------..................
ENSGGOP00000007339  ..................FEHYpp.........LQYVTFTLDTLLMFLYTAEMIAKMHIR..................
ENSGGOP00000016934  ..................FEHYpp.........LQYVTFTLDTLLMFLYTAEMIAKMHIR..................
ENSGGOP00000004744  ..................----...........---------IFFVSICTSELSMKVYVD..................
ENSGGOP00000010343  ..................PWEP...........PCGLTESVEVLCLLVFAADLSVKGYLF..................
ENSGGOP00000027967  ..................PWEP...........PCGLTESVEVLCLLVFAADLSVKGYLF..................
ENSGGOP00000025809  ..................QSQH...........MTEVLYWINVVFIILFTGECVLKLISL..................
ENSGGOP00000024463  ..................----...........---------------------------..................
ENSGGOP00000002078  ..................QRKT...........IKILLEYADMIFTYIFILEMLLKWMAY..................
ENSGGOP00000010207  ..................KGGNf..........FSKHVPWSYLVFLTIYGVELFLKVAGL..................
ENSGGOP00000010203  ..................KGGNf..........FSKHVPWSYLVFLTIYGVELFLKVAGL..................
ENSGGOP00000003957  ..................KNNY...........AAMVFHYMSITILVFFMMEIIFKLFVF..................
ENSGGOP00000011478  ..................----...........---------------------------..................
ENSGGOP00000010203  ..................----...........------TLELFALMVVVFELCMKLRWL..................
ENSGGOP00000010207  ..................----...........------TLELFALMVVVFELCMKLRWL..................
ENSGGOP00000001755  ..................----...........---------------------------..................
ENSGGOP00000018945  ..................----...........---------------------------..................
ENSGGOP00000022444  ..................----...........-----EIIFCFFILYYVVEEILEIRIH..................
ENSGGOP00000018177  ..................KNNY...........AAMVFHYMSITILVFFMMEIIFKLFVF..................
ENSGGOP00000003268  ..................----...........-----EIIFCFFILYYVVEEILEIRIH..................
ENSGGOP00000001590  ..................SKLY...........IPLEYRSISLAIALFFLMDVLLRVFVE..................
ENSGGOP00000020483  ..................----...........-------IFCVFIFYYVVEEILELHIH..................
ENSGGOP00000020927  ..................----...........-------IFCVFIFYYVVEEILELHIH..................
ENSGGOP00000001815  ..................----...........-------IFCVFIFYYVVEEILELHIH..................
ENSGGOP00000007339  ..................VEDP...........VTVPLATMSVVFTFIFVLEVTLKML--..................
ENSGGOP00000001254  ..................LNVI...........YHSELKHTNYCFLTLYILEALLKIAAM..................
ENSGGOP00000000981  ..................SKLY...........IPLEYRSISLAIALFFLMDVLLRVFVE..................
ENSGGOP00000026559  ..................----...........---------------------------..................
ENSGGOP00000000982  ..................SKLY...........IPLEYRSISLAIALFFLMDVLLRVFVE..................
ENSGGOP00000009351  ..................----...........---------------------------..................
ENSGGOP00000014483  ..................SAFQ...........FAGVIHWISLVILSVFFSETVLRIVVL..................
ENSGGOP00000023496  ..................SAFQ...........FAGVIHWISLVILSVFFSETVLRIVVL..................
ENSGGOP00000016934  ..................VEDP...........VTVPLATMSVVFTFIFVLEHVILIILLsravflkykeekcpmirt
ENSGGOP00000016605  ..................----...........---------------------------..................
ENSGGOP00000014493  ..................----...........---------------------------..................
ENSGGOP00000012367  ..................----...........---------------------------..................
ENSGGOP00000027522  ..................----...........---------------------------..................


                                      70              80         90                                 
                                       |               |          |                                 
d1orqc_               ..GDP.........AGYVK...K...TLYEIPAL.VPAGLLALIE.....................G...HLAG....
ENSGGOP00000011420  ..PSK.........AGFFT...Nim.NIIDIVAI.IPYFITLGTElaekpedaqq...........G...---Qqams
ENSGGOP00000021753  ..PSK.........TDFFK...Nim.NFIDIVAI.IPYFITLGTEiaeqegnqkgeqa........T...SLAI....
ENSGGOP00000000656  ..PSK.........ATFSR...Nim.NLIDIVAI.IPYFITLGTElaerqgn..............G...Q--Qamsl
ENSGGOP00000011744  ..PSK.........AGFSR...Nim.NIIDVVAI.FPYFITLGTElaeqqpggggggqn.......G...---Qqams
ENSGGOP00000003210  ..PNK.........WKFFKg..Pl..NVIDLLAI.LPYYVTIFLTesnksvlqfq...........N...VRRV....
ENSGGOP00000027568  ..PSK.........PAFFR...Nim.NIIDLVAI.FPYFITLGTElvqqrgggqn...........G...---Qqams
ENSGGOP00000007168  ..PSQ.........ALFFK...Nim.NIIDIVSI.LPYFITLGTDlaqqqgggng...........Q...---Qqqam
ENSGGOP00000024337  ..PSQ.........ALFFK...Nim.NIIDIVSI.LPYFITLGTDlaqqqgggng...........Q...---Qqqam
ENSGGOP00000002688  ..PSR.........CRFLR...Svm.SLIDVVAI.LPYYIGLLVPknd..................D...VSGA....
ENSGGOP00000009305  ..PNK.........LHFAL...Sfm.NIVDVLAI.LPFYVSLTLThlgarmmelt...........N...VQQA....
ENSGGOP00000006737  ..PKK.........WKFFKg..Pl..NAIDLLAI.LPYYVTIFLTesnksvlqfq...........N...VRRV....
ENSGGOP00000015335  ..PNK.........VEFIKn..Sl..NIIDFVAI.LPFYLEVGLSglsskaak.............D...VLGF....
ENSGGOP00000015202  ..PSR.........YRFIR...Svm.SIIDVVAI.MPYYIGLVMTnne..................D...VSGA....
ENSGGOP00000003820  ..PNK.........LEFIK...Nll.NIIDFVAI.LPFYLEVGLSglsskaak.............D...VLGF....
ENSGGOP00000008219  ..PSK.........TDFFR...Nim.NIIDIISI.IPYFATLITElvqetepsaqqn.........M...SLAI....
ENSGGOP00000022687  ..PNK.........LEFIK...Nll.NIIDFVAI.LPFYLEVGLSglsskaak.............D...VLGF....
ENSGGOP00000013400  ..PSK.........AIFFK...Nvm.NLIDFVAI.LPYFVALGTElarqrgvgqq...........A...---Mslai
ENSGGOP00000027450  ..PDT.........LDFVK...Nll.NIIDFVAI.LPFYLEVGLSglsskaar.............D...VLGF....
ENSGGOP00000000227  ..PDL.........RRFAR...Sal.NLVDLVAI.LPLYLQLLLEcftgedhqrgqtvgsvg....K...VGQV....
ENSGGOP00000012818  ..PDT.........LDFVK...Nll.NIIDFVAI.LPFYLEVGLSglsskaar.............D...VLGF....
ENSGGOP00000008276  ..RDR.........CRFLR...Kvp.NIIDLLAI.LPFYITLLVEslsgsqttqele.........N...VGRI....
ENSGGOP00000019798  ..PDT.........LDFVK...Nll.NIIDFVAI.LPFYLEVGLSglsskaar.............D...VLGF....
ENSGGOP00000006085  ..PDK.........VEFLK...Ssl.NIIDCVAI.LPFYLEVGLSglsskaak.............D...VLGF....
ENSGGOP00000000958  ..PCQ.........KKFWKn..Pl..NIIDFVSI.IPFYATLAVDtkeeesedie...........N...MGKV....
ENSGGOP00000002752  ..PDF.........LKFFK...Nal.NLIDLMSI.VPFYITLVVNlvvestptla...........N...LGRV....
ENSGGOP00000000831  ..PSK.........FAFLR...Spl.TLIDLVAI.LPYYITLLVDgaaagrrkpgagnsyld....K...VGLV....
ENSGGOP00000002953  ..PST.........RNFFCh..Pl..NLIDIVSV.LPFYLTLLAGvalgdqggkefg.........H...LGKV....
ENSGGOP00000023230  ..PST.........RNFFCh..Pl..NLIDIVSV.LPFYLTLLAGvalgdqggkefg.........H...LGKV....
ENSGGOP00000001534  ..QDK.........CQFFQg..Pl..NIIDILAI.SPYYVSLAVSeeppedgerlsgssyle....K...VGLV....
ENSGGOP00000005162  ..ESK.........CAFLRa..Pl..NIIDILAL.LPFYVSLLLGlaagpggtklle.........R...AGLV....
ENSGGOP00000001664  ..KNK.........CEFVKr..Pl..NIIDLLAI.TPYYISVLMTvftgensqlq...........R...AGVT....
ENSGGOP00000025520  ..RGR.........LKFARk..Pf..CVIDIMVL.IASIAVLAAG.....................S...QGNVfats
ENSGGOP00000016408  ..RIA.........VHYFKg..W...FLIDMVAA.IPFDLLIFGS.....................G...SEEL....
ENSGGOP00000020811  ..RGR.........LKFARk..Pf..CVIDIMVL.IASIAVLAAG.....................S...QGNVfats
ENSGGOP00000008202  ..RGR.........LKFARk..Pf..CVIDIMVL.IASIAVLAAG.....................S...QGNVfats
ENSGGOP00000012351  ..KIA.........IHYFKg..W...FLIDMVAA.IPFDLLIFGSgsd..................E...TTTL....
ENSGGOP00000028732  ..LIR.........MNYLKt..W...FVIDLLSC.LPYDIINAFE.....................N...VDEGissl
ENSGGOP00000011126  ..GCCcryrgwqgrLRFARk..Pf..CVIDTIVL.IASIAVVSAK.....................T...QGNIfats
ENSGGOP00000012234  ..GFK.........VYFTNa..W...CWLDFLIV.DVSIISLVANwlgy.................S...ELGP....
ENSGGOP00000024945  ..GFK.........VYFTNa..W...CWLDFLIV.DVSIISLVANwlgy.................S...ELGP....
ENSGGOP00000008980  ..GFV.........KFFTNa..W...CWLDFLIV.AVSLVSLIANalgy.................S...ELGA....
ENSGGOP00000013052  ..GCRskyvglwgrLRFARk..Pi..SIIDLIVV.VASMVVLCVG.....................S...KGQVfats
ENSGGOP00000012641  ..GFK.........KYFTNa..W...CWLDFLIV.DVSLVSLVAN.....................T...LGFAemgp
ENSGGOP00000028610  ..LIR.........MNYLKt..W...FVIDLLSC.LPYDVINAFE.....................N...VDEVsafm
ENSGGOP00000006310  ..GFR.........KYFTNa..W...CWLDFLIV.NISLISLTAKiley.................S...EVAP....
ENSGGOP00000001711  ..RGR.........LKFARk..Pl..CMLDIFVL.IASVPVVAVG.....................N...QGNVlats
ENSGGOP00000017557  ..GLYfge......QAYLRss.W...NVLDGFLV.FVSIIDIVVSlasagga..............K...ILGV....
ENSGGOP00000024463  ..GLYfge......QAYLRss.W...NVLDGFLV.FVSIIDIVVSlasagga..............K...ILGV....
ENSGGOP00000009882  ..GLYfge......QAYLRss.W...NVLDGFLV.FVSIIDIVVSlasagga..............K...ILGV....
ENSGGOP00000023204  ..GWCfge......QAYLRss.W...NVLDGLLV.LISVIDILVSmvsdsgt..............K...ILGM....
ENSGGOP00000003342  ..GWCfge......QAYLRss.W...NVLDGLLV.LISVIDILVSmvsdsgt..............K...ILGM....
ENSGGOP00000000352  ..GFQ.........VYFTNa..W...CWLDFLIV.DVSLVSLTANalgy.................S...ELGA....
ENSGGOP00000028147  ..GFQ.........VYFTNa..W...CWLDFLIV.DVSLVSLTANalgy.................S...ELGA....
ENSGGOP00000016440  ..GFQ.........TYFTNa..W...CWLDFLIV.DVSLVSLVANalgy.................S...ELGA....
ENSGGOP00000008980  ..RHY.........YFTIG...W...NIFDFVVV.ILSIVGMFLAdiiekyf..............V...SPTL....
ENSGGOP00000024463  ..GLF.........DYLRN...Py..NIFDSIIV.IISIWEIVGQ.....................A...D-GG....
ENSGGOP00000017557  ..GLF.........DYLRN...Py..NIFDSIIV.IISIWEIVGQ.....................A...D-GG....
ENSGGOP00000001541  ..SIC.........LHYVTt..W...FLLDVIAA.LPFDLLHAFKv....................N...VYFG....
ENSGGOP00000009882  ..GLF.........DYLRN...Py..NIFDSIIV.IISIWEIVGQ.....................A...D-GG....
ENSGGOP00000013701  ..GLLsgeh.....AYLQSs..W...NLLDGLLV.LVSLVDIVVAmasagga..............K...ILGV....
ENSGGOP00000021319  ..GLLsgeh.....AYLQSs..W...NLLDGLLV.LVSLVDIVVAmasagga..............K...ILGV....
ENSGGOP00000027513  ..GLLsgeh.....AYLQSs..W...NLLDGLLV.LVSLVDIVVAmasagga..............K...ILGV....
ENSGGOP00000023417  ..RHY.........YFTIG...W...NIFDFVVV.ILSIVGMFLAeliekyf..............V...SPTL....
ENSGGOP00000005331  ..RHY.........YFTIG...W...NIFDFVVV.ILSIVGMFLAeliekyf..............V...SPTL....
ENSGGOP00000025522  ..KLI.........NKYKS...Nlq.FKLDVLSL.IPTDLLYFK-.....................-...LGWN....
ENSGGOP00000013502  ..KLI.........NKYKS...Nlq.FKLDVLSL.IPTDLLYFK-.....................-...LGWN....
ENSGGOP00000025809  ..GYK.........TYFTNa..W...CWLDFLIV.DVSLVTLVANtlgy.................S...DLGP....
ENSGGOP00000024945  ..RQY.........YFTVG...W...NIFDFVVV.ILSIVGLALSdliqkyf..............V...SPTL....
ENSGGOP00000012234  ..RQY.........YFTVG...W...NIFDFVVV.ILSIVGLALSdliqkyf..............V...SPTL....
ENSGGOP00000000352  ..RYY.........YFTIG...W...NIFDFVVV.ILSIVGMFLAeliekyf..............V...SPTL....
ENSGGOP00000013701  ..GPL.........GYIRN...Py..NIFDGIIV.VISVWEIVGQ.....................-...ADGG....
ENSGGOP00000021319  ..GPL.........GYIRN...Py..NIFDGIIV.VISVWEIVGQ.....................-...ADGG....
ENSGGOP00000027513  ..GPL.........GYIRN...Py..NIFDGIIV.VISVWEIVGQ.....................-...ADGG....
ENSGGOP00000003602  ..GLLlhp......NAYVRng.W...NLLDFVIV.IVGLFSVILEqltketeggnhssgk......S...GGFD....
ENSGGOP00000017118  ..SIC.........IHYVTt..W...FIIDLIAA.LPFDLLYAFNv....................T...VVSL....
ENSGGOP00000016440  ..RHY.........YFTIG...W...NIFDFVVV.ILSIVGMFLAemiekyf..............V...SPTL....
ENSGGOP00000015188  ..SIG.........LHYLAt..W...FFVDLIAA.LPFDLLYIFNi....................T...VTSL....
ENSGGOP00000019923  ..GPR.........LYFHS...Sf..NCFDFGVT.VGSIFEVVWAifrp.................G...TSFG....
ENSGGOP00000003342  ..GPF.........GYIKN...Py..NIFDGVIV.VISVWEIVGQ.....................-...QGGG....
ENSGGOP00000023204  ..GPF.........GYIKN...Py..NIFDGVIV.VISVWEIVGQ.....................-...QGGG....
ENSGGOP00000010829  ..GPR.........LYFHS...Sf..NCFDFGVT.VGSIFEVVWAifrp.................G...TSFG....
ENSGGOP00000027293  ..GCCcryrgwqgrLRFARk..Pf..CVIDTIVL.IASIAVVSAK.....................T...QGNIfats
ENSGGOP00000026337  ..KLR.........DNYIH...Tlq.FKLDVASI.IPTDLIYFA-.....................-...VDIH....
ENSGGOP00000012641  ..RHY.........YFTNS...W...NIFDFVVV.ILSIVGTVLSdiiqkyf..............F...SPTL....
ENSGGOP00000026186  ..RIK.........MKYLKs..W...FMVDFISS.IPVDYIFLIVetridsevy............K...---Taral
ENSGGOP00000008627  ..RIK.........MKYLKs..W...FMVDFISS.IPVDYIFLIVetridsevy............K...---Taral
ENSGGOP00000012593  ..KLR.........DNYIH...Tlq.FKLDVASI.IPTDLIYFA-.....................-...VDIH....
ENSGGOP00000013701  ..GQK.........CYLGDt..W...NRLDFFIV.VAGMMEYSLD.....................G...HNVS....
ENSGGOP00000021319  ..GQK.........CYLGDt..W...NRLDFFIV.VAGMMEYSLD.....................G...HNVS....
ENSGGOP00000022082  ..KPK.........HYFCDa..W...NTFDALIV.VGSIVDIAITevnpaehtqcspsmnaee...N...SRIS....
ENSGGOP00000028147  ..RYY.........YFTIG...W...NIFDFVVV.ILSIVGMFLAeliekyf..............V...SPTL....
ENSGGOP00000000898  ..GLVlhp......SAYIRng.W...NLLDFIIV.VVGLFSVLLEqgpgrpgdaphtggk......P...GGFD....
ENSGGOP00000022765  ..RLW.........QHYKTt..Tq..FKLDVLSL.VPTDLAYLK-.....................-...VGTN....
ENSGGOP00000003013  ..RLW.........QHYKTt..Tq..FKLDVLSL.VPTDLAYLK-.....................-...VGTN....
ENSGGOP00000006428  ..RQY.........YFTNG...W...NLFDCVVV.LLSIVSTMIStlenq................E...---Hipfp
ENSGGOP00000006310  ..RQY.........YFTNG...W...NVFDFIVV.VLSIASLIFSailkslqsy............F...SPTL....
ENSGGOP00000017309  ..GTR.........PYFHS...Sf..NCFDCGVI.IGSIFEVIWAvikp.................G...TSFG....
ENSGGOP00000015727  ..AIR.........TRYLRt..W...FLVDLISS.IPVDYIFLVVeleprldaevy..........K...---Taral
ENSGGOP00000008481  ..GTR.........PYFHS...Sf..NCFDCGVI.IGSIFEVIWAvikp.................G...TSFG....
ENSGGOP00000006428  ..GFG.........KYFTSa..W...CCLDFIIV.IVSVTTLI--.....................-...NLME....
ENSGGOP00000004729  ..GPR.........SYFRS...Sf..NCFDFGVI.VGSVFEVVWAaikp.................G...SSFG....
ENSGGOP00000003342  ..GKK.........CYLGDt..W...NRLDFFIV.IAGMLEYSLD.....................L...QNVS....
ENSGGOP00000001513  ..VIK.........MNYLKs..W...FVVDFISS.IPVDYIFLIV.....................E...KGMDsevy
ENSGGOP00000021823  ..GLVlhp......SAYIRng.W...NLLDFIIV.VVGLFSVLLEqgpgrpgdaphtggk......P...GGFD....
ENSGGOP00000021537  ..RIK.........MKYLKs..W...FMVDFISS.IPVDYIFLIVetridsevy............K...---Taral
ENSGGOP00000018103  ..NDK.........LWFWLev.N...SVVDFFTV.PPVFVSVYLN.....................R...SWLG....
ENSGGOP00000003602  ..KPK.........GYFSDa..W...NTFDSLIV.IGSIIDVALSeadptesenvpvp........T...---Atpgn
ENSGGOP00000013701  ..GFR.........RFFKDr..W...NQLDLAIV.LLSLMGITLEeiemna...............AlpiNPTI....
ENSGGOP00000021319  ..GFR.........RFFKDr..W...NQLDLAIV.LLSLMGITLEeiemna...............AlpiNPTI....
ENSGGOP00000027513  ..GFR.........RFFKDr..W...NQLDLAIV.LLSLMGITLEeiemna...............AlpiNPTI....
ENSGGOP00000002713  ..GLQ.........AYFVS...Lf..NRFDCFVV.CGGILETILV.....................E...TKIMsplg
ENSGGOP00000002713  ..KPK.........GYFSDp..W...NVFDFLIV.IGSIIDVILSetnhyfcdawntfdal.....I...---Vvgsi
ENSGGOP00000000898  ..KPK.........HYFTDa..W...NTFDALIV.VGSIVDIAVTevnng................G...---Hlges
ENSGGOP00000005331  ..GYQ.........TYFTNa..W...CWLDFLIV.DVSLVSLTANalgy.................S...ELGA....
ENSGGOP00000021823  ..KPK.........HYFTDa..W...NTFDALIV.VGSIVDIAVTevnng................G...---Hlges
ENSGGOP00000001185  ..GLR.........QYFMSi..F...NRFDCFVV.CSGILEILLV.....................E...SGAMtplg
ENSGGOP00000008481  ..GIL.........NYFRDa..W...NIFDFVTV.LGSITDILVTefg..................N...NFIN....
ENSGGOP00000001185  ..KAR.........GYFGDp..W...NVFDFLIV.IGSIIDVILS.....................E...IDTFlass
ENSGGOP00000023924  ..KAR.........GYFGDp..W...NVFDFLIV.IGSIIDVILS.....................E...IDTFlass
ENSGGOP00000022383  ..AIR.........TRYLRt..W...FLVDLISS.IPVDYIFLVVeleprldaevy..........K...---Tara.
ENSGGOP00000023204  ..GKK.........CYLGDt..W...NRLDFFIV.IAGMLEYSLD.....................L...QNVS....
ENSGGOP00000023417  ..GYQ.........TYFTNa..W...CWLDFLIV.DVSLVSLTANalgy.................S...ELGA....
ENSGGOP00000024463  ..GLR.........RFFKDr..W...NQLDLAIV.LLSVMGITLE.....................E...IEINaalp
ENSGGOP00000016442  ..-IA.........VHYFKg..W...FLIDMVAA.IPFDLLIFRTgsd..................E...TTTL....
ENSGGOP00000009882  ..GLR.........RFFKDr..W...NQLDLAIV.LLSVMGITLE.....................E...IEINaalp
ENSGGOP00000019923  ..GFL.........NYFRDt..W...NIFDFITV.IGSITEIILTdsklvn...............T...SGFN....
ENSGGOP00000017309  ..GIL.........NYFRDa..W...NIFDFVTV.LGSITDILVTefg..................N...NFIN....
ENSGGOP00000017557  ..GLR.........RFFKDr..W...NQLDLAIV.LLSVMGITLE.....................E...IEINaalp
ENSGGOP00000010829  ..GFL.........NYFRDt..W...NIFDFITV.IGSITEIILTdsklvn...............T...SGFN....
ENSGGOP00000001185  ..LHK.........GSFCR...Nyf.NMLDLLVV.AVSLISMGLE.....................S...SAISv...
ENSGGOP00000019172  ..-IA.........VHYFKg..W...FLIDMVAA.IPFDLLIFRTgsd..................E...TTTL....
ENSGGOP00000019923  ..GLIlqd......GSYFRdl.W...NILDFVVV.VGALVAFALA.....................N...ALGTnkgr
ENSGGOP00000003342  ..GFR.........RFFQDr..W...NQLDLAIV.LLSIMGITLEeievna...............S...---Lpinp
ENSGGOP00000023204  ..GFR.........RFFQDr..W...NQLDLAIV.LLSIMGITLEeievna...............S...---Lpinp
ENSGGOP00000008481  ..GFAfhk......GSYLRng.W...NVMDFVVV.LTGILATVGT.....................E...FD--....
ENSGGOP00000000501  ..NDK.........LWFWLev.N...SVVDFFTV.PPVFVSVYLN.....................R...SWLG....
ENSGGOP00000023924  ..LHK.........GSFCR...Nyf.NMLDLLVV.AVSLISMGLE.....................S...SAISv...
ENSGGOP00000004729  ..GLLlhp......GAYFRdl.W...NILDFIVV.SGALVAFAFSgskg.................K...DINT....
ENSGGOP00000027513  ..GQK.........CYLGDt..W...NRLDFFIV.VAGMMEYSLD.....................G...HNVS....
ENSGGOP00000010829  ..GLIlqd......GSYFRdl.W...NILDFVVV.VGALVAFALA.....................N...ALGTnkgr
ENSGGOP00000004729  ..GVL.........NYFRDa..W...NVFDFVTV.LGSITDILVTeiaet................N...NFIN....
ENSGGOP00000001185  ..GFLfhq......DAYLRsg.W...NVLDFTIV.FLGVFTVILEqvnviqshtapmssk......G...AGLD....
ENSGGOP00000023924  ..GFLfhq......DAYLRsg.W...NVLDFTIV.FLGVFTVILEqvnviqshtapmssk......G...AGLD....
ENSGGOP00000000352  ..DPY.........YYFQEg..W...NIFDGFIV.SLSLMELGLA.....................N...VEG-....
ENSGGOP00000007211  ..GCC.........CRYRG...Wq..G-------.----------.....................-...----....
ENSGGOP00000028147  ..DPY.........YYFQEg..W...NIFDGFIV.SLSLMELGLA.....................N...VEG-....
ENSGGOP00000020299  ..KPK.........GYFSDa..W...NTFDSLIV.IGSIIDVALSeadptesenvpvp........T...---Atpgn
ENSGGOP00000013354  ..GRS.........YFYDF...W...NNLDFFIM.TMAVLDFLLMqthsfaiyh............Q...---Slfri
ENSGGOP00000008980  ..DPY.........YYFQEg..W...NIFDGFIV.SLSLMELSLA.....................D...VEG-....
ENSGGOP00000010829  ..GFIfhk......GSYLRng.W...NVMDFIVV.LSGILATAGThf...................N...THVD....
ENSGGOP00000024945  ..DPY.........EYFQQg..W...NIFDSIIV.TLSLVELGLA.....................N...VQG-....
ENSGGOP00000012234  ..DPY.........EYFQQg..W...NIFDSIIV.TLSLVELGLA.....................N...VQG-....
ENSGGOP00000021390  ..GCC.........CRYRG...Wq..GRFRFARK.PFCVIGNEXEelrk.................K...----....
ENSGGOP00000023417  ..DPY.........YYFQEg..W...NIFDGFIV.TLSLVELGLA.....................N...VEG-....
ENSGGOP00000005331  ..DPY.........YYFQEg..W...NIFDGFIV.TLSLVELGLA.....................N...VEG-....
ENSGGOP00000002713  ..GLLfhp......NAYLRng.W...NLLDFIIV.VVGLFSAILEqatkadganalggk.......G...AGFD....
ENSGGOP00000020299  ..GLQ.........AYFVS...Lf..NRFDCFVV.CGGITETILV.....................E...LEIMsplg
ENSGGOP00000003602  ..GLQ.........AYFVS...Lf..NRFDCFVV.CGGITETILV.....................E...LEIMsplg
ENSGGOP00000012641  ..DPY.........YYFQQg..W...NIFDSIIV.ILSLMELGLS.....................R...M-SN....
ENSGGOP00000010638  ..RIS.........SRYVRt..Ws..FFLDLASL.MPTDVVYVRL.....................G...PH--....
ENSGGOP00000020299  ..GLLlhp......NAYVRng.W...NLLDFVIV.IVGLFSVILEqltketeggnhssgk......S...GGFD....
ENSGGOP00000004729  ..GFVfhk......GSYLRng.W...NVMDFVVV.LTGILATAG-.....................-...TDFD....
ENSGGOP00000016440  ..GFCled......FTFLRdp.W...NWLDFSVI.VMAYVTEFV-.....................-...DLGN....
ENSGGOP00000025809  ..DPY.........EYFQVg..W...NIFDSLIV.TLSLVELFLA.....................D...VEG-....
ENSGGOP00000006736  ..KIK.........KKYLRt..W...FVVDFVSS.IPVDYIFLIV.....................E...KGIDsevy
ENSGGOP00000022082  ..GLLfhp......NAYLRng.W...NLLDFIIV.VVGLFSAILEqatkadganalggk.......G...AGFD....
ENSGGOP00000000352  ..GFCled......FTFLRdp.W...NWLDFTVI.TFAYVTEFV-.....................-...DLGN....
ENSGGOP00000005331  ..GFCled......FTFLRdp.W...NWLDFTVI.TFAYVTEFV-.....................-...DLGN....
ENSGGOP00000008980  ..GFCidg......FTFLRdp.W...NWLDFSVI.MMAYITEFV-.....................-...NLGN....
ENSGGOP00000012641  ..GFClha......FTFLRdp.W...NWLDFSVI.IMAYTTEFV-.....................-...DLGN....
ENSGGOP00000000898  ..GPS.........AYVSS...Ff..NRFDCFVV.CGGILETTLV.....................E...VGAMqplg
ENSGGOP00000028147  ..GFCled......FTFLRdp.W...NWLDFTVI.TFAYVTEFV-.....................-...DLGN....
ENSGGOP00000003602  ..LHK.........GAFCR...Nyf.NLLDMLVV.GVSLVSFGIQ.....................S...SAISv...
ENSGGOP00000023417  ..GFCled......FTFLRdp.W...NWLDFTVI.TFAYVTEFV-.....................-...DLGN....
ENSGGOP00000006310  ..GFClne......FTYLRdp.W...NWLDFSVI.TLAYVGTAI-.....................-...DLRG....
ENSGGOP00000006310  ..DPY.........YYFQKk..W...NIFDCIIV.TVSLLELGLA.....................K...KGS-....
ENSGGOP00000020299  ..LHK.........GAFCR...Nyf.NLLDMLVV.GVSLVSFGIQ.....................S...SAISv...
ENSGGOP00000023924  ..GLR.........QYFMSi..F...NRFDCFVV.CSGILEILLV.....................E...SGAMtplg
ENSGGOP00000011260  ..DDK.........IKFWLem.N...SIVDIFTI.PPTFISYYLK.....................S...NWLG....
ENSGGOP00000012234  ..GFCvdd......FTFLRdp.W...NWLDFSVI.MMAYLTEFV-.....................-...DLGN....
ENSGGOP00000024945  ..GFCvdd......FTFLRdp.W...NWLDFSVI.MMAYLTEFV-.....................-...DLGN....
ENSGGOP00000021823  ..GPS.........AYVSS...Ff..NRFDCFVV.CGGILETTLV.....................E...VGAMqplg
ENSGGOP00000021823  ..LHR.........GSFCRs..Wf..NMLDLLVV.SVSLISFGIH.....................S...SAISv...
ENSGGOP00000008481  ..GLVlhq......GAYFRdl.W...NILDFIVV.SGALVAFAFTgnskg................K...---Dint.
ENSGGOP00000000898  ..LHR.........GSFCRs..Wf..NMLDLLVV.SVSLISFGIH.....................S...SAISv...
ENSGGOP00000017309  ..GLVlhq......GAYFRdl.W...NILDFIVV.SGALVAFAFTgnskg................K...---Dint.
ENSGGOP00000016440  ..DPY.........YYFQEg..W...NIFDGIIV.SLSLMELGLS.....................N...VEG-....
ENSGGOP00000022082  ..GLQ.........AYFVS...Lf..NRFDCFVV.CGGILETILV.....................E...TKIMsplg
ENSGGOP00000009838  ..ELR.........KHYRT...Stk.FQLDVASI.IPFDICYLF-.....................-...----....
ENSGGOP00000006428  ..GFIlde......FSFLRdp.W...NWLDSIVI.GIAIVSYIPG.....................-...INIK....
ENSGGOP00000005127  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000016918  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000001687  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000015184  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000017557  ..GKK.........CYLGDt..W...NRLDFFIV.MAGILEMICD.....................F...QHLS....
ENSGGOP00000022082  ..LHK.........GSFCR...Nyf.NILDLLVV.SVSLISFGIQ.....................S...SAINv...
ENSGGOP00000006428  ..DPY.........HYFRRg..W...NIFDSIVA.LLSFADVMNCv....................L...QKKS....
ENSGGOP00000027687  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000002713  ..LHK.........GSFCR...Nyf.NILDLLVV.SVSLISFGIQ.....................S...SAINv...
ENSGGOP00000007339  ..GLFftp......TAVIR...Dfg.GVMDIFIY.LVSLIFLCWM.....................P...QNVPaesg
ENSGGOP00000016934  ..GLFftp......TAVIR...Dfg.GVMDIFIY.LVSLIFLCWM.....................P...QNVPaesg
ENSGGOP00000025319  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000025813  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000003047  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000025809  ..GFCvge......FTFLRdp.W...NWLDFVVI.VFAYLTEFV-.....................-...NLGN....
ENSGGOP00000008617  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000012511  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000005228  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000024187  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000007461  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000016722  ..DMR.........NNYLK...Srr.FKMDLLSL.LPLDFLYLK-.....................-...----....
ENSGGOP00000027288  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000005376  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000006442  ..FWI.........FWKDG...W...NILNFIIV.FILLLRFFIN.....................E...INI-....
ENSGGOP00000024150  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000001687  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000009882  ..GKK.........CYLGDt..W...NRLDFFIV.MAM-------.....................-...----....
ENSGGOP00000003047  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000002078  ..HPY.........GYFQVg..W...NIFDSMIV.FHGLIELCLA.....................N...VAG-....
ENSGGOP00000027711  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000000658  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000019229  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000000546  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000007454  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000024187  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000018574  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000001313  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000022306  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000006045  ..FSV.........FWKSA...W...NVFDFVVT.MLSLLPEVVVlvgvt................G...QSVW....
ENSGGOP00000026587  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000003743  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000005670  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000025319  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000003637  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000010687  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000005951  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000013120  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000002078  ..RCF.........YFTIA...W...NIFDFMVV.FFSITGLCLPmtv..................G...SYLVppsl
ENSGGOP00000008753  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000018872  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000017068  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000028458  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000025813  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000019335  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000001313  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000027030  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000012459  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000026172  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000017309  ..---.........-----...-...--------.----------.....................-...--FD....
ENSGGOP00000018574  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000004798  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000027211  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000018872  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000007946  ..---.........-----...-...--------.----------.....................-...--FN....
ENSGGOP00000009787  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000017068  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000012459  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000017225  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000024508  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000026172  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000007339  ..GFT.........GYISS...Sl..HKFELLLV.IGTTLHVYP-.....................-...-DLY....
ENSGGOP00000012997  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000016934  ..GFT.........GYISS...Sl..HKFELLLV.IGTTLHVYP-.....................-...-DLY....
ENSGGOP00000009787  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000019335  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000010687  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000007461  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000005951  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000007454  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000002078  ..GVWags......FSFLGdp.W...NWLDFSVT.VFEVIIRYS-.....................-...PLDF....
ENSGGOP00000011478  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000027967  ..GLR.........GYLSYp..S...NVFDGLLT.IVLLVLEISTlavyrlphpgwrp........E...---Mlgll
ENSGGOP00000027288  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000010343  ..GLR.........GYLSYp..S...NVFDGLLT.IVLLLKVLEI.....................S...TLAVyrlp
ENSGGOP00000021593  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000007339  ..GIVkgd......SSYVKdr.W...CVFDGFMV.FCLWISLVLQvfeiadivdqm..........S...PWGM....
ENSGGOP00000016934  ..GIVkgd......SSYVKdr.W...CVFDGFMV.FCLWISLVLQvfeiadivdqm..........S...PWGM....
ENSGGOP00000004744  ..PIN.........YWKNG...Y...NLLDVIII.IIMFLPYALRqlmg.................K...QFTY....
ENSGGOP00000010343  ..GWA.........HFQKNl..W...LLGYLVVL.VVSLVDWTVS.....................L...SLVC....
ENSGGOP00000027967  ..GWA.........HFQKNl..W...LLGYLVVL.VVSLVDWTVS.....................L...SLVC....
ENSGGOP00000025809  ..RHY.........YFTVG...W...NIFDFVVV.IISIVVVVIFt....................N...LAKY....
ENSGGOP00000024463  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000002078  ..GFK.........AYFSNg..W...YRLDFVVV.IVRILKFCLSlig..................K...TREE....
ENSGGOP00000010207  ..GPV.........EYLSSg..W...NLFDFSVT.VFAFLGLLALa....................L...NMEP....
ENSGGOP00000010203  ..GPV.........EYLSSg..W...NLFDFSVT.VFAFLGLLALa....................L...NMEP....
ENSGGOP00000003957  ..RLE.........FFHHK...F...EILDAVVV.VVSFILDIVLlfqe.................H...EFEA....
ENSGGOP00000011478  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000010203  ..GLH.........TFIRH...KrtmVKTSVLVV.QFVEAIVVLV.....................R...QMSH....
ENSGGOP00000010207  ..GLH.........TFIRH...KrtmVKTSVLVV.QFVEAIVVLV.....................R...QMSH....
ENSGGOP00000001755  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000018945  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000022444  ..KLH.........YFRSF...W...NCLDVVIV.VLSVVAIGINiyrtsnvevllqfledqn...T...---Fpnfe
ENSGGOP00000018177  ..RLE.........FFHHK...F...EILDAVVV.VVSFILDIVLlfqe.................H...EFEA....
ENSGGOP00000003268  ..KLH.........YFRSF...W...NCLDVVIV.VLSVVAIGINiyrtsnvevllqfledqn...T...---Fpnfe
ENSGGOP00000001590  ..GRQ.........QYFSD...Lf..NILDTAIIvIPLLVDVIYIffdikllrnip..........R...---Wthl.
ENSGGOP00000020483  ..RLR.........YLSSI...W...NILDMVVI.LLSIVAVGFHifrtlevnrlmgkllqqpntyA...---Dfefl
ENSGGOP00000020927  ..RLR.........YLSSI...W...NILDMVVI.LLSIVAVGFHifrtlevnrlmgkllqqpntyA...---Dfefl
ENSGGOP00000001815  ..RLR.........YLSSI...W...NILDMVVI.LLSIVAVGFHifrtlevnrlmgkllqqpntyA...---Dfefl
ENSGGOP00000007339  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000001254  ..RKD.........FFSHA...W...NIFELAIT.LIGILHVILIeidnikyifnet.........E...VIVF....
ENSGGOP00000000981  ..GWT.........HL---...-...--------.----------.....................-...----....
ENSGGOP00000026559  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000000982  ..GWT.........HL---...-...--------.----------.....................-...----....
ENSGGOP00000009351  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000014483  ..GIW.........DYIEN...Ki..EVFDGAVI.ILSLAPMVAStva..................N...---Gprsp
ENSGGOP00000023496  ..GIW.........DYIEN...Ki..EVFDGAVI.ILSLAPMVAStva..................N...---Gprsp
ENSGGOP00000016934  shKTK.........SYYIVyncSl..NRYYLLMF.MGIFHIYFS-.....................-...----....
ENSGGOP00000016605  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000014493  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000012367  ..---.........-----...-...--------.----------.....................-...----....
ENSGGOP00000027522  ..---.........-----...-...--------.----------.....................-...----....


                                                     100             110                          12
                                                       |               |                            
d1orqc_               .............................LGLFR......LVRLLRFLRILLIISRGS.K..................
ENSGGOP00000011420  ..........................laiLRVIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000021753  .............................LRVIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000000656  ...........................aiLRVIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000011744  ..........................laiLRVIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000003210  .............................VQIFR......IMRILRILKLARHSTGLQ.S..................
ENSGGOP00000027568  ..........................laiLRVIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000007168  .........................sfaiLRIIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000024337  .........................sfaiLRIIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000002688  .............................FVTLR......VFRVFRIFKFSRHSQGLR.I..................
ENSGGOP00000009305  .............................VQALR......IMRIARIFKLARHSSGLQ.T..................
ENSGGOP00000006737  .............................VQIFR......IMRILRILKLARHSTGLQ.S..................
ENSGGOP00000015335  .............................LRVVR......FVRILRIFKLTRHFVGLR.V..................
ENSGGOP00000015202  .............................FVTLR......VFRVFRIFKFSRHSQGLR.I..................
ENSGGOP00000003820  .............................LRVVR......FVRILRIFKLTRHFVGLR.V..................
ENSGGOP00000008219  .............................LRIIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000022687  .............................LRVVR......FVRILRIFKLTRHFVGLR.V..................
ENSGGOP00000013400  .............................LRVIR......LVRVFRIFKLSRHSKGLQ.I..................
ENSGGOP00000027450  .............................LRVVR......FVRILRIFKLTRHFVGLR.V..................
ENSGGOP00000000227  .............................LRVMR......LMRIFRILKLARHSTGLR.A..................
ENSGGOP00000012818  .............................LRVVR......FVRILRIFKLTRHFVGLR.V..................
ENSGGOP00000008276  .............................VQVLR......LLRALRMLKLGRHSTGLR.S..................
ENSGGOP00000019798  .............................LRVVR......FVRILRIFKLTRHFVGLR.V..................
ENSGGOP00000006085  .............................LRVVR......FVRILRIFKLTRHFVGLR.V..................
ENSGGOP00000000958  .............................VQILR......LMRIFRILKLARHSVGLR.S..................
ENSGGOP00000002752  .............................AQVLR......LMRIFRILKLARHSTGLR.S..................
ENSGGOP00000000831  .............................LRVLR......ALRILYVMRLARHSLGLQ.T..................
ENSGGOP00000002953  .............................VQVFR......LMRIFRVLKLARHSTGLR.S..................
ENSGGOP00000023230  .............................VQVFR......LMRIFRVLKLARHSTGLR.S..................
ENSGGOP00000001534  .............................LRVLR......ALRILYVMRLARHSLGLQ.T..................
ENSGGOP00000005162  .............................LRLLR......ALRVLYVMRLARHSLGLR.S..................
ENSGGOP00000001664  .............................LRVLR......MMRIFWVIKLARHFIGLQ.T..................
ENSGGOP00000025520  ............................aLRSLR......FLQILRMIRMDRRGGTWK.L..................
ENSGGOP00000016408  .............................IGLLK......TARLLRLVRVARKLDRYS.E..................
ENSGGOP00000020811  ............................aLRSLR......FLQILRMIRMDRRGGTWK.L..................
ENSGGOP00000008202  ............................aLRSLR......FLQILRMIRMDRRGGTWK.L..................
ENSGGOP00000012351  .............................IGLLK......TARLLRLVRVARKLDRYS.E..................
ENSGGOP00000028732  .............................FSSLK......VVRLLRLGRVARKLDHYL.E..................
ENSGGOP00000011126  ............................aLRSLR......FLQILRMVRMDRRGGTWK.L..................
ENSGGOP00000012234  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000024945  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000008980  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000013052  ............................aIRGIR......FLQILRMLHVDRQGGTWR.L..................
ENSGGOP00000012641  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000028610  ..gdpgkigfadqippplegresqgisslFSSLK......VVRLLRLGRVARKLDHYI.E..................
ENSGGOP00000006310  .............................IKALR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000001711  .............................LRSLR......FLQILRMLRMDRRGGTWK.L..................
ENSGGOP00000017557  .............................LRVLR......LLRTLRPLRVISRAPGLK.L..................
ENSGGOP00000024463  .............................LRVLR......LLRTLRPLRVISRAPGLK.L..................
ENSGGOP00000009882  .............................LRVLR......LLRTLRPLRVISRAPGLK.L..................
ENSGGOP00000023204  .............................LRVLR......LLRTLRPLRVISRAQGLK.L..................
ENSGGOP00000003342  .............................LRVLR......LLRTLRPLRVISRAQGLK.L..................
ENSGGOP00000000352  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000028147  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000016440  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000008980  .............................FRVIR......LARIGRILRLIKGAKGIR.T..................
ENSGGOP00000024463  .............................LSVLR......TFRLLRVLKLVRFMPALR.R..................
ENSGGOP00000017557  .............................LSVLR......TFRLLRVLKLVRFMPALR.R..................
ENSGGOP00000001541  .............................AHLLK......TVRLLRLLRLLPRLDRYS.Q..................
ENSGGOP00000009882  .............................LSVLR......TFRLLRVLKLVRFMPALR.R..................
ENSGGOP00000013701  .............................LRVLR......LLRTLRPLRVISRAPGLK.L..................
ENSGGOP00000021319  .............................LRVLR......LLRTLRPLRVISRAPGLK.L..................
ENSGGOP00000027513  .............................LRVLR......LLRTLRPLRVISRAPGLK.L..................
ENSGGOP00000023417  .............................FRVIR......LARIGRILRLIKGAKGIR.T..................
ENSGGOP00000005331  .............................FRVIR......LARIGRILRLIKGAKGIR.T..................
ENSGGOP00000025522  .............................YPEIR......LNRLLRFSRMFEFFQRTE.T..................
ENSGGOP00000013502  .............................YPEIR......LNRLLRFSRMFEFFQRTE.T..................
ENSGGOP00000025809  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000024945  .............................FRVIR......LARIGRVLRLIRGAKGIR.T..................
ENSGGOP00000012234  .............................FRVIR......LARIGRVLRLIRGAKGIR.T..................
ENSGGOP00000000352  .............................FRVIR......LARIGRILRLIKGAKGIR.T..................
ENSGGOP00000013701  .............................LSVLR......TFRLLRVLKLVRFLPALR.R..................
ENSGGOP00000021319  .............................LSVLR......TFRLLRVLKLVRFLPALR.R..................
ENSGGOP00000027513  .............................LSVLR......TFRLLRVLKLVRFLPALR.R..................
ENSGGOP00000003602  .............................VKALR......AFRVLRPLRLVSGVPSLQ.V..................
ENSGGOP00000017118  .............................VHLLK......TVRLLRLLRLLQKLDRYS.Q..................
ENSGGOP00000016440  .............................FRVIR......LARIGRILRLIKGAKGIR.T..................
ENSGGOP00000015188  .............................VHLLK......TVRLLRLLRLLQKLERYS.Q..................
ENSGGOP00000019923  .............................ISVLR......ALRLLRIFKITKYWASLR.N..................
ENSGGOP00000003342  .............................LSVLR......TFRLMRVLKLVRFLPALQ.R..................
ENSGGOP00000023204  .............................LSVLR......TFRLMRVLKLVRFLPALQ.R..................
ENSGGOP00000010829  .............................ISVLR......ALRLLRIFKITKYWASLR.N..................
ENSGGOP00000027293  ............................aLRSLR......FLQILRMVRMDRRGGTWK.L..................
ENSGGOP00000026337  .............................SPEVR......FNRLLHFARMFEFFDRTE.T..................
ENSGGOP00000012641  .............................FRVIR......LARIGRILRLIRGAKGIR.T..................
ENSGGOP00000026186  ........................rivrfTKILS......LLRLLRLSRLIRYIHQWE.E..................
ENSGGOP00000008627  ........................rivrfTKILS......LLRLLRLSRLIRYIHQWE.E..................
ENSGGOP00000012593  .............................SPEVR......FNRLLHFARMFEFFDRTE.T..................
ENSGGOP00000013701  .............................LSAIR......TVRVLRPLRAINRVPSMR.I..................
ENSGGOP00000021319  .............................LSAIR......TVRVLRPLRAINRVPSMR.I..................
ENSGGOP00000022082  .............................ITFFR......LFRVMRLVKLLSRGEGIR.T..................
ENSGGOP00000028147  .............................FRVIR......LARIGRILRLIKGAKGIR.T..................
ENSGGOP00000000898  .............................VKALR......AFRVLRPLRLVSGVPSLH.I..................
ENSGGOP00000022765  .............................YPEVR......FNRLLKFSRLFEFFDRTE.T..................
ENSGGOP00000003013  .............................YPEVR......FNRLLKFSRLFEFFDRTE.T..................
ENSGGOP00000006428  ..........................ptlFRIVR......LARIGRILRLVRAARGIR.T..................
ENSGGOP00000006310  .............................FRVIR......LARIGRILRLIRAAKGIR.T..................
ENSGGOP00000017309  .............................ISVLR......ALRLLRIFKVTKYWASLR.N..................
ENSGGOP00000015727  ........................rivrfTKILS......LLRLLRLSRLIRYIHQWE.E..................
ENSGGOP00000008481  .............................ISVLR......ALRLLRIFKVTKYWASLR.N..................
ENSGGOP00000006428  .............................LKSFR......TLRALRPLRALSQFEGMK.V..................
ENSGGOP00000004729  .............................ISVLR......ALRLLRIFKVTKYWSSLR.N..................
ENSGGOP00000003342  .............................FSAVR......TVRVLRPLRAINRVPSMR.I..................
ENSGGOP00000001513  ..................ktaralrivrfTKILS......LLRLLRLSRLIRYIHQWE.E..................
ENSGGOP00000021823  .............................VKALR......AFRVLRPLRLVSGVPSLH.I..................
ENSGGOP00000021537  ........................rivrfTKILS......LLRLLRLSRLIRYIHQWE.E..................
ENSGGOP00000018103  .............................LRFLR......ALRLIQFSEILQFLNILK.T..................
ENSGGOP00000003602  .....................seesnrisITFFR......LFRVMRLVKLLSRGEGIR.T..................
ENSGGOP00000013701  .............................IRIMR......VLRIARVLKLLKMATGMR.A..................
ENSGGOP00000021319  .............................IRIMR......VLRIARVLKLLKMATGMR.A..................
ENSGGOP00000027513  .............................IRIMR......VLRIARVLKLLKMATGMR.A..................
ENSGGOP00000002713  .............................ISVLR......CVRLLRIFKITRYWNSLS.N..................
ENSGGOP00000002713  vdiaitevnpaehtqcspsmnaeensrisITFFR......LFRVMRLVKLLSRGEGIR.T..................
ENSGGOP00000000898  .....................sedssrisITFFR......LFRVMRLVKLLSKGEGIR.T..................
ENSGGOP00000005331  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000021823  .....................sedssrisITFFR......LFRVMRLVKLLSKGEGIR.T..................
ENSGGOP00000001185  .............................ISVLR......CIRLLRIFKITKYWTSLS.N..................
ENSGGOP00000008481  .............................LSFLR......LFRAARLIKLLRQGYTIR.I..................
ENSGGOP00000001185  .......gglyclgggcgnvdpdesarisSAFFR......LFRVMRLIKLLSRAEGVR.T..................
ENSGGOP00000023924  .......gglyclgggcgnvdpdesarisSAFFR......LFRVMRLIKLLSRAEGVR.T..................
ENSGGOP00000022383  .............................LRIVRftkilsLLRLLRLSRLIRYIHQWT.S..................
ENSGGOP00000023204  .............................FSAVR......TVRVLRPLRAINRVPSMR.I..................
ENSGGOP00000023417  .............................IKSLR......TLRALRPLRALSRFEGMR.V..................
ENSGGOP00000024463  ........................inptiIRIMR......VLRIARVLKLLKMATGMR.A..................
ENSGGOP00000016442  .............................IGLLK......TARLLRLVRVARKLDRYS.E..................
ENSGGOP00000009882  ........................inptiIRIMR......VLRIARVLKLLKMATGMR.A..................
ENSGGOP00000019923  .............................MSFLK......LFRAARLIKLLRQGYTIR.I..................
ENSGGOP00000017309  .............................LSFLR......LFRAARLIKLLRQGYTIR.I..................
ENSGGOP00000017557  ........................inptiIRIMR......VLRIARVLKLLKMATGMR.A..................
ENSGGOP00000010829  .............................MSFLK......LFRAARLIKLLRQGYTIR.I..................
ENSGGOP00000001185  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000019172  .............................IGLLK......TARLLRLVRVARKLDRYS.E..................
ENSGGOP00000019923  .........................diktIKSLR......VLRVLRPLKTIKRLPKLK.A..................
ENSGGOP00000003342  ...........................tiIRIMR......VLRIARVLKLLKMAVGMR.A..................
ENSGGOP00000023204  ...........................tiIRIMR......VLRIARVLKLLKMAVGMR.A..................
ENSGGOP00000008481  .............................LRTLR......AVRVLRPLKLVSGIPSLQ.V..................
ENSGGOP00000000501  .............................LRFLR......ALRLIQFSEILQFLNILK.T..................
ENSGGOP00000023924  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000004729  .............................IKSLR......VLRVLRPLKTIKRLPKLK.A..................
ENSGGOP00000027513  .............................LSAIR......TVRVLRPLRAINRVPSLR.I..................
ENSGGOP00000010829  .........................diktIKSLR......VLRVLRPLKTIKRLPKLK.A..................
ENSGGOP00000004729  .............................LSFLR......LFRAARLIKLLRQGYTIR.I..................
ENSGGOP00000001185  .............................VKALR......AFRVLRPLRLVSGVPSLQ.V..................
ENSGGOP00000023924  .............................VKALR......AFRVLRPLRLVSGVPSLQ.V..................
ENSGGOP00000000352  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000007211  .............................-----......------------------.-..................
ENSGGOP00000028147  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000020299  .....................seesnrisITFFR......LFRVMRLVKLLSRGEGIR.T..................
ENSGGOP00000013354  ..........................lkvFKSLR......ALRAIRVLRRLSFLTSVQ.E..................
ENSGGOP00000008980  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000010829  .............................LRTLR......AVRVLRPLKLVSGIPSLQ.I..................
ENSGGOP00000024945  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000012234  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000021390  .............................-----......------------------.Selglremgdlypfpvwks
ENSGGOP00000023417  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000005331  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000002713  .............................VKALR......AFRVLRPLRLVSGVPSLQ.V..................
ENSGGOP00000020299  .............................ISVFR......CVRLLRIFKVTRHWTSLS.N..................
ENSGGOP00000003602  .............................ISVFR......CVRLLRIFKVTRHWTSLS.N..................
ENSGGOP00000012641  .............................LSVLR......SFRLLRVFKLAKSWPTLN.T..................
ENSGGOP00000010638  .............................TPTLR......LNRFLRAPRLFEAFDRTE.T..................
ENSGGOP00000020299  .............................VKALR......AFRVLRPLRLVSGVPSLQ.V..................
ENSGGOP00000004729  .............................LRTLR......AVRVLRPLKLVSGIPSLQ.V..................
ENSGGOP00000016440  .............................VSALR......TFRVLRALKTISVIPGLK.T..................
ENSGGOP00000025809  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000006736  ........................ktaraLRIVR......FTKILSLLRLLRLSRLIR.Y..................
ENSGGOP00000022082  .............................VKALR......AFRVLRPLRLVSGVPSLQ.V..................
ENSGGOP00000000352  .............................VSALR......TFRVLRALKTISVIPGLK.T..................
ENSGGOP00000005331  .............................VSALR......TFRVLRALKTISVIPGLK.T..................
ENSGGOP00000008980  .............................VSALR......TFRVLRALKTISVIPGLK.T..................
ENSGGOP00000012641  .............................VSALR......TFRVLRALKTISVISGLK.T..................
ENSGGOP00000000898  .............................ISVLR......CVRLLRIFKVTRHWASLS.N..................
ENSGGOP00000028147  .............................VSALR......TFRVLRALKTISVIPGLK.T..................
ENSGGOP00000003602  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000023417  .............................VSALR......TFRVLRALKTISVIPGLK.T..................
ENSGGOP00000006310  .............................ISGLR......TFRVLRALKTVSVIPGLK.V..................
ENSGGOP00000006310  .............................LSVLR......SFRLLRVFKLAKSWPTLN.T..................
ENSGGOP00000020299  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000023924  .............................ISVLR......CIRLLRIFKITKYWTSLS.N..................
ENSGGOP00000011260  .............................LRFLR......ALRLLELPQILQILRAIK.T..................
ENSGGOP00000012234  .............................ISALR......TFRVLRALKTITVIPGLK.T..................
ENSGGOP00000024945  .............................ISALR......TFRVLRALKTITVIPGLK.T..................
ENSGGOP00000021823  .............................ISVLR......CVRLLRIFKVTRHWASLS.N..................
ENSGGOP00000021823  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000008481  .............................IKSLR......VLRVLRPLKTIKRLPKLK.A..................
ENSGGOP00000000898  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000017309  .............................IKSLR......VLRVLRPLKTIKRLPKLK.A..................
ENSGGOP00000016440  .............................LSVLR......SFRLLRVFKLAKSWPTLN.M..................
ENSGGOP00000022082  .............................ISVLR......CVRLLRIFKITRYWNSLS.N..................
ENSGGOP00000009838  .............................FGFNP......IFRANRMLKYTSFFE-FN.H..................
ENSGGOP00000006428  .............................LLSLR......TFRVFRALKAISVVSRLK.V..................
ENSGGOP00000005127  .............................-----......--FIPVFLNCWLAKHALE.N..................
ENSGGOP00000016918  .............................-----......--FIPVFLNCWLAKHALE.N..................
ENSGGOP00000001687  .............................-----......-----RVEKVFRKKQVSQ.T..................
ENSGGOP00000015184  .............................-----......-LRLYLIARVMLLHSKLF.Tdassrsigalnkinfn..
ENSGGOP00000017557  .............................FPSIS......CVRVCVPVRV--CVPGMR.I..................
ENSGGOP00000022082  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000006428  .............................WPFLR......SFRVLRVFKLAKSWPTLN.T..................
ENSGGOP00000027687  .............................-----......--FVPVFLNCWLAKHALE.N..................
ENSGGOP00000002713  .............................VKILR......VLRVLRPLRAINRAKGLK.H..................
ENSGGOP00000007339  .............................AQLLM......VLRCLRPLRIFKLVPQMR.K..................
ENSGGOP00000016934  .............................AQLLM......VLRCLRPLRIFKLVPQMR.K..................
ENSGGOP00000025319  .............................-----......------------------.-..................
ENSGGOP00000025813  .............................-----......------------------.-..................
ENSGGOP00000003047  .............................-----......------------------.-..................
ENSGGOP00000025809  .............................VSALR......TFRVLRALKTISVIPGLK.T..................
ENSGGOP00000008617  .............................-----......---------------YLR.D..................
ENSGGOP00000012511  .............................-----......-LRLYLIARVMLLHSKLF.Tdassrsigalnkinfn..
ENSGGOP00000005228  .............................-----......---------------YLA.D..................
ENSGGOP00000024187  .............................-----......------------------.-..................
ENSGGOP00000007461  .............................-----......------------------.-..................
ENSGGOP00000016722  .............................VGVNP......LLRLPRCLKYMAFFEFNS.R..................
ENSGGOP00000027288  .............................-----......------------------.-..................
ENSGGOP00000005376  .............................-----......------------------.-..................
ENSGGOP00000006442  .............................PSINY......TLRALRLVHVCMAVEPLA.R..................
ENSGGOP00000024150  .............................-----......-LRLYLIARVMLLHSKLF.Tdassrsigalnkinfn..
ENSGGOP00000001687  .............................-----......------------------.-..................
ENSGGOP00000009882  .............................-----......-----------------R.I..................
ENSGGOP00000003047  .............................-----......------------------.-..................
ENSGGOP00000002078  .............................MALLR......LFRMLRIFKLGKYWPTFQ.I..................
ENSGGOP00000027711  .............................-----......---------------YMA.D..................
ENSGGOP00000000658  .............................-----......----------------LA.D..................
ENSGGOP00000019229  .............................-----......--------------RYLT.D..................
ENSGGOP00000000546  .............................-----......---------------YMA.D..................
ENSGGOP00000007454  .............................-----......------------------.-..................
ENSGGOP00000024187  .............................-----......------------------.-..................
ENSGGOP00000018574  .............................-----......------------------.-..................
ENSGGOP00000001313  .............................-----......------------------.-..................
ENSGGOP00000022306  .............................-----......--------------RYLS.D..................
ENSGGOP00000006045  .............................LQLLR......ICRVLRSLKLLAQFRQIR.I..................
ENSGGOP00000026587  .............................-QRIT......VHVTRRPVLYFHIRWGFS.K..................
ENSGGOP00000003743  .............................-----......--------------RYLT.D..................
ENSGGOP00000005670  .............................-----......------------------.-..................
ENSGGOP00000025319  .............................-----......------------------.-..................
ENSGGOP00000003637  .............................-----......-------------GRFLQ.D..................
ENSGGOP00000010687  .............................-----......-----------------S.K..................
ENSGGOP00000005951  .............................-----......---------AKRLGQFLT.K..................
ENSGGOP00000013120  .............................-----......--------------RYLS.D..................
ENSGGOP00000002078  .............................VQLIL......LSRIIHMLRLGKGPKVFH.N..................
ENSGGOP00000008753  .............................-----......-------------GRFLQ.D..................
ENSGGOP00000018872  .............................-----......------------------.-..................
ENSGGOP00000017068  .............................-----......------------------.-..................
ENSGGOP00000028458  .............................-----......------------------.D..................
ENSGGOP00000025813  .............................-----......------------------.-..................
ENSGGOP00000019335  .............................-----......------------------.-..................
ENSGGOP00000001313  .............................-----......------------------.-..................
ENSGGOP00000027030  .............................-----......--------------RYLS.D..................
ENSGGOP00000012459  .............................-----......------------------.-..................
ENSGGOP00000026172  .............................-----......------------------.-..................
ENSGGOP00000017309  .............................LRTLR......AVRVLRPLKLVSGIPSLQ.V..................
ENSGGOP00000018574  .............................-----......------------------.-..................
ENSGGOP00000004798  .............................-----......------------------.D..................
ENSGGOP00000027211  .............................-----......------------------.D..................
ENSGGOP00000018872  .............................-----......-----VVRRLLLAAKHCL.G..................
ENSGGOP00000007946  .............................LFLER......LITIIAYIMKSCHQRQLR.R..................
ENSGGOP00000009787  .............................-----......------------------.-..................
ENSGGOP00000017068  .............................-----......-----VVRRLLLAAKHCL.G..................
ENSGGOP00000012459  .............................-----......------------------.-..................
ENSGGOP00000017225  .............................-----......-------------FLYLK.D..................
ENSGGOP00000024508  .............................-----......-------------FLYLK.D..................
ENSGGOP00000026172  .............................-----......------------------.-..................
ENSGGOP00000007339  .............................HSQFT......YFQVLRVVRLIKISPALE.D..................
ENSGGOP00000012997  .............................-----......----------------LQ.D..................
ENSGGOP00000016934  .............................HSQFT......YFQVLRVVRLIKISPALE.D..................
ENSGGOP00000009787  .............................-----......------------------.R..................
ENSGGOP00000019335  .............................-----......------------------.-..................
ENSGGOP00000010687  .............................-----......------------------.-..................
ENSGGOP00000007461  .............................-----......------------------.-..................
ENSGGOP00000005951  .............................-----......------------------.-..................
ENSGGOP00000007454  .............................-----......------------------.-..................
ENSGGOP00000002078  .............................IPMLQ......TARTLRILKIIPLNQGLK.S..................
ENSGGOP00000011478  .............................-----......------------------.-..................
ENSGGOP00000027967  ........................slwdmTRMLN......MLIVFRFLRIIPSMKPMA.V..................
ENSGGOP00000027288  .............................-----......------------------.-..................
ENSGGOP00000010343  ............hpgwrpemlgllslwdmTRMLN......MLIVFRFLRIIPSMKPMA.V..................
ENSGGOP00000021593  .............................-----......------------------.-..................
ENSGGOP00000007339  .............................LRIPR......PLIMIRAFRIYFRFELPRtR..................
ENSGGOP00000016934  .............................LRIPR......PLIMIRAFRIYFRFELPRtR..................
ENSGGOP00000004744  .............................LYIAD......GVQSLRILKLIGYSQGIR.T..................
ENSGGOP00000010343  .............................HEPLR......IRRLLRPFFLLQNSSMMK.K..................
ENSGGOP00000027967  .............................HEPLR......IRRLLRPFFLLQNSSMMK.K..................
ENSGGOP00000025809  .............................FRIVF......LFRI--------------.-..................
ENSGGOP00000024463  .............................-----......--------------PGMR.I..................
ENSGGOP00000002078  .............................LKPLI......SMKFLRPLRVLSQFERMK.K..................
ENSGGOP00000010207  .............................FYFIV......VLRPLQLLRLFKLKERYR.N..................
ENSGGOP00000010203  .............................FYFIV......VLRPLQLLRLFKLKERYR.N..................
ENSGGOP00000003957  .............................LGLLI......LLRLWRVARII-------.-..................
ENSGGOP00000011478  .............................-----......------------------.-..................
ENSGGOP00000010203  .............................VRVTR......ALRCIFLVDCR-YCGGVR.R..................
ENSGGOP00000010207  .............................VRVTR......ALRCIFLVDCR-YCGGVR.R..................
ENSGGOP00000001755  .............................-----......------------------.-..................
ENSGGOP00000018945  .............................-----......------------------.-..................
ENSGGOP00000022444  .................hlaywqiqfnniAAVTV......FFVWIKLFKFINFNRTMS.Q..................
ENSGGOP00000018177  .............................LGLLI......LLRLWRVARII-------.-..................
ENSGGOP00000003268  .................hlaywqiqfnniAAVTV......FFVWIKLFKFINFNRTMS.Q..................
ENSGGOP00000001590  .............................VRLLR......LIILIRIFHLLHQKRQLE.K..................
ENSGGOP00000020483  ...................afwqtqynnmNAVNL......FFAWIKVFKYISFNKTMT.Q..................
ENSGGOP00000020927  ...................afwqtqynnmNAVNL......FFAWIKVFKYISFNKTMT.Q..................
ENSGGOP00000001815  ...................afwqtqynnmNAVNL......FFAWIKVFKYISFNKTMT.Q..................
ENSGGOP00000007339  .............................-----......------------------.-..................
ENSGGOP00000001254  .............................IKVVQ......FIRILRIFKLI-------.-..................
ENSGGOP00000000981  .............................LRLLR......LIILLRIFHLFHQKRQLE.K..................
ENSGGOP00000026559  .............................-----......------------------.-..................
ENSGGOP00000000982  .............................VRLLR......LIILIRIFHLLHQKRQLE.K..................
ENSGGOP00000009351  .............................-----......------------------.-..................
ENSGGOP00000014483  ..........................wdaISLII......MLRIWRVKRVI-------.-..................
ENSGGOP00000023496  ..........................wdaISLII......MLRIWRVKRVI-------.-..................
ENSGGOP00000016934  .............................-----......------FFSVCGRNVTLK.M..................
ENSGGOP00000016605  .............................-----......------------------.-..................
ENSGGOP00000014493  .............................-----......------------------.-..................
ENSGGOP00000012367  .............................-----......------------------.-..................
ENSGGOP00000027522  .............................-----......------------------.-..................


                      0       130                        140       150                              
                      |         |                          |         |                              
d1orqc_               FLSAIADAADKI.................RFYHLFGAVMLTVLYGAFAI.............................
ENSGGOP00000011420  LGQTLKASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000021753  LGQTLKASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000000656  LGQTLKASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000011744  LGKTLQASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000003210  LGFTLRRSYNE-.................-LGLLILFLAMGIMIFSSLV.............................
ENSGGOP00000027568  LGKTLQASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000007168  LGHTLRASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000024337  LGHTLRASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000002688  LGYTLKSCASE-.................-LGFLLFSLTMAIIIFATVM.............................
ENSGGOP00000009305  LTYALKRSFKE-.................-LGLLLMYLAVGIFVFSALG.............................
ENSGGOP00000006737  LGFTLRRSYNE-.................-LGLLILFLAMGIMIFSSLV.............................
ENSGGOP00000015335  LGHTLRASTNE-.................-FLLLIIFLALGVLIFATMI.............................
ENSGGOP00000015202  LGYTLKSCASE-.................-LGFLLFSLTMAIIIFATVM.............................
ENSGGOP00000003820  LGHTLRASTNE-.................-FLLLIIFLALGVLIFATMI.............................
ENSGGOP00000008219  LGQTLKASMRE-.................-LGLLIFFLFIGVILFSSAV.............................
ENSGGOP00000022687  LGHTLRASTNE-.................-FLLLIIFLALGVLIFATMI.............................
ENSGGOP00000013400  LGQTLRASMRE-.................-LGLLIFFLFIGVVLFSSAV.............................
ENSGGOP00000027450  LGHTLRASTNE-.................-FLLLIIFLALGVLIFATMI.............................
ENSGGOP00000000227  FGFTLRQCYQQ-.................-VGCLLLFIAMGIFTFSAAV.............................
ENSGGOP00000012818  LGHTLRASTNE-.................-FLLLIIFLALGVLIFATMI.............................
ENSGGOP00000008276  LGMTITQCYEE-.................-VGLLLLFLSVGISIFSTVE.............................
ENSGGOP00000019798  LGHTLRASTNE-.................-FLLLIIFLALGVLIFATMI.............................
ENSGGOP00000006085  LGHTLRASTNE-.................-FLLLIIFLALGVLIFATMI.............................
ENSGGOP00000000958  LGATLRHSYQE-.................-VGLLLLFLSVGISIFSVLI.............................
ENSGGOP00000002752  LGATLKYSYKE-.................-VGLLLLYLSVGISIFSVVA.............................
ENSGGOP00000000831  LGLTARRCTRE-.................-FGLLLLFLCVAIALFAPLL.............................
ENSGGOP00000002953  LGATLKHSYRE-.................-VGILLLYLAVGVSVFSGVA.............................
ENSGGOP00000023230  LGATLKHSYRE-.................-VGILLLYLAVGVSVFSGVA.............................
ENSGGOP00000001534  LGLTVRRCTRE-.................-FGLLLLFLAVAVTLFSPLV.............................
ENSGGOP00000005162  LGLTVRRCARE-.................-FGLLLLFLCVAMALFAPLV.............................
ENSGGOP00000001664  LGLTLKRCYRE-.................-MVMLLVFICVAMAIFSALS.............................
ENSGGOP00000025520  LGSVVYAHSKE-.................-LVTAWYIGFLCLILASFLV.............................
ENSGGOP00000016408  YGAAV-------.................-LFLLMCTFALIAHWLACIW.............................
ENSGGOP00000020811  LGSVVYAHSKE-.................-LVTAWYIGFLCLILASFLV.............................
ENSGGOP00000008202  LGSVVYAHSKE-.................-LVTAWYIGFLCLILASFLV.............................
ENSGGOP00000012351  YGAAV-------.................-LMLLMCIFALIAHWLACIW.............................
ENSGGOP00000028732  YGAAV-------.................-LVLLVCVFGLVAHWLACIW.............................
ENSGGOP00000011126  LGSVVYAHSKE-.................-LITAWYIGFLVLIFSSFLV.............................
ENSGGOP00000012234  VVNALLGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000024945  VVNALLGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000008980  VVNALVGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000013052  LGSVVFIHRQE-.................-LITTLYIGFLGLIFSSYFV.............................
ENSGGOP00000012641  VVNALVGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000028610  YGAAV-------.................-LVLLVCVFGLAAHWMACIW.............................
ENSGGOP00000006310  VVDALVGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000001711  LGSAICAHSKE-.................-LITAWYIGFLTLILSSFLV.............................
ENSGGOP00000017557  VVETLISSLKP-.................-IGNIVLICCAFFIIFGILG.............................
ENSGGOP00000024463  VVETLISSLKP-.................-IGNIVLICCAFFIIFGILG.............................
ENSGGOP00000009882  VVETLISSLKP-.................-IGNIVLICCAFFIIFGILG.............................
ENSGGOP00000023204  VVETLMSSLKP-.................-IGNIVVICCAFFIIFGILG.............................
ENSGGOP00000003342  VVETLMSSLKP-.................-IGNIVVICCAFFIIFGILG.............................
ENSGGOP00000000352  VVNALLGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000028147  VVNALLGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000016440  VVNALVGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000008980  LLFALMMSLPA-.................-LFNIGLLLFLVMFIFSIFG.............................
ENSGGOP00000024463  QLVVLMKTMDN-.................-VATFCMLLMLFIFIFSILG.............................
ENSGGOP00000017557  QLVVLMKTMDN-.................-VATFCMLLMLFIFIFSILG.............................
ENSGGOP00000001541  YSAVV-------.................-LTLLMAVFALLAHWVACVW.............................
ENSGGOP00000009882  QLVVLMKTMDN-.................-VATFCMLLMLFIFIFSILG.............................
ENSGGOP00000013701  VVETLISSLRP-.................-IGNIVLICCAFFIIFGILG.............................
ENSGGOP00000021319  VVETLISSLRP-.................-IGNIVLICCAFFIIFGILG.............................
ENSGGOP00000027513  VVETLISSLRP-.................-IGNIVLICCAFFIIFGILG.............................
ENSGGOP00000023417  LLFALMMSLPA-.................-LFNIGLLLFLVMFIYAIFG.............................
ENSGGOP00000005331  LLFALMMSLPA-.................-LFNIGLLLFLVMFIYAIFG.............................
ENSGGOP00000025522  RTNYP--NIFR-.................-ISNLVMYIVIIIHWNACVF.............................
ENSGGOP00000013502  RTNYP--NIFR-.................-ISNLVMYIVIIIHWNACVF.............................
ENSGGOP00000025809  VVNALIGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000024945  LLFALMMSLPA-.................-LFNIGLLLFLVMFIYSIFG.............................
ENSGGOP00000012234  LLFALMMSLPA-.................-LFNIGLLLFLVMFIYSIFG.............................
ENSGGOP00000000352  LLFALMMSLPALfn...............IGLLLFLLLFLVMFIYAIFG.............................
ENSGGOP00000013701  QLVVLVKTMDN-.................-VATFCTLLMLFIFIFSILG.............................
ENSGGOP00000021319  QLVVLVKTMDN-.................-VATFCTLLMLFIFIFSILG.............................
ENSGGOP00000027513  QLVVLVKTMDN-.................-VATFCTLLMLFIFIFSILG.............................
ENSGGOP00000003602  VLNSIIKAMVP-.................-LLHIALLVLFVIIIYAIIG.............................
ENSGGOP00000017118  HSTIV-------.................-LTLLMSMFALLAHWMACIW.............................
ENSGGOP00000016440  LLFALMMSLPA-.................-LFNIGLLLFLVMFIYAIFG.............................
ENSGGOP00000015188  CSAVV-------.................-LTLLMSVFALLAHWMACIW.............................
ENSGGOP00000019923  LVVSLMSSMKS-.................-IISLLFLLFLFIVVFALLG.............................
ENSGGOP00000003342  QLVVLMKTMDN-.................-VATFCMLLMLFIFIFSILG.............................
ENSGGOP00000023204  QLVVLMKTMDN-.................-VATFCMLLMLFIFIFSILG.............................
ENSGGOP00000010829  LVVSLMSSMKS-.................-IISLLFLLFLFIVVFALLG.............................
ENSGGOP00000027293  LGSVVYAHSKE-.................-LITAWYIGFLVLIFSSFLV.............................
ENSGGOP00000026337  RTSYP--NIFR-.................-ISNLVLYILVIIHWNACIY.............................
ENSGGOP00000012641  LLFALMMSLPA-.................-LFNIGLLLFLVMFIYSIFG.............................
ENSGGOP00000026186  IFHMTYDLASAVv................RIVNLIGMMLLLCHWDGCLQ.............................
ENSGGOP00000008627  IFHMTYDLASAVv................RIVNLIGMMLLLCHWDGCLQ.............................
ENSGGOP00000012593  RTSYP--NIFR-.................-ISNLVLYILVIIHWNACIY.............................
ENSGGOP00000013701  LVTLLLDTLPM-.................-LGNVLLLCFFVFFIFGIVG.............................
ENSGGOP00000021319  LVTLLLDTLPM-.................-LGNVLLLCFFVFFIFGIVG.............................
ENSGGOP00000022082  LLWTFIKSFQA-.................-LPYVALLIVMLFFIYAVIG.............................
ENSGGOP00000028147  LLFALMMSLPALfniglllflxx......XXLLLFLVMFIYAIFGMSNF.............................
ENSGGOP00000000898  VLNSIMKALVP-.................-LLHIALLVLFVIIIYAIIG.............................
ENSGGOP00000022765  RTNYP--NMFR-.................-IGNLVLYILIIIHWNACIY.............................
ENSGGOP00000003013  RTNYP--NMFR-.................-IGNLVLYILIIIHWNACIY.............................
ENSGGOP00000006428  LLFALMMSLPS-.................-LFNIGLLLFLIMFIYAILG.............................
ENSGGOP00000006310  LLFALMMSLPA-.................-LFNIGLLLFLVMFIYSIFG.............................
ENSGGOP00000017309  LVVSLLNSMKS-.................-IISLLFLLFLFIVVFALLG.............................
ENSGGOP00000015727  IFHMTYDLASAVv................RIFNLIGMMLLLCHWDGCLQ.............................
ENSGGOP00000008481  LVVSLLNSMKS-.................-IISLLFLLFLFIVVFALLG.............................
ENSGGOP00000006428  VVNALIGAIPA-.................-ILNVLLVCLIFWLIFCILG.............................
ENSGGOP00000004729  LVVSLLNSMKS-.................-IISLLFLLFLFIVVFALLG.............................
ENSGGOP00000003342  LVTLLLDTLPM-.................-LGNVLLLCFFVFFIFGIVG.............................
ENSGGOP00000001513  IFHMTYDLASAVv................RIFNLIGMMLLLCHWDGCLQ.............................
ENSGGOP00000021823  VLNSIMKALVP-.................-LLHIALLVLFVIIIYAIIG.............................
ENSGGOP00000021537  IFHMTYDLASAVv................RIVNLIGMMLLLCHWDGCLQ.............................
ENSGGOP00000018103  SNSIK-------.................-LVNLLSIFISTWLTAAGFI.............................
ENSGGOP00000003602  LLWTFIKSFQA-.................-LPYVALLIAMLFFIYAVIG.............................
ENSGGOP00000013701  LLDTVVQALPQ-.................-VGNLGLLFMLLFFIYAALG.............................
ENSGGOP00000021319  LLDTVVQALPQ-.................-VGNLGLLFMLLFFIYAALG.............................
ENSGGOP00000027513  LLDTVVQALPQ-.................-VGNLGLLFMLLFFIYAALG.............................
ENSGGOP00000002713  LVASLLNSVRS-.................-IASLLLLLFLFIIIFSLLG.............................
ENSGGOP00000002713  LLWTFIKSFQA-.................-LPYVALLIVMLFFIYAVIG.............................
ENSGGOP00000000898  LLWTFIKSFQA-.................-LPYVALLIAMIFFIYAVIG.............................
ENSGGOP00000005331  VVNALLGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000021823  LLWTFIKSFQA-.................-LPYVALLIAMIFFIYAVIG.............................
ENSGGOP00000001185  LVASLLNSIRS-.................-IASLLLLLFLFIVIFALLG.............................
ENSGGOP00000008481  LLWTFVQSFKA-.................-LPYVCLLIAMLFFIYAIIG.............................
ENSGGOP00000001185  LLWTFIKSFQA-.................-LPYVALLIVMLFFIYAVIG.............................
ENSGGOP00000023924  LLWTFIKSFQA-.................-LPYVALLIVMLFFIYAVIG.............................
ENSGGOP00000022383  LIFHM------Tydlasavv.........RIFNLIGMMLLLCHWDGCLQ.............................
ENSGGOP00000023204  LVTLLLDTLPM-.................-LGNVLLLCFFVFFIFGIVG.............................
ENSGGOP00000023417  VVNALLGAIPS-.................-IMNVLLVCLIFWLIFSIMG.............................
ENSGGOP00000024463  LLDTVVQALPQ-.................-VGNLGLLFMLLFFIYAALG.............................
ENSGGOP00000016442  YGAAV-------.................-LFLLMCTFALIAHWLACIW.............................
ENSGGOP00000009882  LLDTVVQALPQ-.................-VGNLGLLFMLLFFIYAALG.............................
ENSGGOP00000019923  LLWTFVQSFKA-.................-LPYVCLLIAMLFFIYAIIG.............................
ENSGGOP00000017309  LLWTFVQSFKA-.................-LPYVCLLIAMLFFIYAIIG.............................
ENSGGOP00000017557  LLDTVVQALPQ-.................-VGNLGLLFMLLFFIYAALG.............................
ENSGGOP00000010829  LLWTFVQSFKA-.................-LPYVCLLIAMLFFIYAIIG.............................
ENSGGOP00000001185  VVQCMFVAIST-.................-IGNIVLVTTLLQFMFACIG.............................
ENSGGOP00000019172  YGAAV-------.................-LFLLMCTFALIAHWLACIW.............................
ENSGGOP00000019923  VFDCVVTSLKN-.................-VFNILIVYKLFMFIFAVIA.............................
ENSGGOP00000003342  LLDTVMQALPQ-.................-VGNLGLLFMLLFFIFAALG.............................
ENSGGOP00000023204  LLDTVMQALPQ-.................-VGNLGLLFMLLFFIFAALG.............................
ENSGGOP00000008481  VLKSIMKAMIP-.................-LLQIGLLLFFAILIFAIIGlefymgkfhttcfeegtddiqgespapcg
ENSGGOP00000000501  SNSIK-------.................-LVNLLSIFISTWLTAAGFI.............................
ENSGGOP00000023924  VVQCMFVAIST-.................-IGNIVLVTTLLQFMFACIG.............................
ENSGGOP00000004729  VFDCVVNSLKN-.................-VLNILIVYMLFMFIFAVIA.............................
ENSGGOP00000027513  LVWLMVETLLPA.................WSHLLKLCFFVFFIFGIVGV.............................
ENSGGOP00000010829  VFDCVVTSLKN-.................-VFNILIVYKLFMFIFAVIA.............................
ENSGGOP00000004729  LLWTFVQSFKA-.................-LPYVCLLIAMLFFIYAIIG.............................
ENSGGOP00000001185  VLNSIFKAMLP-.................-LFHIALLVLFMVIIYAIIG.............................
ENSGGOP00000023924  VLNSIFKAMLP-.................-LFHIALLVLFMVIIYAIIG.............................
ENSGGOP00000000352  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000007211  RFRFARKPFCVI.................ELITAWYIGFLVLIFASFLV.............................
ENSGGOP00000028147  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000020299  LLWTFIKSFQA-.................-LPYVALLIAMLFFIYAVIG.............................
ENSGGOP00000013354  VTGTLGQSLPS-.................-IAAILILMFTCLFLFSAVL.............................
ENSGGOP00000008980  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000010829  VLKSIMKAMVP-.................-LLQIGLLLFFAILMFAIIG.............................
ENSGGOP00000024945  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000012234  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000021390  PTSPRQAQRSE-.................-LITAWYIGFLVLIFASFLV.............................
ENSGGOP00000023417  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000005331  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000002713  VLNSIIKAMVP-.................-LLHIALLVLFVIIIYAIIG.............................
ENSGGOP00000020299  LVASLLNSMKS-.................-IASLLLLLFLFIIIFSLLG.............................
ENSGGOP00000003602  LVASLLNSMKS-.................-IASLLLLLFLFIIIFSLLG.............................
ENSGGOP00000012641  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000010638  RTAYP--NAFR-.................-IAKLMLYIFVVIHWNSCLY.............................
ENSGGOP00000020299  VLNSIIKAMVP-.................-LLHIALLVLFVIIIYAIIG.............................
ENSGGOP00000004729  VLKSIMKAMVP-.................-LLQIGLLLFFAILMFAIIG.............................
ENSGGOP00000016440  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALIG.............................
ENSGGOP00000025809  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000006736  IHQWEEASAV-M.................RICNLISMMLLLCHWDGCLQ.............................
ENSGGOP00000022082  VLNSIIKAMVP-.................-LLHIALLVLFVIIIYAIIG.............................
ENSGGOP00000000352  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALIG.............................
ENSGGOP00000005331  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALIG.............................
ENSGGOP00000008980  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALIG.............................
ENSGGOP00000012641  IVGALIQSVKK-.................-LADVMVLTVFCLSVFALIG.............................
ENSGGOP00000000898  LVASLLNSMKS-.................-IASLLLLLFLFIIIFSLLG.............................
ENSGGOP00000028147  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALIG.............................
ENSGGOP00000003602  VVQCVFVAIRT-.................-IGNIMIVTTLLQFMFACIG.............................
ENSGGOP00000023417  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALIG.............................
ENSGGOP00000006310  IVGALIHSVKK-.................-LADVTILTIFCLSVFALVG.............................
ENSGGOP00000006310  LIKIIGNSVGA-.................-LGNLTIILAIIVFVFALVG.............................
ENSGGOP00000020299  VVQCVFVAIRT-.................-IGNIMIVTTLLQFMFACIG.............................
ENSGGOP00000023924  LVASLLNSIRS-.................-IASLLLLLFLFIVIFALLG.............................
ENSGGOP00000011260  SNSVK-------.................-FSKLLSIILSTWFTAAGFI.............................
ENSGGOP00000012234  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALVG.............................
ENSGGOP00000024945  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALVG.............................
ENSGGOP00000021823  LVASLLNSMKS-.................-IASLLLLLFLFIIIFSLLG.............................
ENSGGOP00000021823  VVQCVFVAIRT-.................-IGNIMIVTTLLQFMFACIG.............................
ENSGGOP00000008481  VFDCVVNSLKN-.................-VFNILIVYMLFMFIFAVVA.............................
ENSGGOP00000000898  VVQCVFVAIRT-.................-IGNIMIVTTLLQFMFACIG.............................
ENSGGOP00000017309  VFDCVVNSLKN-.................-VFNILIVYMLFMFIFAVVA.............................
ENSGGOP00000016440  LIKIIGNSVGA-.................-LGNLTLVLAIIVFIFAVVG.............................
ENSGGOP00000022082  LVASLLNSVRS-.................--------IALGMQLFGGKF.............................
ENSGGOP00000009838  HLESIMDKAYIY.................RVIRTTGYLLFILHINACVY.............................
ENSGGOP00000006428  IVGALLRSVKK-.................-LVNVIILTFFCLSIFALVG.............................
ENSGGOP00000005127  MINDFHRAILRTqsamsn...........QVLILFCTLLCLVFTGTCGI.............................
ENSGGOP00000016918  MINDFHRAILRTqsamsn...........QVLILFCTLLCLVFTGTCGI.............................
ENSGGOP00000001687  KIRVIST-----.................-ILFILAGCIVFVTIPAVIF.............................
ENSGGOP00000015184  TRFVMKTLMTIC.................PGTVLLVFSISLWIIAAWTV.............................
ENSGGOP00000017557  LVNLLLDTLPM-.................-LGNVLLLCFFVFFIFGIIG.............................
ENSGGOP00000022082  VVQCVFVAIRT-.................-IGNIVIVTTLLQFMFACIG.............................
ENSGGOP00000006428  LIKIIGNSVGA-.................-LGSLTVVLVIVIFIFSVVG.............................
ENSGGOP00000027687  MINDLHRAIQRTqsamfn...........QVLILISTLLCLIFTCICGI.............................
ENSGGOP00000002713  VVQCVFVAIRT-.................-IGNIVIVTTLLQFMFACIG.............................
ENSGGOP00000007339  VVRELFSGFKE-.................-IFLVSILLLTLMLVFASFG.............................
ENSGGOP00000016934  VVRELFSGFKE-.................-IFLVSILLLTLMLVFASFG.............................
ENSGGOP00000025319  ----KIRIIS--.................TIIFILFGCVLFVALPAIIF.............................
ENSGGOP00000025813  ------------.................-GLCFLCFLVTYALVGAVLF.............................
ENSGGOP00000003047  ------------.................--LSLIVCTFTYLLVGAAVF.............................
ENSGGOP00000025809  IVGALIQSVKK-.................-LSDVMILTVFCLSVFALIG.............................
ENSGGOP00000008617  AWGILMDMRWRW.................MMLVFSASFVVHWLVFAVLW.............................
ENSGGOP00000012511  TRFVMKTLMTIC.................PGTVLLVFSISLWIIAAWTV.............................
ENSGGOP00000005228  IFTTCVDIRWRW.................MLVIFCLAFVLSWLFFGCVF.............................
ENSGGOP00000024187  -----IRIIST-.................-IIFILFGCVLFVALPAIIF.............................
ENSGGOP00000007461  ------------.................-VLPLLLAYVCYLLLGATIF.............................
ENSGGOP00000016722  LESIL-SKAYVY.................RVIRTTAYLLYSLHLNSCLY.............................
ENSGGOP00000027288  ------------.................-VLPLLLAYVCYLLLGATIF.............................
ENSGGOP00000005376  ------MNTH--.................PGRLLLGLTLGLWLTTAWVL.............................
ENSGGOP00000006442  IIRVILQSVPD-.................-MANIMVLILFFMLVFSVFG.............................
ENSGGOP00000024150  TRFVMKTLMTIC.................PGTVLLVFSISLWIIAAWTV.............................
ENSGGOP00000001687  -------VMKWK.................TVVAIFVVVVVYLVTGGLVF.............................
ENSGGOP00000009882  LVNLLLDTLPM-.................-LGNVLLLCFFVFFIFGIIG.............................
ENSGGOP00000003047  ----------EN.................MVTVGFFSCMGTLCIGAAAF.............................
ENSGGOP00000002078  LMWSLSNSWVA-.................-LKDLVLLLFTFIFFSAAFG.............................
ENSGGOP00000027711  IFTTCVDTRWRY.................MLMIFSAAFLVSWLFFGLLF.............................
ENSGGOP00000000658  MFITCVDIRWRY.................MLLIFSLAFLASWLLFGIIF.............................
ENSGGOP00000019229  LFTTLVDLQWRL.................SLLFFVLAYALTWLFFGAIW.............................
ENSGGOP00000000546  IFTTCVDTRWRY.................MLMIFSAAFLVSWLFFGLLF.............................
ENSGGOP00000007454  ------------.................---LLLLAYLAYLALGTGVF.............................
ENSGGOP00000024187  ---------KWK.................TVSTIFLVVVLYLIIGATVF.............................
ENSGGOP00000018574  --------MRST.................TLLALLALVLLYLVSGALVF.............................
ENSGGOP00000001313  --------MRST.................TLLALLALVLLYLVSGALVF.............................
ENSGGOP00000022306  LFTTLVDLKWRF.................NLLVFTMVYTVTWLFFGFIW.............................
ENSGGOP00000006045  IILVLVRALKS-.................-MTFLLMLLLIFFYIFAVTG.............................
ENSGGOP00000026587  QVVAIVHA----.................-VLLGFVTVSCFFFIPAAVF.............................
ENSGGOP00000003743  IFTTLVDLKWRF.................NLLIFVMVYTVTWLFFGMIW.............................
ENSGGOP00000005670  ------------.................-LKCLISLSTAILLGLVVLY.............................
ENSGGOP00000025319  ---------KWK.................TVSTIFLVVVLYLIIGATVF.............................
ENSGGOP00000003637  VFTTLVDLKWPH.................TLLIFTMSFLCSWLLFAMAW.............................
ENSGGOP00000010687  QVVAIVH-----.................AVLLGFVTVSCFFFIPAAVF.............................
ENSGGOP00000005951  RGVSLRKAQITC.................TVIFIVWGVLVHLVIPPFVF.............................
ENSGGOP00000013120  LFTTCVDVRWRW.................MCLLFSCSFLASWLLFGLAF.............................
ENSGGOP00000002078  LMLPLMLSLPA-.................-LLNIILLIFLVMFIYAIFG.............................
ENSGGOP00000008753  IFTTLVDLKWRH.................TLVIFTMSFLCSWLLFAIMW.............................
ENSGGOP00000018872  ------------.................---GLILCTLCYLLVSAAVF.............................
ENSGGOP00000017068  ------------.................---GLILCTLCYLLVSAAVF.............................
ENSGGOP00000028458  IFTTLVDTKWRH.................MFVIFSLSYILSWLIFGSVF.............................
ENSGGOP00000025813  ------------.................PLPIIALIVFAYISCAAAIL.............................
ENSGGOP00000019335  ------------.................-FLLLAALIVLYLLGGAAVF.............................
ENSGGOP00000001313  ------RVLSA-.................-MLFLLIGCLLFVLTPTFVF.............................
ENSGGOP00000027030  LFTTLVDLKWRW.................NLFIFILTYTVAWLFMASMW.............................
ENSGGOP00000012459  ------------.................-LLILGLFAVLLSCCASAMY.............................
ENSGGOP00000026172  ------------.................-LLILGLFAVLLSCCASAMY.............................
ENSGGOP00000017309  VLKSIMKAMIP-.................-LLQIGLLLFFAILIFAIIGlefymgkfhttcfeegtddiqgespapcg
ENSGGOP00000018574  ------RVLSA-.................-MLFLLIGCLLFVLTPTFVF.............................
ENSGGOP00000004798  IWTTVLDLKWRY.................KMTIFITAFLGSWFFFGLLW.............................
ENSGGOP00000027211  IWTTVLDLKWRY.................KMTIFITAFLGSWFFFGLLW.............................
ENSGGOP00000018872  LRRTCMSTENL-.................-VVAGLLACAATLALGAVAF.............................
ENSGGOP00000007946  RGALPQESLKDAgqcegdslagwkpsvyyVMLILCTASILISCCASAMY.............................
ENSGGOP00000009787  ------------.................---GALAAYAAYLVLGALLV.............................
ENSGGOP00000017068  LRRTCMSTENL-.................-VVAGLLACAATLALGAVAF.............................
ENSGGOP00000012459  ------------.................RFVLLAALIGLYLVAGATVF.............................
ENSGGOP00000017225  LWTTFIDMQWRY.................KLLLFSATFAGTWFLFGVVW.............................
ENSGGOP00000024508  LWTTFIDMQWRY.................KLLLFSATFAGTWFLFGVVW.............................
ENSGGOP00000026172  ------------.................-FVLLAALIGLYLVAGATVF.............................
ENSGGOP00000007339  FVYKIFGPGKK-.................-LGSLVVFTASLLIVMSAIS.............................
ENSGGOP00000012997  LWTTVIDMKWRY.................KLTLFAATFVMTWFLFGVIY.............................
ENSGGOP00000016934  FVYKIFGPGKK-.................-LGSLVVFTASLLIVMSAIS.............................
ENSGGOP00000009787  WGWDPRRAACWH.................LVALLGVIVTICFLVPAVIF.............................
ENSGGOP00000019335  ------------.................-MLILCTASILISCCASAMY.............................
ENSGGOP00000010687  -----HRSAWC-.................-FGFLVLGYLLYLVFGAVVF.............................
ENSGGOP00000007461  ------------.................LALFLTLGTLVILIFPPMVF.............................
ENSGGOP00000005951  ------------.................--------------------.............................
ENSGGOP00000007454  ---------WLA.................GSGALLSGLLLFLLLPPLLF.............................
ENSGGOP00000002078  LVGVLIHCLKK-.................-LIGVIILTLFFLSIFSLIG.............................
ENSGGOP00000011478  ---------PWA.................RYGLLVVAHLLALGLGAVVF.............................
ENSGGOP00000027967  VASTVLGLVQN-.................-MRAFGGILVVVYYVFAIIG.............................
ENSGGOP00000027288  -----------G.................LALFLTLGTLVILIFPPMVF.............................
ENSGGOP00000010343  VASTVLGLVQN-.................-MRAFGGILVVVYYVFAIIG.............................
ENSGGOP00000021593  ------------.................--------------------.............................
ENSGGOP00000007339  ITNILKRSGEQ-.................-IWSVSIFLLFFLLLYGILG.............................
ENSGGOP00000016934  ITNILKRSGEQ-.................-IWSVSIFLLFFLLLYGILG.............................
ENSGGOP00000004744  LITAVGQTVYT-.................-VASVLLLLFLLMYIFAILG.............................
ENSGGOP00000010343  TLKCIRWSLPE-.................-MASVGLLLAIHLCLFTMFG.............................
ENSGGOP00000027967  TLKCIRWSLPE-.................-MASVGLLLAIHLCLFTMFG.............................
ENSGGOP00000025809  ------------.................--------------------.............................
ENSGGOP00000024463  LVNLLLDTLPM-.................-LGNVLLLCFFVFFIFGIIG.............................
ENSGGOP00000002078  YICQKMNLGSVN.................KLSNYTNIVLIFYNTFMCFC.............................
ENSGGOP00000010207  VLDTMFELLPR-.................-MASLGLTLLIFYYSFAIVG.............................
ENSGGOP00000010203  VLDTMFELLPR-.................-MASLGLTLLIFYYSFAIVG.............................
ENSGGOP00000003957  ------------.................--------------------.............................
ENSGGOP00000011478  ------------.................-VALGLLVASSFVLLPALVL.............................
ENSGGOP00000010203  NLRQIFQSLPP-.................-FMDILLLLLFFMIIFAILG.............................
ENSGGOP00000010207  NLRQIFQSLPP-.................-FMDILLLLLFFMIIFAILG.............................
ENSGGOP00000001755  ------------.................FQSTLWLLVGLSVHVVAVML.............................
ENSGGOP00000018945  ------------.................----LWLLVGLSVHVVAVML.............................
ENSGGOP00000022444  LSTTMSRCAKD-.................-LFGFAIMFFIIFLAYAQLA.............................
ENSGGOP00000018177  ------------.................--------------------.............................
ENSGGOP00000003268  LSTTMSRCAKD-.................-LFGFAIMFFIIFLAYAQLA.............................
ENSGGOP00000001590  LMRRLVSE----.................--------------------.............................
ENSGGOP00000020483  LSSTLARCAKD-.................-ILGFAVMFFIVFFAYAQLG.............................
ENSGGOP00000020927  LSSTLARCAKD-.................-ILGFAVMFFIVFFAYAQLG.............................
ENSGGOP00000001815  LSSTLARCAKD-.................-ILGFAVMFFIVFFAYAQLG.............................
ENSGGOP00000007339  -LLTVVVSMYK-.................-SFFIIVGMFLLLLCYAFAG.............................
ENSGGOP00000001254  ------------.................--------------------.............................
ENSGGOP00000000981  LLRR--------.................--------------------.............................
ENSGGOP00000026559  ------------.................-----VSVVLFLVSRFSPYE.............................
ENSGGOP00000000982  LMRRLV------.................--------------------.............................
ENSGGOP00000009351  ------------.................-----VSVVLFLVSRFSPYE.............................
ENSGGOP00000014483  ------------.................--------------------.............................
ENSGGOP00000023496  ------------.................--------------------.............................
ENSGGOP00000016934  LLLTVVVSMYK-.................-SFFIIVGMFLLLLCYAFAG.............................
ENSGGOP00000016605  ------------.................-AYIGVSVVLFLVSRFSPYE.............................
ENSGGOP00000014493  ------------.................-------MCIVFAYIGVSVV.............................
ENSGGOP00000012367  ------------.................-AYIGVSVVLFLVSRFSPYE.............................
ENSGGOP00000027522  ------------.................-AYIGVSVVLFLVSRFSPYE.............................


                                                                                                    
                                                                                                    
d1orqc_               ...............YIVEYPD........................................................
ENSGGOP00000011420  ...............YFAEADE........................................................
ENSGGOP00000021753  ...............YFAEAEE........................................................
ENSGGOP00000000656  ...............YFAEADD........................................................
ENSGGOP00000011744  ...............YFAEADN........................................................
ENSGGOP00000003210  ...............FFAEKDE........................................................
ENSGGOP00000027568  ...............YFAEADD........................................................
ENSGGOP00000007168  ...............YFAEADE........................................................
ENSGGOP00000024337  ...............YFAEADE........................................................
ENSGGOP00000002688  ...............FYAEKGT........................................................
ENSGGOP00000009305  ...............YTMEQSH........................................................
ENSGGOP00000006737  ...............FFAEKDE........................................................
ENSGGOP00000015335  ...............YYAERIGaqpndpsas...............................................
ENSGGOP00000015202  ...............FYAEKGS........................................................
ENSGGOP00000003820  ...............YYAERVGaqpndpsas...............................................
ENSGGOP00000008219  ...............YFAGVDE........................................................
ENSGGOP00000022687  ...............YYAERVGaqpndpsas...............................................
ENSGGOP00000013400  ...............YFAEVDR........................................................
ENSGGOP00000027450  ...............YYAERIGarpsdprgn...............................................
ENSGGOP00000000227  ...............YSVEHDV........................................................
ENSGGOP00000012818  ...............YYAERIGarpsdprgn...............................................
ENSGGOP00000008276  ...............YFAEQSI........................................................
ENSGGOP00000019798  ...............YYAERIGarpsdprgn...............................................
ENSGGOP00000006085  ...............YYAERIGadpddilgs...............................................
ENSGGOP00000000958  ...............YSVEKDD........................................................
ENSGGOP00000002752  ...............YTIEKEE........................................................
ENSGGOP00000000831  ...............YVIENEM........................................................
ENSGGOP00000002953  ...............YTAEKE-........................................................
ENSGGOP00000023230  ...............YTAEKE-........................................................
ENSGGOP00000001534  ...............YMAEKES........................................................
ENSGGOP00000005162  ...............HLAEREL........................................................
ENSGGOP00000001664  ...............QLLEHGLdlet....................................................
ENSGGOP00000025520  ...............YLAEKG-........................................................
ENSGGOP00000016408  ...............YAIGNMEqphmdsrigwlhnlgdqigkpynssglg............................
ENSGGOP00000020811  ...............YLAEKG-........................................................
ENSGGOP00000008202  ...............YLAEKG-........................................................
ENSGGOP00000012351  ...............YAIGNVErpyltdkigwldslgqqigkryndsdsss...........................
ENSGGOP00000028732  ...............YSIGDYEvidevtntiqidswlyqlalsigtpyryntsagiweg...................
ENSGGOP00000011126  ...............YLVEKDA........................................................
ENSGGOP00000012234  ...............VNLFAGKfyycintttserfdisevnnkseceslmhtgqvrwln...................
ENSGGOP00000024945  ...............VNLFAGKfyycintttserfdisevnnkseceslmhtgqvrwln...................
ENSGGOP00000008980  ...............VNLFAGKyhycfnetseirfeiedvnnkteceklmeg..........................
ENSGGOP00000013052  ...............YLAEKDA........................................................
ENSGGOP00000012641  ...............VNLFAGKfgrcinqtegdlplnytivnnksqceslnmtgelywtk..................
ENSGGOP00000028610  ...............YSIGDYEifdedtktirnnswlyqlamdigtpyqfngsgsgkweg..................
ENSGGOP00000006310  ...............VNLFAGKfwrcinytdgeyslvplsivnnksdckiqnstgsffwvn.................
ENSGGOP00000001711  ...............YLVEKDV........................................................
ENSGGOP00000017557  ...............VQLFKGKfyhclgvdtrnitnrsdcmaanyrwvh.............................
ENSGGOP00000024463  ...............VQLFKGKfyhclgvdtrnitnrsdcmaanyrwvh.............................
ENSGGOP00000009882  ...............VQLFKGKfyhclgvdtrnitnrsdcmaanyrwvh.............................
ENSGGOP00000023204  ...............VQLFKGKffvcqgedtrnitnksdcaeasyrwvr.............................
ENSGGOP00000003342  ...............VQLFKGKffvcqgedtrnitnksdcaeasyrwvr.............................
ENSGGOP00000000352  ...............VNLFAGKfyhcinyttgemfdvsvvnnyseckaliesnqtarwkn..................
ENSGGOP00000028147  ...............VNLFAGKfyhcinyttgemfdvsvvnnyseckaliesnqtarwkn..................
ENSGGOP00000016440  ...............VNLFAGKfyhcvnmttgnmfdvsdvnnlsdcqalgkqarwkn.....................
ENSGGOP00000008980  ...............MSNFAYV........................................................
ENSGGOP00000024463  ...............MHIFGCKfslrtdtgdtvp............................................
ENSGGOP00000017557  ...............MHIFGCKfslrtdtgdtvp............................................
ENSGGOP00000001541  ...............FYIGQREiesseselpeigwlqelarrletpyylvgrrpaggnssgqsdncsssseangtgle
ENSGGOP00000009882  ...............MHIFGCKfslrtdtgdtvp............................................
ENSGGOP00000013701  ...............VQLFKGKfyycegsdtrnistkaqcraahyrwvr.............................
ENSGGOP00000021319  ...............VQLFKGKfyycegsdtrnistkaqcraahyrwvr.............................
ENSGGOP00000027513  ...............VQLFKGKfyycegsdtrnistkaqcraahyrwvr.............................
ENSGGOP00000023417  ...............MSNFAYV........................................................
ENSGGOP00000005331  ...............MSNFAYV........................................................
ENSGGOP00000025522  ...............YSISKAIgfgndtwvypdindpe........................................
ENSGGOP00000013502  ...............YSISKAIgfgndtwvypdindpe........................................
ENSGGOP00000025809  ...............VNLFAGKfyecinttdgsrfpasqvpnrsecfalmnv..........................
ENSGGOP00000024945  ...............MSNFAYV........................................................
ENSGGOP00000012234  ...............MSNFAYV........................................................
ENSGGOP00000000352  ...............MSNFAYVkrev....................................................
ENSGGOP00000013701  ...............MHLFGCKfslktdtgdtvp............................................
ENSGGOP00000021319  ...............MHLFGCKfslktdtgdtvp............................................
ENSGGOP00000027513  ...............MHLFGCKfslktdtgdtvp............................................
ENSGGOP00000003602  ...............LELFIGKmhktcffadsdivaeedpapcafsgngrqctangtecrsgwvgpng..........
ENSGGOP00000017118  ...............YVIGKMErednsllkwevgwlhelgkrlespyygnntlg........................
ENSGGOP00000016440  ...............MSNFAYV........................................................
ENSGGOP00000015188  ...............YVIGRREmeandpllwdigwlhelgkrlevpyvngsvg.........................
ENSGGOP00000019923  ...............MQLFGGRfnfndgt.................................................
ENSGGOP00000003342  ...............MHLFGCKfaserdgdtlp.............................................
ENSGGOP00000023204  ...............MHLFGCKfaserdgdtlp.............................................
ENSGGOP00000010829  ...............MQLFGGRfnfndgt.................................................
ENSGGOP00000027293  ...............YLVEKDA........................................................
ENSGGOP00000026337  ...............YAISKSIgfgvdtwvypnitdpe........................................
ENSGGOP00000012641  ...............MANFAYVkweagi..................................................
ENSGGOP00000026186  ...............FLVPMLQdfpddcwvsinnmv..........................................
ENSGGOP00000008627  ...............FLVPMLQdfpddcwvsinnmv..........................................
ENSGGOP00000012593  ...............YAISKSIgfgvdtwvypnitdpe........................................
ENSGGOP00000013701  ...............VQLWAGLlrnrcfldsafvrnnnltflrpyyqteegeenpficssrrdngmqkcshipgrrel
ENSGGOP00000021319  ...............VQLWAGLlrnrcfldsafvrnnnltflrpyyqteegeenpficssrrdngmqkcshipgrrel
ENSGGOP00000022082  ...............MQVFGKIalndttein...............................................
ENSGGOP00000028147  ...............AYVKREV........................................................
ENSGGOP00000000898  ...............LELFLGRmhktcyflgsdmeaeedpspcassgsgractlnqtecrgrwpgpng..........
ENSGGOP00000022765  ...............FAISKFIgfgtdswvypnisipe........................................
ENSGGOP00000003013  ...............FAISKFIgfgtdswvypnisipe........................................
ENSGGOP00000006428  ...............MNWFSKV........................................................
ENSGGOP00000006310  ...............MSSFPHVrweagi..................................................
ENSGGOP00000017309  ...............MQLFGGQfnfdegt.................................................
ENSGGOP00000015727  ...............FLVPMLQdfppdcwvsinhmv..........................................
ENSGGOP00000008481  ...............MQLFGGQfnfdegt.................................................
ENSGGOP00000006428  ...............VYFFSGKfgkcingtdsvinytiirnksqcesgnfswin........................
ENSGGOP00000004729  ...............MQLFGGQfnfqdet.................................................
ENSGGOP00000003342  ...............VQLWAGLlrnrcflpenfslplsvdleryyqtenedespficsqprengmrscrsvptlrgeg
ENSGGOP00000001513  ...............FLVPLLQdfppdcwvslnemv..........................................
ENSGGOP00000021823  ...............LELFLGRmhktcyflgsdmeaeedpspcassgsgractlnqtecrgrwpgpng..........
ENSGGOP00000021537  ...............FLVPMLQdfpddcwvsinnmv..........................................
ENSGGOP00000018103  ...............HLVENSG........................................................
ENSGGOP00000003602  ...............MQMFGKVamrdnnqin...............................................
ENSGGOP00000013701  ...............VELFGRLecsednpcegls............................................
ENSGGOP00000021319  ...............VELFGRLecsednpcegls............................................
ENSGGOP00000027513  ...............VELFGRLecsednpcegls............................................
ENSGGOP00000002713  ...............MQLFGGK........................................................
ENSGGOP00000002713  ...............MQVFGKIalndttein...............................................
ENSGGOP00000000898  ...............MQMFGKValqdgtqin...............................................
ENSGGOP00000005331  ...............VNLFAGKfyhcintttgdrfdiedvnnhtdclkliernetarwkn..................
ENSGGOP00000021823  ...............MQMFGKValqdgtqin...............................................
ENSGGOP00000001185  ...............MQLFGGR........................................................
ENSGGOP00000008481  ...............MQVFGNIgidvededsdedefqit.......................................
ENSGGOP00000001185  ...............MQMFGKIalvdgtqin...............................................
ENSGGOP00000023924  ...............MQMFGKIalvdgtqin...............................................
ENSGGOP00000022383  ...............FLVPMLQdfppdcwvsinhmv..........................................
ENSGGOP00000023204  ...............VQLWAGLlrnrcflpenfslplsvdleryyqtenedespficsqprengmrscrsvptlrgeg
ENSGGOP00000023417  ...............VNLFAGKfyhcintttgdrfdiedvnnhtdclkliernetarwkn..................
ENSGGOP00000024463  ...............VELFGKLvcndenpcegms............................................
ENSGGOP00000016442  ...............YAIGNVErpylehkigwldslgvqlgkryngsdpas...........................
ENSGGOP00000009882  ...............VELFGKLvcndenpcegms............................................
ENSGGOP00000019923  ...............MQVFGNIkldeeshin...............................................
ENSGGOP00000017309  ...............MQVFGNIgidvededsdedefqi........................................
ENSGGOP00000017557  ...............VELFGKLvcndenpcegms............................................
ENSGGOP00000010829  ...............MQVFGNIkldeeshin...............................................
ENSGGOP00000001185  ...............VQLFKGKffrctdlskmteeecrgyyyvykdgdptqielhhrewvh.................
ENSGGOP00000019172  ...............YAIGNVErpylehkigwldslgvqlgkryngsdpas...........................
ENSGGOP00000019923  ...............VQLFKGKffyctdsskdtekecignyvdheknkmevkgrewkr....................
ENSGGOP00000003342  ...............VELFGDLecdethpceglg............................................
ENSGGOP00000023204  ...............VELFGDLecdethpceglg............................................
ENSGGOP00000008481  teepartcpngtkcqPYWEGPN........................................................
ENSGGOP00000000501  ...............HLVENSG........................................................
ENSGGOP00000023924  ...............VQLFKGKffrctdlskmteeecrgyyyvykdgdptqielhhrewvh.................
ENSGGOP00000004729  ...............VQLFKGKffyctdeskelerdcrgqeqdyekeeveaqprqwkk....................
ENSGGOP00000027513  ...............QLWAGLLrnrcfldsafvrnnnltflrpyyqteegeenpficssrrdngmqkcshipgrrelr
ENSGGOP00000010829  ...............VQLFKGKffyctdsskdtekecignyvdheknkmevkgrewkr....................
ENSGGOP00000004729  ...............MQVFGNIaldddtsin...............................................
ENSGGOP00000001185  ...............LELFKGKmhktcyftgtdivatveneepspcartgsgrrctingsecrggwpgpnh.......
ENSGGOP00000023924  ...............LELFKGKmhktcyftgtdivatveneepspcartgsgrrctingsecrggwpgpnh.......
ENSGGOP00000000352  ...............MQLFGKSykecvckisndcelprwhmhdffhsflivfrvl.......................
ENSGGOP00000007211  ...............YLAEKD-........................................................
ENSGGOP00000028147  ...............MQLFGKSykecvckisndcelprwhmhdffhsflivfrvl.......................
ENSGGOP00000020299  ...............MQMFGKVamrdnnqin...............................................
ENSGGOP00000013354  ...............RALFRKS........................................................
ENSGGOP00000008980  ...............MQLFGKSykecvckinqdcelprwhmhdffhsflivfrvl.......................
ENSGGOP00000010829  ...............LEFYSGKlhracfmnnsgilegfdpphpcgvqgcpagyeckdwigpnd...............
ENSGGOP00000024945  ...............MQLFGKSykecvckialdcnlprwhmhdffhsflivfril.......................
ENSGGOP00000012234  ...............MQLFGKSykecvckialdcnlprwhmhdffhsflivfril.......................
ENSGGOP00000021390  ...............YLAEKD-........................................................
ENSGGOP00000023417  ...............MQLFGKSykdcvckiasdcqlprwhmndffhsflivfrvl.......................
ENSGGOP00000005331  ...............MQLFGKSykdcvckiasdcqlprwhmndffhsflivfrvl.......................
ENSGGOP00000002713  ...............LELFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvckpgwdgpkh........
ENSGGOP00000020299  ...............MQLFGGK........................................................
ENSGGOP00000003602  ...............MQLFGGK........................................................
ENSGGOP00000012641  ...............MQLFGKNyselrdsdsgllprwhmmdffhafliifril.........................
ENSGGOP00000010638  ...............FALSRYLgfgrdawvypdpaqpg........................................
ENSGGOP00000020299  ...............LELFIGKmhktcffadsdivaeedpapcafsgngrqctangtecrsgwvgpng..........
ENSGGOP00000004729  ...............LEFYMGKfhkacfpnstdaepvgdfpcgkeaparlcegdtecreywpgpnf............
ENSGGOP00000016440  ...............LQLFMGNlrnkclqwppsdsafetnttsyfngtmdsngtfvnvtmstfnwkdyigddshfyvl
ENSGGOP00000025809  ...............MQLFGKSykecvckinddctlprwhmndffhsflivfrvl.......................
ENSGGOP00000006736  ...............FLVPMLQdfprncwvsingmv..........................................
ENSGGOP00000022082  ...............LELFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvckpgwdgpkh........
ENSGGOP00000000352  ...............LQLFMGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsifnwdeyiedkshfyfl
ENSGGOP00000005331  ...............LQLFMGNlrnkciqwpptnasleehsieknitvnyngtlinetvfefdwksyiqdsryhyfle
ENSGGOP00000008980  ...............LQLFMGNlrnkcvvwpinfnesylengtkgfdweeyinnktnfytvpgmlepllcgnssdagq
ENSGGOP00000012641  ...............LQLFMGNlrhkcvrnftalngtngsveadglvwesldlylsdpenyllkngtsdvllcgnssd
ENSGGOP00000000898  ...............MQLFGGK........................................................
ENSGGOP00000028147  ...............LQLFMGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsifnwdeyiedkshfyfl
ENSGGOP00000003602  ...............VQLFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.................
ENSGGOP00000023417  ...............LQLFMGNlrnkciqwpptnasleehsieknitvnyngtlinetvfefdwksyiqdsryhyfle
ENSGGOP00000006310  ...............LQLFKGNlknkcvkndmavnettnysshrkpdiyinkrgtsdpllcgngsdsghcpdgyiclk
ENSGGOP00000006310  ...............KQLLGENyrnnrknisaphedw.........................................
ENSGGOP00000020299  ...............VQLFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.................
ENSGGOP00000023924  ...............MQLFGGR........................................................
ENSGGOP00000011260  ...............HLVENSG........................................................
ENSGGOP00000012234  ...............LQLFMGNlrqkcvrwpppfndtnttwysndtwygndtwygnemwygndswyandtwnshaswa
ENSGGOP00000024945  ...............LQLFMGNlrqkcvrwpppfndtnttwysndtwygndtwygnemwygndswyandtwnshaswa
ENSGGOP00000021823  ...............MQLFGGK........................................................
ENSGGOP00000021823  ...............VQLFKGKfytctdeakhtpqeckgsflvypdgdvsrplvrerlwvn.................
ENSGGOP00000008481  ...............VQLFKGKffhctdeskefekdcrgkyllyeknevkardrewkk....................
ENSGGOP00000000898  ...............VQLFKGKfytctdeakhtpqeckgsflvypdgdvsrplvrerlwvn.................
ENSGGOP00000017309  ...............VQLFKGKffhctdeskefekdcrgkyllyeknevkardrewkk....................
ENSGGOP00000016440  ...............MQLFGKSykecvckinddctlprwhmndffhsflivfrvl.......................
ENSGGOP00000022082  ...............NFDEMQT........................................................
ENSGGOP00000009838  ...............YWASNYEgigttrwvy...............................................
ENSGGOP00000006428  ...............QQLFMGSlnlkcisrdcknisnpevydhcfekkenspefkmcgiwmgnsacsiqyeckhtkin
ENSGGOP00000005127  ...............QHLERAG........................................................
ENSGGOP00000016918  ...............QHLERAG........................................................
ENSGGOP00000001687  ...............KYIEG--........................................................
ENSGGOP00000015184  ...............RACERYH........................................................
ENSGGOP00000017557  ...............VQLWAGLlrnrcfleenftiqgdvalppyyqpeeddempficslsgdngimgcheipplkeqg
ENSGGOP00000022082  ...............VQLFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.................
ENSGGOP00000006428  ...............MQLFGRS........................................................
ENSGGOP00000027687  ...............QHLERIG........................................................
ENSGGOP00000002713  ...............VQLFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.................
ENSGGOP00000007339  ...............VQLFAGKlakcndpniirredcngifrinvsvsknlnlklrpgekkpgfwvprvwanp.....
ENSGGOP00000016934  ...............VQLFAGKlakcndpniirredcngifrinvsvsknlnlklrpgekkpgfwvprvwanp.....
ENSGGOP00000025319  ...............KHIEG--........................................................
ENSGGOP00000025813  ...............SAIEDGQvlvaaddgefekfleelcrilncsetvvqdrkqdlqghlqkvkpqwf.........
ENSGGOP00000003047  ...............DALESDHemreeeklkaeeirikgkynissedyrqlelvilqseph.................
ENSGGOP00000025809  ...............LQLFMGNlkhkcfrnslennetlesimntleseedfrkyfyylegskdallcgfstdsgqcpe
ENSGGOP00000008617  ...............YVLAEMN........................................................
ENSGGOP00000012511  ...............RVCERYH........................................................
ENSGGOP00000005228  ...............WLIALLH........................................................
ENSGGOP00000024187  ...............KHIEG--........................................................
ENSGGOP00000007461  ...............QLLERQAeaqsrdqfqleklrflenytcldqwameqfvqvimeawvkgvnpkgnst.......
ENSGGOP00000016722  ...............YWASAYQglgsthwv................................................
ENSGGOP00000027288  ...............QLLERQAeaqsrdqfqleklrflenytcldqwameqfvqvimeawvkgvnpkgnst.......
ENSGGOP00000005376  ...............SVAERQA........................................................
ENSGGOP00000006442  ...............VTLFGAF........................................................
ENSGGOP00000024150  ...............RVCERYH........................................................
ENSGGOP00000001687  ...............RALEQPFessqkntialekaeflrdhvcvspqeletliqhaldadnagvspignss.......
ENSGGOP00000009882  ...............VQLWAGLlrnrcfleenftiqgdvalppyyqpeeddempficslsgdngimgcheipplkeqg
ENSGGOP00000003047  ...............SQCEE--........................................................
ENSGGOP00000002078  ...............MKLFGKNyeefvchidkdcql..........................................
ENSGGOP00000027711  ...............WCIAFFH........................................................
ENSGGOP00000000658  ...............WVIAVAH........................................................
ENSGGOP00000019229  ...............WLIAYGR........................................................
ENSGGOP00000000546  ...............WCIAFFH........................................................
ENSGGOP00000007454  ...............WTLEGRAaqdssrsfqrdkwellqnftcldrpaldslirdvvqaykngasllsnt........
ENSGGOP00000024187  ...............KALEQPHeisqrttiviqkqtfisqhscvnsteldeliqqivaainagiiplgnts.......
ENSGGOP00000018574  ...............RALEQPHeqqaqrelgevrekflrahpcvsdqelgllikevadalgggadpetnstsn.....
ENSGGOP00000001313  ...............RALEQPHeqqaqrelgevrekflrahpcvsdqelgllikevadalgggadpetnstsn.....
ENSGGOP00000022306  ...............WLIAYIR........................................................
ENSGGOP00000006045  ...............VYVFSEY........................................................
ENSGGOP00000026587  ...............SVLEDD-........................................................
ENSGGOP00000003743  ...............WLIAYIR........................................................
ENSGGOP00000005670  ...............HAREIQY........................................................
ENSGGOP00000025319  ...............KALEQPHeisqrttiviqkqtfisqhscvnsteldeliqqivaainagiiplgnts.......
ENSGGOP00000003637  ...............WLIAFAH........................................................
ENSGGOP00000010687  ...............SVLEDD-........................................................
ENSGGOP00000005951  ...............MVTEG--........................................................
ENSGGOP00000013120  ...............WLIASLH........................................................
ENSGGOP00000002078  ...............MYNFAYVkkeagi..................................................
ENSGGOP00000008753  ...............WLVAFAH........................................................
ENSGGOP00000018872  ...............DALESEAesgrqrllvqkrgalrrkfgfsaedyrelerlarqaeph.................
ENSGGOP00000017068  ...............DALESEAesgrqrllvqkrgalrrkfgfsaedyrelerlarqaeph.................
ENSGGOP00000028458  ...............WLIAFHH........................................................
ENSGGOP00000025813  ...............PFWETQ-........................................................
ENSGGOP00000019335  ...............SALELAHerqakqrweerlanfsrghnlsrdelrgflrhyeeatragirvd............
ENSGGOP00000001313  ...............CYMED--........................................................
ENSGGOP00000027030  ...............WVIAYTR........................................................
ENSGGOP00000012459  ...............TSVEG--........................................................
ENSGGOP00000026172  ...............TSVEG--........................................................
ENSGGOP00000017309  teepartcpngtkcqPYWEGPN........................................................
ENSGGOP00000018574  ...............CYMED--........................................................
ENSGGOP00000004798  ...............YAVAYIHkdlpefh.................................................
ENSGGOP00000027211  ...............YAVAYIHkdlpefh.................................................
ENSGGOP00000018872  ...............AHFEG--........................................................
ENSGGOP00000007946  ...............TPIEG--........................................................
ENSGGOP00000009787  ...............ARLEGPHearlraeletlraqllqrspcvaapaldafvervlaagrlgrvvlanasgsan...
ENSGGOP00000017068  ...............AHFEG--........................................................
ENSGGOP00000012459  ...............SALESPGeaeararwgatlrnfsaahgvaepelraflrhyeaalaagvra.............
ENSGGOP00000017225  ...............YLVAVAH........................................................
ENSGGOP00000024508  ...............YLVAVAH........................................................
ENSGGOP00000026172  ...............SALESPGeaeararwgatlrnfsaahgvaepelraflrhyeaalaagvra.............
ENSGGOP00000007339  ...............LQMFCFV........................................................
ENSGGOP00000012997  ...............YAIAFIH........................................................
ENSGGOP00000016934  ...............LQMFCFV........................................................
ENSGGOP00000009787  ...............AHLEEA-........................................................
ENSGGOP00000019335  ...............TPIEG--........................................................
ENSGGOP00000010687  ...............SSVELPYedllrqelrklkrrfleeheclseqqleqflgrvleasnygvsvlsna........
ENSGGOP00000007461  ...............SHVEG--........................................................
ENSGGOP00000005951  ...............-------........................................................
ENSGGOP00000007454  ...............SHMEG--........................................................
ENSGGOP00000002078  ...............MGLFMGNlkhkcfrwpqenenetlhnrtgnpyytreietfvkgkavfpemlntqhfvrfpkal
ENSGGOP00000011478  ...............QALEGPPacrlqaelraelaafqaahraclppgaleellgtalatqahgvsslgns.......
ENSGGOP00000027967  ...............INLFRGVivappgnsslapangsapcgsfeqley.............................
ENSGGOP00000027288  ...............SHVEG--........................................................
ENSGGOP00000010343  ...............INLFRGVivappgnsslapangsapcgsfeqley.............................
ENSGGOP00000021593  ...............-------........................................................
ENSGGOP00000007339  ...............VQMFGTFtyhcvvndtkpgnvtwnslavpdthcspeleegyqcppgfkcmdledlglsrqel.
ENSGGOP00000016934  ...............VQMFGTFtyhcvvndtkpgnvtwnslavpdthcspeleegyqcppgfkcmdledlglsrqel.
ENSGGOP00000004744  ...............FCLFGSP........................................................
ENSGGOP00000010343  ...............MLLFAGG........................................................
ENSGGOP00000027967  ...............MLLFAGG........................................................
ENSGGOP00000025809  ...............-------........................................................
ENSGGOP00000024463  ...............VQLWAGLlrnrcfleenftiqgdvalppyyqpeeddempficslsgdngimgcheipplkeqg
ENSGGOP00000002078  ...............IFIYKYKfydcvnttlgsfkeevemqvnlteeiqilaqtiftttdqvigsinfk.........
ENSGGOP00000010207  ...............MEFFCGIvfpnccntstvadayrwrnhtvgnrtvveegyy.......................
ENSGGOP00000010203  ...............MEFFCGIvfpnccntstvadayrwrnhtvgnrtvveegyy.......................
ENSGGOP00000003957  ...............-------........................................................
ENSGGOP00000011478  ...............WGLQGD-........................................................
ENSGGOP00000010203  ...............FYLFSPN........................................................
ENSGGOP00000010207  ...............FYLFSPN........................................................
ENSGGOP00000001755  ...............YLLDRFSpfgrfkvnsee.............................................
ENSGGOP00000018945  ...............YLLDRFSpfgrfkvnsee.............................................
ENSGGOP00000022444  ...............YLVFGTQ........................................................
ENSGGOP00000018177  ...............-------........................................................
ENSGGOP00000003268  ...............YLVFGTQ........................................................
ENSGGOP00000001590  ...............-------........................................................
ENSGGOP00000020483  ...............YLLFGT-........................................................
ENSGGOP00000020927  ...............YLLFGT-........................................................
ENSGGOP00000001815  ...............YLLFGT-........................................................
ENSGGOP00000007339  ...............VVLFGTVkygenin.................................................
ENSGGOP00000001254  ...............-------........................................................
ENSGGOP00000000981  ...............-------........................................................
ENSGGOP00000026559  ...............WHLEDNNeeprdpqspp..............................................
ENSGGOP00000000982  ...............-------........................................................
ENSGGOP00000009351  ...............WHLEDNNeeprdpqspp..............................................
ENSGGOP00000014483  ...............-------........................................................
ENSGGOP00000023496  ...............-------........................................................
ENSGGOP00000016934  ...............VVLFGTVkygenin.................................................
ENSGGOP00000016605  ...............WHTEEPEdgkegpsd................................................
ENSGGOP00000014493  ...............LFLVSRFspyewhseefeegrdqtts.....................................
ENSGGOP00000012367  ...............WHTEEFEdgretqss................................................
ENSGGOP00000027522  ...............WHTEEFEdgretqss................................................


                                                                          160                       
                                                                            |                       
d1orqc_               .....................................................PN...........S...........
ENSGGOP00000011420  .....................................................RE...........S...........
ENSGGOP00000021753  .....................................................AE...........S...........
ENSGGOP00000000656  .....................................................PT...........S...........
ENSGGOP00000011744  .....................................................QG...........T...........
ENSGGOP00000003210  .....................................................DA...........T...........
ENSGGOP00000027568  .....................................................DD...........S...........
ENSGGOP00000007168  .....................................................PT...........T...........
ENSGGOP00000024337  .....................................................PT...........T...........
ENSGGOP00000002688  .....................................................NK...........T...........
ENSGGOP00000009305  .....................................................PE...........T...........
ENSGGOP00000006737  .....................................................DD...........T...........
ENSGGOP00000015335  .....................................................EH...........T...........
ENSGGOP00000015202  .....................................................SA...........S...........
ENSGGOP00000003820  .....................................................EH...........T...........
ENSGGOP00000008219  .....................................................PE...........S...........
ENSGGOP00000022687  .....................................................EH...........T...........
ENSGGOP00000013400  .....................................................VD...........S...........
ENSGGOP00000027450  .....................................................DH...........T...........
ENSGGOP00000000227  .....................................................PS...........T...........
ENSGGOP00000012818  .....................................................DH...........T...........
ENSGGOP00000008276  .....................................................PD...........T...........
ENSGGOP00000019798  .....................................................DH...........T...........
ENSGGOP00000006085  .....................................................NH...........T...........
ENSGGOP00000000958  .....................................................HT...........S...........
ENSGGOP00000002752  .....................................................N-...........E...........
ENSGGOP00000000831  .....................................................ADs..........P...........
ENSGGOP00000002953  .....................................................ED...........V...........
ENSGGOP00000023230  .....................................................ED...........V...........
ENSGGOP00000001534  .....................................................GRv..........L...........
ENSGGOP00000005162  .....................................................GAr..........R...........
ENSGGOP00000001664  .....................................................SN...........K...........
ENSGGOP00000025520  .....................................................EN...........D...........
ENSGGOP00000016408  .....................................................GP...........S...........
ENSGGOP00000020811  .....................................................EN...........D...........
ENSGGOP00000008202  .....................................................EN...........D...........
ENSGGOP00000012351  .....................................................GP...........S...........
ENSGGOP00000028732  .....................................................GP...........S...........
ENSGGOP00000011126  .....................................................NK...........E...........
ENSGGOP00000012234  .....................................................VK...........V...........
ENSGGOP00000024945  .....................................................VK...........V...........
ENSGGOP00000008980  .....................................................N-...........Nteirwknvki.
ENSGGOP00000013052  .....................................................VNesgr.......V...........
ENSGGOP00000012641  .....................................................VK...........V...........
ENSGGOP00000028610  .....................................................GP...........S...........
ENSGGOP00000006310  .....................................................VK...........V...........
ENSGGOP00000001711  .....................................................PEvdaqgeemk..E...........
ENSGGOP00000017557  .....................................................HK...........Y...........
ENSGGOP00000024463  .....................................................HK...........Y...........
ENSGGOP00000009882  .....................................................HK...........Y...........
ENSGGOP00000023204  .....................................................HK...........Y...........
ENSGGOP00000003342  .....................................................HK...........Y...........
ENSGGOP00000000352  .....................................................VK...........V...........
ENSGGOP00000028147  .....................................................VK...........V...........
ENSGGOP00000016440  .....................................................VK...........V...........
ENSGGOP00000008980  .....................................................KHeagiddm....F...........
ENSGGOP00000024463  .....................................................DR...........K...........
ENSGGOP00000017557  .....................................................DR...........K...........
ENSGGOP00000001541  ..................................................llgGP...........S...........
ENSGGOP00000009882  .....................................................DR...........K...........
ENSGGOP00000013701  .....................................................RK...........Y...........
ENSGGOP00000021319  .....................................................RK...........Y...........
ENSGGOP00000027513  .....................................................RK...........Y...........
ENSGGOP00000023417  .....................................................KRevgiddm....F...........
ENSGGOP00000005331  .....................................................KRevgiddm....F...........
ENSGGOP00000025522  .....................................................FG...........R...........
ENSGGOP00000013502  .....................................................FG...........R...........
ENSGGOP00000025809  .....................................................S-...........Qnvrwknlkv..
ENSGGOP00000024945  .....................................................KKesgiddm....F...........
ENSGGOP00000012234  .....................................................KKesgiddm....F...........
ENSGGOP00000000352  .....................................................GIddm........F...........
ENSGGOP00000013701  .....................................................DR...........K...........
ENSGGOP00000021319  .....................................................DR...........K...........
ENSGGOP00000027513  .....................................................DR...........K...........
ENSGGOP00000003602  .....................................................GI...........T...........
ENSGGOP00000017118  .....................................................GP...........S...........
ENSGGOP00000016440  .....................................................KKeagiddm....F...........
ENSGGOP00000015188  .....................................................GP...........S...........
ENSGGOP00000019923  .....................................................PS...........A...........
ENSGGOP00000003342  .....................................................DR...........K...........
ENSGGOP00000023204  .....................................................DR...........K...........
ENSGGOP00000010829  .....................................................PS...........A...........
ENSGGOP00000027293  .....................................................NK...........E...........
ENSGGOP00000026337  .....................................................YG...........Y...........
ENSGGOP00000012641  .....................................................DDm..........F...........
ENSGGOP00000026186  .....................................................NN...........S...........
ENSGGOP00000008627  .....................................................NN...........S...........
ENSGGOP00000012593  .....................................................YG...........Y...........
ENSGGOP00000013701  ........rvpctlgweaytqpqaegvgaarnacinwnqyynvcrsgdsnphnGA...........I...........
ENSGGOP00000021319  ........rvpctlgweaytqpqaegvgaarnacinwnqyynvcrsgdsnphnGA...........I...........
ENSGGOP00000022082  .....................................................RN...........N...........
ENSGGOP00000028147  .....................................................GIddm........F...........
ENSGGOP00000000898  .....................................................GI...........T...........
ENSGGOP00000022765  .....................................................HG...........R...........
ENSGGOP00000003013  .....................................................HG...........R...........
ENSGGOP00000006428  .....................................................NP...........Esgiddif....
ENSGGOP00000006310  .....................................................DDm..........F...........
ENSGGOP00000017309  .....................................................PP...........T...........
ENSGGOP00000015727  .....................................................NH...........S...........
ENSGGOP00000008481  .....................................................PP...........T...........
ENSGGOP00000006428  .....................................................QK...........V...........
ENSGGOP00000004729  .....................................................PT...........T...........
ENSGGOP00000003342  .............gggppcgldyeaynsssnttcvnwnqyytncsagehnpfkGA...........I...........
ENSGGOP00000001513  .....................................................ND...........S...........
ENSGGOP00000021823  .....................................................GI...........T...........
ENSGGOP00000021537  .....................................................NN...........S...........
ENSGGOP00000018103  .....................................................DPwenfqn.....N...........
ENSGGOP00000003602  .....................................................RN...........N...........
ENSGGOP00000013701  .....................................................RH...........A...........
ENSGGOP00000021319  .....................................................RH...........A...........
ENSGGOP00000027513  .....................................................RH...........A...........
ENSGGOP00000002713  .....................................................FNfdemqtrr...S...........
ENSGGOP00000002713  .....................................................RN...........N...........
ENSGGOP00000000898  .....................................................RN...........N...........
ENSGGOP00000005331  .....................................................VK...........V...........
ENSGGOP00000021823  .....................................................RN...........N...........
ENSGGOP00000001185  .....................................................YDfedtevrr...S...........
ENSGGOP00000008481  .....................................................EH...........N...........
ENSGGOP00000001185  .....................................................RN...........N...........
ENSGGOP00000023924  .....................................................RN...........N...........
ENSGGOP00000022383  .....................................................NH...........S...........
ENSGGOP00000023204  .............gggppcgldyeaynsssnttcvnwnqyytncsagehnpfkGA...........I...........
ENSGGOP00000023417  .....................................................VK...........V...........
ENSGGOP00000024463  .....................................................RH...........A...........
ENSGGOP00000016442  .....................................................GP...........S...........
ENSGGOP00000009882  .....................................................RH...........A...........
ENSGGOP00000019923  .....................................................RH...........N...........
ENSGGOP00000017309  .....................................................TE...........H...........
ENSGGOP00000017557  .....................................................RH...........A...........
ENSGGOP00000010829  .....................................................RH...........N...........
ENSGGOP00000001185  .....................................................SD...........F...........
ENSGGOP00000019172  .....................................................GP...........S...........
ENSGGOP00000019923  .....................................................HE...........F...........
ENSGGOP00000003342  .....................................................RH...........A...........
ENSGGOP00000023204  .....................................................RH...........A...........
ENSGGOP00000008481  .....................................................NGi..........T...........
ENSGGOP00000000501  .....................................................DPwenfqn.....N...........
ENSGGOP00000023924  .....................................................SD...........F...........
ENSGGOP00000004729  .....................................................YD...........F...........
ENSGGOP00000027513  .........vpctlgweaytqpqaegvgaarnacinwnqyynvcrsgdsnphnGA...........I...........
ENSGGOP00000010829  .....................................................HE...........F...........
ENSGGOP00000004729  .....................................................RH...........N...........
ENSGGOP00000001185  .....................................................GI...........T...........
ENSGGOP00000023924  .....................................................GI...........T...........
ENSGGOP00000000352  .....................................................CG...........E...........
ENSGGOP00000007211  .....................................................AN...........S...........
ENSGGOP00000028147  .....................................................CG...........E...........
ENSGGOP00000020299  .....................................................RN...........N...........
ENSGGOP00000013354  .....................................................DP...........K...........
ENSGGOP00000008980  .....................................................CG...........E...........
ENSGGOP00000010829  .....................................................GI...........T...........
ENSGGOP00000024945  .....................................................CG...........E...........
ENSGGOP00000012234  .....................................................CG...........E...........
ENSGGOP00000021390  .....................................................AN...........S...........
ENSGGOP00000023417  .....................................................CG...........E...........
ENSGGOP00000005331  .....................................................CG...........E...........
ENSGGOP00000002713  .....................................................GI...........T...........
ENSGGOP00000020299  .....................................................FNfdetqtkr...S...........
ENSGGOP00000003602  .....................................................FNfdetqtkr...S...........
ENSGGOP00000012641  .....................................................CG...........E...........
ENSGGOP00000010638  .....................................................FE...........R...........
ENSGGOP00000020299  .....................................................GI...........T...........
ENSGGOP00000004729  .....................................................GI...........T...........
ENSGGOP00000016440  ....................dgqkdpllcgngsdagqcpegyicvkagrnpnyGY...........T...........
ENSGGOP00000025809  .....................................................CG...........E...........
ENSGGOP00000006736  .....................................................NH...........S...........
ENSGGOP00000022082  .....................................................GI...........T...........
ENSGGOP00000000352  ....................egqndallcgnssdagqcpegyicvkagrnpnyGY...........T...........
ENSGGOP00000005331  .....................gfldallcgnssdagqcpegymcvkagrnpnyGY...........T...........
ENSGGOP00000008980  .....................................cpegyqcmkagrnpnyGY...........T...........
ENSGGOP00000012641  ..................................agtcpegyrclkagenpdhGY...........T...........
ENSGGOP00000000898  .....................................................FNfdqthtkr...S...........
ENSGGOP00000028147  ....................egqndallcgnssdagqcpegyicvkagrnpnyGY...........T...........
ENSGGOP00000003602  .....................................................SD...........F...........
ENSGGOP00000023417  .....................gfldallcgnssdagqcpegymcvkagrnpnyGY...........T...........
ENSGGOP00000006310  ..............................................tsdnpdfNY...........T...........
ENSGGOP00000006310  .....................................................PR...........W...........
ENSGGOP00000020299  .....................................................SD...........F...........
ENSGGOP00000023924  .....................................................YDfedtevrr...S...........
ENSGGOP00000011260  .....................................................DPwlkgrn.....S...........
ENSGGOP00000012234  tndtfdwdayisdegnfyflegsndallcgnssdaghcpegyeciktgrnpnyGY...........T...........
ENSGGOP00000024945  tndtfdwdayisdegnfyflegsndallcgnssdaghcpegyeciktgrnpnyGY...........T...........
ENSGGOP00000021823  .....................................................FNfdqthtkr...S...........
ENSGGOP00000021823  .....................................................SD...........F...........
ENSGGOP00000008481  .....................................................YE...........F...........
ENSGGOP00000000898  .....................................................SD...........F...........
ENSGGOP00000017309  .....................................................YE...........F...........
ENSGGOP00000016440  .....................................................CG...........E...........
ENSGGOP00000022082  .....................................................RR...........S...........
ENSGGOP00000009838  .....................................................DG...........E...........
ENSGGOP00000006428  ..................................................pdyNY...........T...........
ENSGGOP00000005127  .....................................................EN...........-...........
ENSGGOP00000016918  .....................................................EN...........-...........
ENSGGOP00000001687  .....................................................--...........-...........
ENSGGOP00000015184  .....................................................DQq..........D...........
ENSGGOP00000017557  ........recclskddvydfgagrqdlnasglcvnwnryynvcrtgsanphkGA...........I...........
ENSGGOP00000022082  .....................................................SK...........F...........
ENSGGOP00000006428  .....................................................FN...........Sqkspklcnptg
ENSGGOP00000027687  .....................................................KK...........-...........
ENSGGOP00000002713  .....................................................SK...........F...........
ENSGGOP00000007339  .....................................................RN...........F...........
ENSGGOP00000016934  .....................................................RN...........F...........
ENSGGOP00000025319  .....................................................--...........-...........
ENSGGOP00000025813  .....................................................NR...........T...........
ENSGGOP00000003047  .....................................................RA...........G...........
ENSGGOP00000025809  ........................................gytcmkigrnpdyGY...........T...........
ENSGGOP00000008617  .....................................................GD...........Leldhdappenh
ENSGGOP00000012511  .....................................................DQq..........D...........
ENSGGOP00000005228  .....................................................GDldaskegkacvS...........
ENSGGOP00000024187  .....................................................--...........-...........
ENSGGOP00000007461  .....................................................NP...........S...........
ENSGGOP00000016722  .....................................................YD...........G...........
ENSGGOP00000027288  .....................................................NP...........S...........
ENSGGOP00000005376  .....................................................VN...........A...........
ENSGGOP00000006442  .....................................................VP...........K...........
ENSGGOP00000024150  .....................................................DQq..........D...........
ENSGGOP00000001687  .....................................................NN...........S...........
ENSGGOP00000009882  ........recclskddvydfgagrqdlnasglcvnwnryynvcrtgsanphkGA...........I...........
ENSGGOP00000003047  .....................................................--...........-...........
ENSGGOP00000002078  .....................................................PR...........W...........
ENSGGOP00000027711  .....................................................GD...........Leaspgvgggga
ENSGGOP00000000658  .....................................................GD...........Lepaegrgrtpc
ENSGGOP00000019229  .....................................................GD...........Lehledtawtpc
ENSGGOP00000000546  .....................................................GD...........Leaspgvaaagg
ENSGGOP00000007454  .....................................................TS...........M...........
ENSGGOP00000024187  .....................................................NQ...........I...........
ENSGGOP00000018574  .....................................................SS...........H...........
ENSGGOP00000001313  .....................................................SS...........H...........
ENSGGOP00000022306  .....................................................GD...........Ldhvgdqewipc
ENSGGOP00000006045  .....................................................TR...........Sprqdleyhv..
ENSGGOP00000026587  .....................................................--...........-...........
ENSGGOP00000003743  .....................................................GD...........Mdhiedpswtpc
ENSGGOP00000005670  .....................................................HDkq.........E...........
ENSGGOP00000025319  .....................................................NQ...........I...........
ENSGGOP00000003637  .....................................................GD...........Lapsegtaepcv
ENSGGOP00000010687  .....................................................--...........-...........
ENSGGOP00000005951  .....................................................--...........-...........
ENSGGOP00000013120  .....................................................GDlaappppapcfS...........
ENSGGOP00000002078  .....................................................NDv..........S...........
ENSGGOP00000008753  .....................................................GD...........Iyaymeksgmek
ENSGGOP00000018872  .....................................................RA...........G...........
ENSGGOP00000017068  .....................................................RA...........G...........
ENSGGOP00000028458  .....................................................GD...........Llndpditpcvd
ENSGGOP00000025813  .....................................................--...........-...........
ENSGGOP00000019335  .....................................................NV...........R...........
ENSGGOP00000001313  .....................................................--...........-...........
ENSGGOP00000027030  .....................................................GD...........Lnkahvgnytpc
ENSGGOP00000012459  .....................................................--...........-...........
ENSGGOP00000026172  .....................................................--...........-...........
ENSGGOP00000017309  .....................................................NGi..........T...........
ENSGGOP00000018574  .....................................................--...........-...........
ENSGGOP00000004798  .....................................................P-...........Sanhtpcve...
ENSGGOP00000027211  .....................................................P-...........Sanhtpcve...
ENSGGOP00000018872  .....................................................--...........-...........
ENSGGOP00000007946  .....................................................--...........-...........
ENSGGOP00000009787  .....................................................AS...........D...........
ENSGGOP00000017068  .....................................................--...........-...........
ENSGGOP00000012459  .....................................................D-...........Alr.........
ENSGGOP00000017225  .....................................................GD...........Lleldppanhtp
ENSGGOP00000024508  .....................................................GD...........Lleldppanhtp
ENSGGOP00000026172  .....................................................D-...........Alr.........
ENSGGOP00000007339  .....................................................EEl..........D...........
ENSGGOP00000012997  .....................................................GD...........Lepgepisnhtp
ENSGGOP00000016934  .....................................................EEl..........D...........
ENSGGOP00000009787  .....................................................--...........-...........
ENSGGOP00000019335  .....................................................--...........-...........
ENSGGOP00000010687  .....................................................SG...........N...........
ENSGGOP00000007461  .....................................................--...........-...........
ENSGGOP00000005951  .....................................................--...........-...........
ENSGGOP00000007454  .....................................................--...........-...........
ENSGGOP00000002078  .......vesfsetenfyylegeryallcgnrtdagqcpegyvcvkaginpdqGF...........T...........
ENSGGOP00000011478  .....................................................SE...........G...........
ENSGGOP00000027967  .....................................................WA...........N...........
ENSGGOP00000027288  .....................................................--...........-...........
ENSGGOP00000010343  .....................................................WA...........N...........
ENSGGOP00000021593  .....................................................--...........-...........
ENSGGOP00000007339  .....................................................GY...........S...........
ENSGGOP00000016934  .....................................................GY...........S...........
ENSGGOP00000004744  .....................................................DKgdh........D...........
ENSGGOP00000010343  .....................................................KQddgqdrerl..T...........
ENSGGOP00000027967  .....................................................KQddgqdrerl..T...........
ENSGGOP00000025809  .....................................................--...........-...........
ENSGGOP00000024463  ........recclskddvydfgagrqdlnasglcvnwnryynvcrtgsanphkGA...........I...........
ENSGGOP00000002078  .....................................................C-...........-...........
ENSGGOP00000010207  .....................................................YL...........N...........
ENSGGOP00000010203  .....................................................YL...........N...........
ENSGGOP00000003957  .....................................................--...........-...........
ENSGGOP00000011478  .....................................................--...........-...........
ENSGGOP00000010203  .....................................................PSd..........P...........
ENSGGOP00000010207  .....................................................PSd..........P...........
ENSGGOP00000001755  .....................................................EE...........E...........
ENSGGOP00000018945  .....................................................EE...........E...........
ENSGGOP00000022444  .....................................................VD...........D...........
ENSGGOP00000018177  .....................................................--...........-...........
ENSGGOP00000003268  .....................................................VD...........D...........
ENSGGOP00000001590  .....................................................--...........-...........
ENSGGOP00000020483  .....................................................QV...........E...........
ENSGGOP00000020927  .....................................................QV...........E...........
ENSGGOP00000001815  .....................................................QV...........E...........
ENSGGOP00000007339  .....................................................RH...........A...........
ENSGGOP00000001254  .....................................................--...........-...........
ENSGGOP00000000981  .....................................................--...........-...........
ENSGGOP00000026559  .....................................................DP...........P...........
ENSGGOP00000000982  .....................................................--...........-...........
ENSGGOP00000009351  .....................................................DP...........P...........
ENSGGOP00000014483  .....................................................--...........-...........
ENSGGOP00000023496  .....................................................--...........-...........
ENSGGOP00000016934  .....................................................RH...........A...........
ENSGGOP00000016605  .....................................................QP...........P...........
ENSGGOP00000014493  .....................................................DQ...........S...........
ENSGGOP00000012367  .....................................................ES...........T...........
ENSGGOP00000027522  .....................................................ES...........T...........


                                              170          180                              190     
                                                |            |                                |     
d1orqc_               ..................SIKSVFDALW.WAV..VTATTVGY....GD..VV.P................ATPIGK..
ENSGGOP00000011420  ..................QFPSIPDAFW.WAV..VSMTTVGY....GD..MV.P................TTIGGK..
ENSGGOP00000021753  ..................HFSSIPDAFW.WAV..VSMTTVGY....GD..MY.P................VTIGGK..
ENSGGOP00000000656  ..................GFSSIPDAFW.WAV..VTMTTVGY....GD..MH.P................VTIGGK..
ENSGGOP00000011744  ..................HFSSIPDAFW.WAV..VTMTTVGY....GD..MR.P................ITVGGK..
ENSGGOP00000003210  ..................KFTSIPASFW.WAT..ITMTTVGY....GD..IY.P................KTLLGK..
ENSGGOP00000027568  ..................LFPSIPDAFW.WAV..VTMTTVGY....GD..MY.P................MTVGGK..
ENSGGOP00000007168  ..................HFQSIPDAFW.WAV..VTMTTVGY....GD..MK.P................ITVGGK..
ENSGGOP00000024337  ..................HFQSIPDAFW.WAV..VTMTTVGY....GD..MK.P................ITVGGK..
ENSGGOP00000002688  ..................NFTSIPAAFW.YTI..VTMTTLGY....GD..MV.P................STIAGK..
ENSGGOP00000009305  ..................LFKSIPQSFW.WAI..ITMTTVGY....GD..IY.P................KTTLGK..
ENSGGOP00000006737  ..................KFKSIPASFW.WAT..ITMTTVGY....GD..IY.P................KTLLGK..
ENSGGOP00000015335  ..................HFKNIPIGFW.WAV..VTMTTLGY....GD..MY.P................QTWSGM..
ENSGGOP00000015202  ..................KFTSIPASFW.YTI..VTMTTLGY....GD..MV.P................KTIAGK..
ENSGGOP00000003820  ..................QFKNIPIGFW.WAV..VTMTTLGY....GD..MY.P................QTWSGM..
ENSGGOP00000008219  ..................HFSSIPDGFW.WAV..VTMTTVGY....GD..MC.P................TTPGGK..
ENSGGOP00000022687  ..................QFKNIPIGFW.WAV..VTMTTLGY....GD..MY.P................QTWSGM..
ENSGGOP00000013400  ..................HFTSIPESFW.WAV..VTMTTVGY....GD..MA.P................VTVGGK..
ENSGGOP00000027450  ..................DFKNIPIGFW.WAV..VTMTTLGY....GD..MY.P................KTWSGM..
ENSGGOP00000000227  ..................NFTTIPHSWW.WAA..VSISTVGY....GD..MY.P................ETHLGR..
ENSGGOP00000012818  ..................DFKNIPIGFW.WAV..VTMTTLGY....GD..MY.P................KTWSGM..
ENSGGOP00000008276  ..................TFTSVPCAWW.WAT..TSMTTVGY....GD..IR.P................DTTTGK..
ENSGGOP00000019798  ..................DFKNIPIGFW.WAV..VTMTTLGY....GD..MY.P................KTWSGM..
ENSGGOP00000006085  ..................YFKNIPIGFW.WAV..VTMTTLGY....GD..MY.P................KTWSGM..
ENSGGOP00000000958  ..................SLTSIPICWW.WAT..ISMTTVGY....GD..TH.P................VTLPGK..
ENSGGOP00000002752  ..................GLATIPACWW.WAT..VSMTTVGY....GD..VV.P................GTTAGK..
ENSGGOP00000000831  ..................EFTSIPACYW.WAV..ITMTTVGY....GD..MV.P................RSTPGQ..
ENSGGOP00000002953  ..................GFNTIPACWW.WGT..VSMTTVGY....GD..VV.P................VTVAGK..
ENSGGOP00000023230  ..................GFNTIPACWW.WGT..VSMTTVGY....GD..VV.P................VTVAGK..
ENSGGOP00000001534  ..................EFTSIPASYW.WAI..ISMTTVGY....GD..MV.P................RSVPGQ..
ENSGGOP00000005162  ..................DFSSVPASYW.WAV..ISMTTVGY....GD..MV.P................RSLPGQ..
ENSGGOP00000001664  ..................DFTSIPAACW.WVI..ISMTTVGY....GD..MY.P................ITVPGR..
ENSGGOP00000025520  ..................HFDTYADALW.WGL..ITLTTIGY....GD..KY.P................QTWNGR..
ENSGGOP00000016408  ..................IKDKYVTALY.FTF..SSLTSVGF....GN..VS.P................NTNSEK..
ENSGGOP00000020811  ..................HFDTYADALW.WGL..ITLTTIGY....GD..KY.P................QTWNGR..
ENSGGOP00000008202  ..................HFDTYADALW.WGL..ITLTTIGY....GD..KY.P................QTWNGR..
ENSGGOP00000012351  ..................IKDKYVTALY.FTF..SSLTSVGF....GN..VS.P................NTNSEK..
ENSGGOP00000028732  ..................KDSLYVSSLY.FTM..TSLTTIGF....GN..IA.P................TTDVEK..
ENSGGOP00000011126  ..................F-STYADALW.WGT..ITLTTIGY....GD..KT.P................LTWLGR..
ENSGGOP00000012234  ..................NYDNVGLGYL.SLL..QVATFKGW....MD..IM.Y................AAVDSRek
ENSGGOP00000024945  ..................NYDNVGLGYL.SLL..QVATFKGW....MD..IM.Y................AAVDSRek
ENSGGOP00000008980  ..................NFDNVGAGYL.ALL..QVATFKGW....MD..IM.Y................AAVDSRkp
ENSGGOP00000013052  ..................EFGSYADALW.WGV..VTVTTIGY....GD..KV.P................QTWVGK..
ENSGGOP00000012641  ..................NFDNVGAGYL.ALL..QVATFKGW....MD..IM.Y................AAVDSRgy
ENSGGOP00000028610  ..................KNSVYISSLY.FTM..TSLTSVGF....GN..IA.P................STDIEK..
ENSGGOP00000006310  ..................NFDNVAMGYL.ALL..QVATFKGW....MD..IM.Y................AAVDSRev
ENSGGOP00000001711  ..................EFETYADALW.WGL..ITLATIGY....GD..KT.P................KTWEGR..
ENSGGOP00000017557  ..................NFDNLGQALM.SLF..VLASKDGW....VN..IM.Y................NGLDAVav
ENSGGOP00000024463  ..................NFDNLGQALM.SLF..VLASKDGW....VN..IM.Y................NGLDAVav
ENSGGOP00000009882  ..................NFDNLGQALM.SLF..VLASKDGW....VN..IM.Y................NGLDAVav
ENSGGOP00000023204  ..................NFDNLGQALM.SLF..VLASKDGW....VD..IM.Y................DGLDAVgv
ENSGGOP00000003342  ..................NFDNLGQALM.SLF..VLASKDGW....VD..IM.Y................DGLDAVgv
ENSGGOP00000000352  ..................NFDNVGLGYL.SLL..QVATFKGW....MD..IM.Y................AAVDSRnv
ENSGGOP00000028147  ..................NFDNVGLGYL.SLL..QVATFKGW....MD..IM.Y................AAVDSRnv
ENSGGOP00000016440  ..................NFDNVGAGYL.ALL..QVATFKGW....MD..IM.Y................AAVDSRdv
ENSGGOP00000008980  ..................NFETFGNSMI.CLF..QITTSAGW....DG..LLlPilnrpp..........DCSLDKeh
ENSGGOP00000024463  ..................NFDSLLWAIV.TVF..QILTQEDW....NV..VL.Yngmast..........SPWASL..
ENSGGOP00000017557  ..................NFDSLLWAIV.TVF..QILTQEDW....NV..VL.Yngmast..........SPWASL..
ENSGGOP00000001541  ..................LRSAYITSLY.FAL..SSLTSVGF....GN..VS.A................NTDTEK..
ENSGGOP00000009882  ..................NFDSLLWAIV.TVF..QILTQEDW....NV..VL.Yngmast..........SPWASL..
ENSGGOP00000013701  ..................NFDNLGQALM.SLF..VLSSKDGW....VN..IM.Y................DGLDAVgv
ENSGGOP00000021319  ..................NFDNLGQALM.SLF..VLSSKDGW....VN..IM.Y................DGLDAVgv
ENSGGOP00000027513  ..................NFDNLGQALM.SLF..VLSSKDGW....VN..IM.Y................DGLDAVgv
ENSGGOP00000023417  ..................NFETFGNSMI.CLF..QITTSAGW....DG..LL.A................PILNSKpp
ENSGGOP00000005331  ..................NFETFGNSMI.CLF..QITTSAGW....DG..LL.A................PILNSKpp
ENSGGOP00000025522  ..................LARKYVYSLY.WST..LTLTTIG-....ET..PP.P................VRDSEY..
ENSGGOP00000013502  ..................LARKYVYSLY.WST..LTLTTIG-....ET..PP.P................VRDSEY..
ENSGGOP00000025809  ..................NFDNVGLGYL.SLL..QVATFKGW....TI..IM.YaavdsvnvdkqpkyeySLYMYI..
ENSGGOP00000024945  ..................NFETFGNSII.CLF..EITTSAGW....DG..LLnPiln.............S---GPpd
ENSGGOP00000012234  ..................NFETFGNSII.CLF..EITTSAGW....DG..LLnPiln.............S---GPpd
ENSGGOP00000000352  ..................NFETFGNSMI.CLF..QITTSAGW....DG..LL.Apilnsgpp........DCDPEKdh
ENSGGOP00000013701  ..................NFDSLLWAIV.TVF..QILTQEDW....NV..VL.Yngmast..........SSWAAL..
ENSGGOP00000021319  ..................NFDSLLWAIV.TVF..QILTQEDW....NV..VL.Yngmast..........SSWAAL..
ENSGGOP00000027513  ..................NFDSLLWAIV.TVF..QILTQEDW....NV..VL.Yngmast..........SSWAAL..
ENSGGOP00000003602  ..................NFDNFAFAML.TVF..QCITMEGW....TD..VL.Ywvndaig.........WEWPWV..
ENSGGOP00000017118  ..................IRSAYIAALY.FTL..SSLTSVGF....GN..VS.A................NTDAEK..
ENSGGOP00000016440  ..................NFETFGNSMI.CLF..QITTSAGW....DG..LL.Apilnsapp........D----Cdp
ENSGGOP00000015188  ..................RRSAYIAALY.FTL..SSLTSVGF....GN..VC.A................NTDAEK..
ENSGGOP00000019923  ..................NFDTFPAAIM.TVF..QILTGEDW....NE..VM.Y................NGIRSQgg
ENSGGOP00000003342  ..................NFDSLLWAIV.TVF..QILTQEDW....NK..VL.Yngmast..........SSWAAL..
ENSGGOP00000023204  ..................NFDSLLWAIV.TVF..QILTQEDW....NK..VL.Yngmast..........SSWAAL..
ENSGGOP00000010829  ..................NFDTFPAAIM.TVF..QILTGEDW....NE..VM.Y................NGIRSQgg
ENSGGOP00000027293  ..................F-STYADALW.WGT..ITLTTIGY....GD..KT.P................LTWLGR..
ENSGGOP00000026337  ..................LAREYIYCLY.WST..LTLTTIG-....ET..PP.P................VKDEEY..
ENSGGOP00000012641  ..................NFQTFANSML.CLF..QITTSAGW....DG..LL.Spiln............TGPPYCdp
ENSGGOP00000026186  ..................WGKQYSYALF.KAM..SHMLCIGY....GR..QA.P................VGMSDV..
ENSGGOP00000008627  ..................WGKQYSYALF.KAM..SHMLCIGY....GR..QA.P................VGMSDV..
ENSGGOP00000012593  ..................LAREYIYCLY.WST..LTLTTIG-....ET..PP.P................VKDEEY..
ENSGGOP00000013701  ..................NFDNIGYAWI.AIF..QVITLEGW....VD..IM.Yyvmdah..........SFYNFI..
ENSGGOP00000021319  ..................NFDNIGYAWI.AIF..QVITLEGW....VD..IM.Yyvmdah..........SFYNFI..
ENSGGOP00000022082  ..................NFQTFPQAVL.LLF..RCATGEAW....QD..IM.L................ACMPGKkc
ENSGGOP00000028147  ..................NFETFGNSMI.CLF..QITTSAGW....DG..LL.Apilnsgpp........DCDPEKdh
ENSGGOP00000000898  ..................NFDNFFFAML.TVF..QCITMEGW....TD..VL.Ywmqdamg.........YELPWV..
ENSGGOP00000022765  ..................LSRKYIYSLY.WST..LTLTTIG-....ET..PP.P................VKDEEY..
ENSGGOP00000003013  ..................LSRKYIYSLY.WST..LTLTTIG-....ET..PP.P................VKDEEY..
ENSGGOP00000006428  ..................NFKTFASSML.CLF..QISTSAGW....DS..LL.S................PMLRSKes
ENSGGOP00000006310  ..................NFQTFANSML.CLF..QITTSAGWd...GL..LS.Piln.............TGPPYCdp
ENSGGOP00000017309  ..................NFDTFPAAIM.TVF..QILTGEDW....NE..VM.Y................DGIKSQgg
ENSGGOP00000015727  ..................WGRQYSHALF.KAM..SHMLCIGY....GQ..QA.P................VGMPDV..
ENSGGOP00000008481  ..................NFDTFPAAIM.TVF..QILTGEDW....NE..VM.Y................DGIKSQgg
ENSGGOP00000006428  ..................NFDNVGNAYL.ALL..QVATFKGW....MD..II.YaavdstekeqqpefesNSLGYI..
ENSGGOP00000004729  ..................NFDTFPAAIL.TVF..QILTGEDW....NA..VM.Y................HGIESQgg
ENSGGOP00000003342  ..................NFDNIGYAWI.AIF..QVITLEGW....VD..IM.Yfvmdah..........SFYNFI..
ENSGGOP00000001513  ..................WGKQYSYALF.KAM..SHMLCIGY....GA..QA.P................VSMSDL..
ENSGGOP00000021823  ..................NFDNFFFAML.TVF..QCITMEGW....TD..VL.Ywmqdamg.........YELPWV..
ENSGGOP00000021537  ..................WGKQYSYALF.KAM..SHMLCIGY....GR..QA.P................VGMSDV..
ENSGGOP00000018103  ..................QALTYWECVY.LLM..VTMSTVGY....GD..VY.A................KTTLGR..
ENSGGOP00000003602  ..................NFQTFPQAVL.LLF..RCATGEAW....QE..IM.L................ACLPGKlc
ENSGGOP00000013701  ..................TFSNFGMAFL.TLF..RVSTGDNW....NG..IM.K................DTLRECsr
ENSGGOP00000021319  ..................TFSNFGMAFL.TLF..RVSTGDNW....NG..IM.K................DTLRECsr
ENSGGOP00000027513  ..................TFSNFGMAFL.TLF..RVSTGDNW....NG..IM.K................DTLRECsr
ENSGGOP00000002713  ..................TFDNFPQSLL.TVF..QILTGEDW....NS..VM.Y................DGIMAYgg
ENSGGOP00000002713  ..................NFQTFPQAVL.LLF..RCATGEAW....QD..IM.L................ACMPGKkc
ENSGGOP00000000898  ..................NFQTFPQAVL.LLF..RCATGEAW....QE..IM.L................ASLPGNrc
ENSGGOP00000005331  ..................NFDNVGFGYL.SLL..QVATFKGW....MD..IM.Y................AAVDSRnv
ENSGGOP00000021823  ..................NFQTFPQAVL.LLF..RCATGEAW....QE..IM.L................ASLPGNrc
ENSGGOP00000001185  ..................NFDNFPQALI.SVF..QVLTGEDW....TS..MM.Y................NGIMAYgg
ENSGGOP00000008481  ..................NFRTFFQALM.LLF..RSATGEAW....HN..IM.L................SCLSGKpc
ENSGGOP00000001185  ..................NFQTFPQAVL.LLF..RCATGEAW....QE..IL.L................ACSYGKlc
ENSGGOP00000023924  ..................NFQTFPQAVL.LLF..RCATGEAW....QE..IL.L................ACSYGKlc
ENSGGOP00000022383  ..................WGRQYSHALF.KAM..SHMLCIGY....GQ..QA.P................VGMPDV..
ENSGGOP00000023204  ..................NFDNIGYAWI.AIF..QVITLEGW....VD..IM.Yfvmdah..........SFYNFI..
ENSGGOP00000023417  ..................NFDNVGFGYL.SLL..QVATFKGW....MD..IM.Y................AAVDSRnv
ENSGGOP00000024463  ..................TFENFGMAFL.TLF..QVSTGDNW....NG..IM.K................DTLRDCth
ENSGGOP00000016442  ..................VQDKYVTALY.FTF..SSLTSVGF....GN..VS.P................NTNSEK..
ENSGGOP00000009882  ..................TFENFGMAFL.TLF..QVSTGDNW....NG..IM.K................DTLRDCth
ENSGGOP00000019923  ..................NFRSFFGSLM.LLF..RSATGEAW....QE..IM.L................SCLGEKgc
ENSGGOP00000017309  ..................NNFTFFQALM.LLF..RSATGEAW....HN..IM.L................SCLSGKpc
ENSGGOP00000017557  ..................TFENFGMAFL.TLF..QVSTGDNW....NG..IM.K................DTLRDCth
ENSGGOP00000010829  ..................NFRSFFGSLM.LLF..RSATGEAW....QE..IM.L................SCLGEKgc
ENSGGOP00000001185  ..................HFDNVLSAMM.SLF..TVSTFEGW....PQ..LL.Y................KAIDSNee
ENSGGOP00000019172  ..................VQDKYVTALY.FTF..SSLTSVGF....GN..VS.P................NTNSEK..
ENSGGOP00000019923  ..................HYDNIIWALL.TLF..TVSTGEGW....PQ..VL.Q................HSVDVTee
ENSGGOP00000003342  ..................TFRNFGMAFL.TLF..RVSTGDNW....NG..IM.K................DTLRDCdq
ENSGGOP00000023204  ..................TFRNFGMAFL.TLF..RVSTGDNW....NG..IM.K................DTLRDCdq
ENSGGOP00000008481  ..................QFDNILFAVL.TVF..QCITMEGW....TD..LL.Ynsndasg.........NTWNWL..
ENSGGOP00000000501  ..................QALTYWECVY.LLM..VTMSTVGY....GD..VY.A................KTTLGR..
ENSGGOP00000023924  ..................HFDNVLSAMM.SLF..TVSTFEGW....PQ..LL.Y................KAIDSNee
ENSGGOP00000004729  ..................HYDNVLWALL.TLF..TVSTGEGW....PM..VL.K................HSVDATye
ENSGGOP00000027513  ..................NFDNIGYAWI.AIF..QVITLEGW....VD..IM.Yyvmdah..........SFYNFI..
ENSGGOP00000010829  ..................HYDNIIWALL.TLF..TVSTGEGW....PQ..VL.Q................HSVDVTee
ENSGGOP00000004729  ..................NFRTFLQALM.LLF..RSATGEAW....HE..IM.L................SCLSNQac
ENSGGOP00000001185  ..................HFDNFGFSML.TVY..QCITMEGW....TD..VL.Ywvndaig.........NEWPWI..
ENSGGOP00000023924  ..................HFDNFGFSML.TVY..QCITMEGW....TD..VL.Ywvndaig.........NEWPWI..
ENSGGOP00000000352  ..................WIETMWDCME.VAG..QTMCL---....--..--.-................-----T..
ENSGGOP00000007211  ..................DFSSYADSLW.WGT..ITLTTIGY....GD..KT.P................HTWLGR..
ENSGGOP00000028147  ..................WIETMWDCME.VAG..QTMCL---....--..--.-................-----T..
ENSGGOP00000020299  ..................NFQTFPQAVL.LLFrkRCATGEAW....QE..IM.L................ACLPGKlc
ENSGGOP00000013354  ..................RFQNIFTTIF.TLF..TLLTLDDW....SL..IY.Mdsra............QGAWYIip
ENSGGOP00000008980  ..................WIETMWDCME.VAG..QAMCL---....--..--.-................-----I..
ENSGGOP00000010829  ..................QFDNILFAVL.TVF..QCITMEGW....TT..VL.Yntndalg.........ATWNWL..
ENSGGOP00000024945  ..................WIETMWDCME.VAG..QAMCL---....--..--.-................-----T..
ENSGGOP00000012234  ..................WIETMWDCME.VAG..QAMCL---....--..--.-................-----T..
ENSGGOP00000021390  ..................DFSSYADSLW.WGT..ITLTTIGY....GD..KT.P................HTWLGR..
ENSGGOP00000023417  ..................WIETMWDCME.VAG..QAMCL---....--..--.-................-----T..
ENSGGOP00000005331  ..................WIETMWDCME.VAG..QAMCL---....--..--.-................-----T..
ENSGGOP00000002713  ..................NFDNFAFAML.TVF..QCITMEGW....TD..VL.Ywvndavg.........RDWPWI..
ENSGGOP00000020299  ..................TFDNFPQALL.TVF..QILTGEDW....NA..VM.Y................DGIMAYgg
ENSGGOP00000003602  ..................TFDNFPQALL.TVF..QILTGEDW....NA..VM.Y................DGIMAYgg
ENSGGOP00000012641  ..................WIETMWDCME.VSG..QSLCL---....--..--.-................-----L..
ENSGGOP00000010638  ..................LRRQYLYSFY.FST..LILTTVG-....DT..PP.P................AREEEY..
ENSGGOP00000020299  ..................NFDNFAFAML.TVF..QCITMEGW....TD..VL.Ywmndamg.........FELPWV..
ENSGGOP00000004729  ..................NFDNILFAIL.TVF..QCITMEGW....TD..IL.Yntndaag.........NTWNWL..
ENSGGOP00000016440  ..................SFDTFSWAFL.SLF..RLMTQDYW....EN..LY.Q................LTLRAAgk
ENSGGOP00000025809  ..................WIETMWDCME.VAG..QAMCL---....--..--.-................-----I..
ENSGGOP00000006736  ..................WSELYSFALF.KAM..SHMLCIGY....GR..QA.P................ESMTDI..
ENSGGOP00000022082  ..................NFDNFAFAML.TVF..QCITMEGW....TD..VL.Ywmqdamg.........YELPWV..
ENSGGOP00000000352  ..................SFDTFSWAFL.SLF..RLMTQDFW....EN..LY.Q................LTLRAAgk
ENSGGOP00000005331  ..................SFDTFSWAFL.SLF..RLMTQDFW....EN..LY.Q................LTLRAAgk
ENSGGOP00000008980  ..................SFDTFSWAFL.ALF..RLMTQDYW....EN..LY.Q................LTLRAAgk
ENSGGOP00000012641  ..................SFDSFAWAFL.ALF..RLMTQDCW....ER..LY.Q................QTLRSAgk
ENSGGOP00000000898  ..................TFDTFPQALL.TVF..QILTGEDW....NV..VM.Y................DGIMAYgg
ENSGGOP00000028147  ..................SFDTFSWAFL.SLF..RLMTQDFW....EN..LY.Q................LTLRAAgk
ENSGGOP00000003602  ..................NFDNVLSAMM.ALF..TVSTFEGW....PA..LL.Y................KAIDSNge
ENSGGOP00000023417  ..................SFDTFSWAFL.SLF..RLMTQDFW....EN..LY.Q................LTLRAAgk
ENSGGOP00000006310  ..................SFDSFAWAFL.SLF..RLMTQDSW....ER..LY.Q................QTLRASgk
ENSGGOP00000006310  ..................HMHDFFHSFL.IVF..RILCGEWI....EN..MW.Acmevgq..........KSICLI..
ENSGGOP00000020299  ..................NFDNVLSAMM.ALF..TVSTFEGW....PA..LL.Y................KAIDSNge
ENSGGOP00000023924  ..................NFDNFPQALVpPPT..QVLTGEDW....TS..MM.Y................NGIMAYgg
ENSGGOP00000011260  ..................QNISYFESIY.LVM..ATTSTVGF....GD..VV.A................KTSLGR..
ENSGGOP00000012234  ..................SYDTFSWAFL.ALF..RLMTQDYW....EN..LF.Q................LTLRAAgk
ENSGGOP00000024945  ..................SYDTFSWAFL.ALF..RLMTQDYW....EN..LF.Q................LTLRAAgk
ENSGGOP00000021823  ..................TFDTFPQALL.TVF..QILTGEDW....NV..VM.Y................DGIMAYgg
ENSGGOP00000021823  ..................NFDNVLSAMM.ALF..TVSTFEGW....PA..LL.Y................KAIDAYae
ENSGGOP00000008481  ..................HYDNVLWALL.TLF..TVSTGEGW....PQ..VL.K................HSVDATfe
ENSGGOP00000000898  ..................NFDNVLSAMM.ALF..TVSTFEGW....PA..LL.Y................KAIDAYae
ENSGGOP00000017309  ..................HYDNVLWALL.TLF..TVSTGEGW....PQ..VL.K................HSVDATfe
ENSGGOP00000016440  ..................WIETMWDCME.VAG..QTMCL---....--..--.-................------..
ENSGGOP00000022082  ..................TFDNFPQSLL.TVF..QILTGEDW....NS..VM.Y................DGIMAYgg
ENSGGOP00000009838  ..................G-NEYLRCYY.WAV..RTLITIG-....GL..PE.P................QTLFEI..
ENSGGOP00000006428  ..................NFDNFGWSFL.AMF..RLMTQDSW....EK..LY.Q................QTLRTTgl
ENSGGOP00000005127  ..................--LSLLTSFY.FCI..VTFSTVGY....GD..VT.P................KIWPSQ..
ENSGGOP00000016918  ..................--LSLLTSFY.FCI..VTFSTVGY....GD..VT.P................KIWPSQ..
ENSGGOP00000001687  ..................--WTALESIY.FVV..VTLTTVGF....GD..FV.Aggnagin.........YREWYK..
ENSGGOP00000015184  ..................VTSNFLGAMW.LIS..ITFLSIGY....GD..MV.P................NTYCGK..
ENSGGOP00000017557  ..................NFDNIGYAWI.VIF..QVITLEGW....VE..IM.Yyvmdah..........SFYNFI..
ENSGGOP00000022082  ..................DFDNVLAAMM.ALF..TVSTFEGW....PE..LL.Y................------..
ENSGGOP00000006428  .........ptvsclrhwHMGDFWHSFL.VVF..RILCGE--....--..W-.-................-----Ien
ENSGGOP00000027687  ..................--LNLFDSLY.FCI..VTFSTVGF....GD..VT.P................ETWSSK..
ENSGGOP00000002713  ..................DFDNVLAAMM.ALF..TVSTFEGW....PE..LL.Y................RSIDSHte
ENSGGOP00000007339  ..................NFDNVGNAML.ALF..EVLSLKGW....VE..VR.Dviihrv..........GPIHGI..
ENSGGOP00000016934  ..................NFDNVGNAML.ALF..EVLSLKGW....VE..VR.Dviihrv..........GPIHGI..
ENSGGOP00000025319  ..................--WSALDAIY.FVV..ITLTTIGF....GD..YV.Aggsdie..........YLDFYK..
ENSGGOP00000025813  ..................THWSFLSSLF.FCC..TVFSTVGY....GY..IY.P................VTRLGK..
ENSGGOP00000003047  ..................VQWKFAGSFY.FAI..TVITTIGY....GH..AA.P................GTDAGK..
ENSGGOP00000025809  ..................SFDTFSWAFL.ALF..RLMTQDYW....EN..LY.Q................Q-----..
ENSGGOP00000008617  .............ticvkYITSFTAAFS.FSL..ETQLTIGY....GT..MF.Psg..............DCPSAI..
ENSGGOP00000012511  ..................VTSNFLGAMW.LIS..ITFLSIGY....GD..MV.P................HTYCGK..
ENSGGOP00000005228  ..................EVNSFTAAFL.FSI..ETQTTIGY....GF..RC.Vtd..............ECPIAV..
ENSGGOP00000024187  ..................--WSALDAIY.FVV..ITLTTIGF....GD..YV.Aggsdie..........YLDFYK..
ENSGGOP00000007461  ..................N-WDFGSSFF.FAG..TVVTTIGY....GN..LA.P................STEAGQ..
ENSGGOP00000016722  ..................VGNSYIRCYY.FAV..KTLITIG-....GL..PD.P................KTLFEI..
ENSGGOP00000027288  ..................N-WDFGSSFF.FAG..TVVTTIGY....GN..LA.P................STEAGQ..
ENSGGOP00000005376  ..................T-GHLSDTLW.LIP..ITFLTIGY....GD..VV.P................GTMWGK..
ENSGGOP00000006442  ..................HFQNIQVALY.TLF..ICITQDGW....VD..IY.S................DFQTEKre
ENSGGOP00000024150  ..................VTSNFLGAMW.LIS..ITFLSIGY....GD..MV.P................HTYCGK..
ENSGGOP00000001687  ..................SHWDLGSAFF.FAG..TVITTIGY....GN..IA.P................STEGGK..
ENSGGOP00000009882  ..................NFDNIGYAWI.VIF..QVITLEGW....VE..IM.Yyvmdah..........SFYNFI..
ENSGGOP00000003047  ..................--WSFFHAYY.YCF..ITLTTIGF....GD..YV.Alqtkgalq........KKPLYV..
ENSGGOP00000002078  ..................HMHDFFHSFL.NVF..RILCG---....-E..WV.Etlwdcmevag......QSWCIP..
ENSGGOP00000027711  ........apvapkpcimHVNGFLGAFL.FSV..ETQTTIGY....GF..RC.Vte..............ECPLAV..
ENSGGOP00000000658  ................vmQVHGFMAAFL.FSI..ETQTTIGY....GL..RC.Vte..............ECPVAV..
ENSGGOP00000019229  ................vnNLNGFVAAFL.FSI..ETETTIGY....GH..RV.Itd..............QCPEGI..
ENSGGOP00000000546  paaggggaapvapkpcimHVNGFLGAFL.FSV..ETQTTIGY....GF..RC.Vte..............ECPLAV..
ENSGGOP00000007454  ..................GRWELMGSFF.FSV..STITTIGY....GN..LS.P................NTMAAR..
ENSGGOP00000024187  ..................SHWDLGSSFF.FAG..TVITTIGF....GN..IS.P................RTEGGK..
ENSGGOP00000018574  ..................SAWDLGSAFF.FSG..TIITTIGY....GN..VA.L................RTDAGR..
ENSGGOP00000001313  ..................SAWDLGSAFF.FSG..TIITTIGY....GN..VA.L................RTDAGR..
ENSGGOP00000022306  ................veNLSGFVSAFL.FSI..ETETTIGY....GF..RV.Ite..............KCPEGI..
ENSGGOP00000006045  ..................FFSDLPNSLV.TVF..ILFTLDHWyallQD..VW.K................VPEVSRif
ENSGGOP00000026587  ..................--WNFLESFY.FCF..ISLSTIGL....GD..YV.Pgegynqk.........FRELYK..
ENSGGOP00000003743  ................vtNLNGFVSAFL.FSI..ETETTIGY....GY..RV.Itd..............KCPEGI..
ENSGGOP00000005670  ..................VTSNFLGAMW.LIS..ITFLSIGY....GD..MV.P................HTYCGK..
ENSGGOP00000025319  ..................SHWDLGSSFF.FAG..TVITTIGF....GN..IS.P................RTEGGK..
ENSGGOP00000003637  .................tSIHSFSSAFL.FSI..EVQVTIGF....GG..RM.Vte..............ECPLAI..
ENSGGOP00000010687  ..................--WNFLESFY.FCF..ISLSTIGL....GD..YV.Pgegynqk.........FRELYK..
ENSGGOP00000005951  ..................--WNYIEGLY.YSF..ITISTIGF....GD..FV.Agvnpsan.........YHALYR..
ENSGGOP00000013120  ..................HVASFLAAFL.FAL..ETQTSIGY....GV..RS.Vte..............ECPAAV..
ENSGGOP00000002078  ..................NFETFGSSML.CLF..QVAIFAGW....DG..ML.D................AIFNSKws
ENSGGOP00000008753  ........sglestvcvtNVRSFTSAFL.FSI..EVQVTIGF....GG..RM.Mte..............ECPLAI..
ENSGGOP00000018872  ..................RQWKFPGSFY.FAI..TVITTIGY....GH..TA.P................GTDSGKv.
ENSGGOP00000017068  ..................RQWKFPGSFY.FAI..TVITTIGY....GH..TA.P................GTDSGKv.
ENSGGOP00000028458  ..................NVHSFTGAFL.FSL..ETQTTIGY....GY..RC.Vte..............ECSVAV..
ENSGGOP00000025813  ..................--LDFENAFY.FCF..VTLTTIGF....GD..TV.L................EHPNFF..
ENSGGOP00000019335  ..................PRWDFTGAFY.FVG..TVVSTIGF....GM..TT.P................ATVGGK..
ENSGGOP00000001313  ..................--WSKLEAIY.FVI..VTLTTVGF....GD..YV.Agadprq..........DSPAYQ..
ENSGGOP00000027030  ................vaNVYNFPSAFL.FFI..ETEATIGY....RN..IT.D................KCPEGI..
ENSGGOP00000012459  ..................--WDYVDSLY.FCF..VTFSTIGF....GD..LV.Ssqhaayr.........NQGLYR..
ENSGGOP00000026172  ..................--WDYVDSLY.FCF..VTFSTIGF....GD..LV.Ssqhaayr.........NQGLYR..
ENSGGOP00000017309  ..................QFDNILFAVL.TVF..QCITMEGW....TD..LL.Ynsndasg.........NTWNWL..
ENSGGOP00000018574  ..................--WSKLEAIY.FVI..VTLTTVGF....GD..YV.Agadprq..........DSPAYQ..
ENSGGOP00000004798  ..................NINGLTSAFL.FSL..ETQVTIGY....GF..RC.Vte..............QCATAI..
ENSGGOP00000027211  ..................NINGLTSAFL.FSL..ETQVTIGY....GF..RC.Vte..............QCATAI..
ENSGGOP00000018872  ..................--WTFFHAYY.YCF..ITPTTIGF....GD..FV.Alqsgealq........RKLPYV..
ENSGGOP00000007946  ..................--WSYFDSLY.FCF..VAFSTIGF....GD..LV.Ssqnahye.........SQGLYR..
ENSGGOP00000009787  ..................PAWDFASALF.FAS..TLITTVGY....GY..TT.P................LTDAGK..
ENSGGOP00000017068  ..................--WTFFHAYY.YCF..ITPTTIGF....GD..FV.Alqsgealq........RKLPYV..
ENSGGOP00000012459  ..................PRWDFPGAFY.FVG..TVVSTIGF....GM..TT.P................ATVGGK..
ENSGGOP00000017225  ...............cvvQVHTLTGAFL.FSL..ESQTTIGY....GF..RY.Ise..............ECPLAI..
ENSGGOP00000024508  ...............cvvQVHTLTGAFL.FSL..ESQTTIGY....GF..RY.Ise..............ECPLAI..
ENSGGOP00000026172  ..................PRWDFPGAFY.FVG..TVVSTIGF....GM..TT.P................ATVGGK..
ENSGGOP00000007339  ..................RFTTFPRAFM.SMF..QILTQEGW....VD..VM.D................QTLNAVgh
ENSGGOP00000012997  ...............cimKVDSLTGAFL.FSL..ESQTTIGY....GVrsIT.E................ECPHAI..
ENSGGOP00000016934  ..................RFTTFPRAFM.SMF..QILTQEGW....VD..VM.D................QTLNAVgh
ENSGGOP00000009787  ..................--WSFLDAFY.FCF..ISLSTIGL....GD..YV.Pgeapgqp.........YRALYK..
ENSGGOP00000019335  ..................--WSYFDSLY.FCF..VAFSTIGF....GD..LV.Ssqnahye.........SQGLYR..
ENSGGOP00000010687  ..................WNWDFTSALF.FAS..TVXXXXXY....GH..TV.P................LSDGGK..
ENSGGOP00000007461  ..................--WSFSEGFY.FAF..ITLSTIGF....GD..YV.V................GTDPSKhy
ENSGGOP00000005951  ..................-NWNWPNAMI.FAA..TVITTIGY....GN..VA.P................KTPAGR..
ENSGGOP00000007454  ..................--WSYTEGFY.FAF..ITLSTVGF....GD..YV.Igmnpsqr.........YPLWYK..
ENSGGOP00000002078  ..................NFDSFGWALF.VLF..RLMAQD-Y....PE..VL.Y................HQILYAsg
ENSGGOP00000011478  ..................RTWDLPSALL.FAA..SILTTTGY....GH..MA.P................LSPGGK..
ENSGGOP00000027967  ..................NFDDFAAALV.TLW..NLMVVNNW....QV..FL.Dayrrys..........GPWSKI..
ENSGGOP00000027288  ..................--WSFSEGFY.FAF..ITLSTIGF....GD..YV.V................GH----..
ENSGGOP00000010343  ..................NFDDFAAALV.TLW..NLMVVNNW....QV..FL.Dayrrys..........GPWSKI..
ENSGGOP00000021593  ..................VTSNFLGAMW.LIS..ITFLSIGY....GD..MV.P................HTYCGK..
ENSGGOP00000007339  ..................GFNEIGTSIF.TVY..EAASQEGW....VF..LM.Yraidsfp.........RWRSYF..
ENSGGOP00000016934  ..................GFNEIGTSIF.TVY..EAASQEGW....VF..LM.Yraidsfp.........RWRSYF..
ENSGGOP00000004744  ..................NWGNLAAAFF.TLF..SLATVDGW....TD..LQ.Kqldnr...........AFALSRa.
ENSGGOP00000010343  ..................YFQNLPESLT.SLL..VLLTTANN....PD..VM.Ipaysk...........NRAYAI..
ENSGGOP00000027967  ..................YFQNLPESLT.SLL..VLLTTANN....PD..VM.Ipaysk...........NRAYAI..
ENSGGOP00000025809  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000024463  ..................NFDNIGYAWI.VIF..QVITLEGW....VE..IM.Yyvmdah..........SFYNFI..
ENSGGOP00000002078  ..................--ISFLQA--.---..---TFNGW....IT..IM.NsaidsvavniqphfevNIYMYC..
ENSGGOP00000010207  ..................NFDNILNSFV.TLF..ELTVVNNW....YI..IM.Egvtsq...........TSHWSR..
ENSGGOP00000010203  ..................NFDNILNSFV.TLF..ELTVVNNW....YI..IM.Egvtsq...........TSHWSR..
ENSGGOP00000003957  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000011478  ..................--CSLLGAVY.FCF..SSLSTIGV....ED..LL.Pghgrslhpv.......IYHLGQ..
ENSGGOP00000010203  ..................YFSTLENSIV.SLF..VLLTTANF....PD..VM.Mpsys............RNPWSCv.
ENSGGOP00000010207  ..................YFSTLENSIV.SLF..VLLTTANF....PD..VM.Mpsys............RNPWSCv.
ENSGGOP00000001755  ..................DALTLSSAMW.FSW..GVLLNSGI....GE..GA.P................RSFSAR..
ENSGGOP00000018945  ..................DALTLSSAMW.FSW..GVLLNSGI....GE..GA.P................RSFSAR..
ENSGGOP00000022444  ..................F-STFQECIF.TQF..RIIL----....GD..IN.F................AEIEEAnr
ENSGGOP00000018177  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000003268  ..................F-STFQECIF.TQF..RIIL----....GD..IN.F................AEIEEAnr
ENSGGOP00000001590  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000020483  ..................NFSTFIKCIF.TQF..RIIL----....GD..FD.Y................NAIDNAnr
ENSGGOP00000020927  ..................NFSTFIKCIF.TQF..RIIL----....GD..FD.Y................NAIDNAnr
ENSGGOP00000001815  ..................NFSTFIKCIF.TQF..RIIL----....GD..FD.Y................NAIDNAnr
ENSGGOP00000007339  ..................NFSSAGKAIT.VLF..RIVTGEDW....NK..IM.Hdcmv............Q----Ppf
ENSGGOP00000001254  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000000981  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000026559  ..................NEFGIFNSLW.FSL..GAFMQQG-....CD..IS.P................RSLSGR..
ENSGGOP00000000982  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000009351  ..................NEFGIFNSLW.FSL..GAFMQQG-....CD..IS.P................RSLSGR..
ENSGGOP00000014483  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000023496  ..................----------.---..--------....--..--.-................------..
ENSGGOP00000016934  ..................NFSSAGKAIT.VLF..RIVTGEDW....NK..IM.Hdcmv............Q----Ppf
ENSGGOP00000016605  ..................NEFGIFNSLW.FSL..GAFMQQG-....CD..IS.P................RSLSGR..
ENSGGOP00000014493  ..................NEFGIFNSLW.FSL..GAFMQQG-....CD..IS.P................RSLSGR..
ENSGGOP00000012367  ..................NEFGIFNSLW.FSL..GAFMQQG-....CD..IS.P................RSLSGR..
ENSGGOP00000027522  ..................NEFGIFNSLW.FSL..GAFMQQG-....CD..IS.P................RSLSGR..


                                                   200       210       220                          
                                                     |         |         |                          
d1orqc_               .........................VIGIAVMLTGISALTLLIGTVSNMFQK---ilv....................
ENSGGOP00000011420  .........................IVGSLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000021753  .........................IVGSLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000000656  .........................IVGSLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000011744  .........................IVGSLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000003210  .........................IVGGLCCIAGVLVIALPIPIIVNNFSE---.......................
ENSGGOP00000027568  .........................IVGSLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000007168  .........................IVGSLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000024337  .........................IVGSLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000002688  .........................IFGSICSLSGVLVIALPVPVIVSNFSR---.......................
ENSGGOP00000009305  .........................LNAAISFLCGVIAIALPIHPIINNFV----r......................
ENSGGOP00000006737  .........................IVGGLCCIAGVLVIALPIPIIVNNFSE---.......................
ENSGGOP00000015335  .........................LVGALCALAGVLTIAMPVPVIVNNF-----.......................
ENSGGOP00000015202  .........................IFGSICSLSGVLVIALPVPVIVSNFSR---.......................
ENSGGOP00000003820  .........................LVGALCALAGVLTIAMPVPVIVNNF-----.......................
ENSGGOP00000008219  .........................IVGTLCAIAGVLTIALPVPVIVSNF-----n......................
ENSGGOP00000022687  .........................LVGALCALAGVLTIAMPVPVIVNNF-----.......................
ENSGGOP00000013400  .........................IVGSLCAIAGVLTISLPVPVIVSNF-----s......................
ENSGGOP00000027450  .........................LVGALCALAGVLTIAMPVPVIVNNF-----.......................
ENSGGOP00000000227  .........................FFAFLCIAFGIILNGMPISILYNKF-----s......................
ENSGGOP00000012818  .........................LVGALCALAGVLTIAMPVPVIVNNF-----.......................
ENSGGOP00000008276  .........................IVAFMCILSGILVLALPIAIINDRF-----s......................
ENSGGOP00000019798  .........................LVGALCALAGVLTIAMPVPVIVNNF-----.......................
ENSGGOP00000006085  .........................LVGALCALAGVLTIAMPVPVIVNNF-----.......................
ENSGGOP00000000958  .........................LIASTCIICGILVVALPITIIFNKFS----k......................
ENSGGOP00000002752  .........................LTASACILAGILVVVLPITLIFNKFS----hfyr...................
ENSGGOP00000000831  .........................VVALSSILSGILLMAFPVTSIFHTFSR---.......................
ENSGGOP00000002953  .........................LAASGCILGGILVVALPITIIFNKFS----hfyr...................
ENSGGOP00000023230  .........................LAASGCILGGILVVALPITIIFNKFS----hfyr...................
ENSGGOP00000001534  .........................MVALSSILSGILIMAFPATSIFHTF-----s......................
ENSGGOP00000005162  .........................VVALSSILSGILLMAFPVTSIFHTFSR---.......................
ENSGGOP00000001664  .........................ILGGVCVVSGIVLLALPITFIYHSF-----v......................
ENSGGOP00000025520  .........................LLAATFTLIGVSFFALPAGILGSGF-----a......................
ENSGGOP00000016408  .........................IFSICVMLIGSLMYASIFGNVSAIIQR---.......................
ENSGGOP00000020811  .........................LLAATFTLIGVSFFALPAGILGSGF-----a......................
ENSGGOP00000008202  .........................LLAATFTLIGVSFFALPAGILGSGF-----a......................
ENSGGOP00000012351  .........................IFSICVMLIGSLMYASIFGNVSAIIQR---.......................
ENSGGOP00000028732  .........................MFSVAMMMVGSLLYATIFGNVTTIFQQ---m......................
ENSGGOP00000011126  .........................LLSAGFALLGISFFALPAGILGSGF-----a......................
ENSGGOP00000012234  ...........eeqpqyevnlymylYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000024945  ...........eeqpqyevnlymylYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000008980  ...........deqpkyedniymyiYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000013052  .........................TIASCFSVFAISFFALPAGILGSGF-----a......................
ENSGGOP00000012641  ...........eeqpqweynlymyiYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000028610  .........................IFAVAIMMIGSLLYATIFGNVTTIFQQ---m......................
ENSGGOP00000006310  ...........nmqpkwednvymylYFVIFIIFGGFFTLNLFVGVIIDNFNQ---qk.....................
ENSGGOP00000001711  .........................LIAATFSLIGVSFFALPAGILGSG------la.....................
ENSGGOP00000017557  ...........dqqpvtnhnpwmllYFISFLLIVSFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000024463  ...........dqqpvtnhnpwmllYFISFLLIVSFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000009882  ...........dqqpvtnhnpwmllYFISFLLIVSFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000023204  ...........dqqpimnhnpwmllYFISFLLIVAFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000003342  ...........dqqpimnhnpwmllYFISFLLIVAFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000000352  ...........elqpkyednlymylYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000028147  ...........elqpkyednlymylYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000016440  ...........klqpvyeenlymylYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000008980  ........pgsgfkgdcgnpsvgifFFVSYIIISFLIVVNMYIAIILENF-----s......................
ENSGGOP00000024463  .........................YFVALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000017557  .........................YFVALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000001541  .........................IFSICTMLIGALMHAVVFGNVTAIIQRM--.......................
ENSGGOP00000009882  .........................YFVALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000013701  ...........dqqpvqnhnpwmllYFISFLLIVSFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000021319  ...........dqqpvqnhnpwmllYFISFLLIVSFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000027513  ...........dqqpvqnhnpwmllYFISFLLIVSFFVLNMFVGVVVENFHK---cr.....................
ENSGGOP00000023417  dcdpnkvnpgssvkgdcgnpsvgifFFVSYIIISFLVVVNMYIAVILENF-----s......................
ENSGGOP00000005331  dcdpnkvnpgssvkgdcgnpsvgifFFVSYIIISFLVVVNMYIAVILENF-----s......................
ENSGGOP00000025522  .........................VFVVVDFLIGVLIFATIVGNIGSMISNM--n......................
ENSGGOP00000013502  .........................VFVVVDFLIGVLIFATIVGNIGSMISNM--n......................
ENSGGOP00000025809  .........................YFVVFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000024945  .cdpnlenpgtsvkgdcgnpsigicFFCSYIIISFLIVVNMYIAIILENF-----n......................
ENSGGOP00000012234  .cdpnlenpgtsvkgdcgnpsigicFFCSYIIISFLIVVNMYIAIILENF-----n......................
ENSGGOP00000000352  ........pgssvkgdcgnpsvgifFFVSYIIISFLVVVNMYIAVILENF-----s......................
ENSGGOP00000013701  .........................YFVALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000021319  .........................YFVALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000027513  .........................YFVALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000003602  .........................YFVSLIILGSFFVLNLVLGVLSGEFSKERE.......................
ENSGGOP00000017118  .........................IFSICTMLIGALMHALVFGNVTAIIQRM--.......................
ENSGGOP00000016440  ....dtihpgssvkgdcgnpsvgifFFVSYIIISFLVVVNMYIAVILENF-----s......................
ENSGGOP00000015188  .........................IFSICTMLIGALMHAVVFGNVTAIIQRM--.......................
ENSGGOP00000019923  ................vssgmwsaiYFIVLTLFGNYTLLNVFLAIAVDNL-----a......................
ENSGGOP00000003342  .........................YFIALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000023204  .........................YFIALMTFGNYVLFNLLVAILVEGFQ----.......................
ENSGGOP00000010829  ................vssgmwsaiYFIVLTLFGNYTLLNVFLAIAVDNL-----a......................
ENSGGOP00000027293  .........................LLSAGFALLGISFFALPAGILGSGF-----a......................
ENSGGOP00000026337  .........................LFVIFDFLIGVLIFATIVGNVGSMISNM--n......................
ENSGGOP00000012641  .....tlpnsngsrgdcgspavgilFFTTYIIISFLIVVNMYIAIILENF-----s......................
ENSGGOP00000026186  .........................WLTMLSMIVGATCYAMFIGHATALIQ----sldssr.................
ENSGGOP00000008627  .........................WLTMLSMIVGATCYAMFIGHATALIQ----sldssr.................
ENSGGOP00000012593  .........................LFVIFDFLIGVLIFATIVGNVGSMISNM--n......................
ENSGGOP00000013701  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000021319  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000022082  ..apesepsnstegetpcgssfavfYFISFYMLCAFLIINLFVAVIMDNF-----.......................
ENSGGOP00000028147  ........pgssvkgdcgnpsvgifFFVSYIIISFLVVVNMYIAVILENF-----s......................
ENSGGOP00000000898  .........................YFVSLVIFGSFFVLNLVLGVLSGEFSKERE.......................
ENSGGOP00000022765  .........................LFVVIDFLVGVLIFATIVGNVGSMISNM--n......................
ENSGGOP00000003013  .........................LFVVIDFLVGVLIFATIVGNVGSMISNM--n......................
ENSGGOP00000006428  .........cnsssenchlpgiatsYFVSYIIISFLIVVNMYIAVILENF-----n......................
ENSGGOP00000006310  .....nlpnsngtrgdcgspavgiiFFTTYIIISFLIVVNMYIAVILENF-----n......................
ENSGGOP00000017309  ................vqggmvfsiYFIVLTLFGNYTLLNVFLAIAVDNL-----a......................
ENSGGOP00000015727  .........................WLTMLSMIVGATCYAMFIGHATALIQ----sldssr.................
ENSGGOP00000008481  ................vqggmvfsiYFIVLTLFGNYTLLNVFLAIAVDNL-----a......................
ENSGGOP00000006428  .........................YFVVFIIFGSFFTLNLFIGVIIDNFNQQQK.......................
ENSGGOP00000004729  ................vskgmfssfYFIVLTLFGNYTLLNVFLAIAVDNL-----a......................
ENSGGOP00000003342  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000001513  .........................WITMLSMIVGATCYAMFVGHATALIQ----sldssr.................
ENSGGOP00000021823  .........................YFVSLVIFGSFFVLNLVLGVL---------sg.....................
ENSGGOP00000021537  .........................WLTMLSMIVGATCYAMFIGHATALIQ----sldssr.................
ENSGGOP00000018103  .........................LFMVFFILGGLAMFASYVPEIIEL------i......................
ENSGGOP00000003602  ....dpesdynpgeeytcgsnfaivYFISFYMLCAFLIINLFVAVIMDNF-----.......................
ENSGGOP00000013701  ..........edkhclsylpalspvYFVTFVLVAQFVLVNVVVAVLMKHLEE---sn.....................
ENSGGOP00000021319  ..........edkhclsylpalspvYFVTFVLVAQFVLVNVVVAVLMKHLEE---sn.....................
ENSGGOP00000027513  ..........edkhclsylpalspvYFVTFVLVAQFVLVNVVVAVLMKHLEE---sn.....................
ENSGGOP00000002713  ...............psfpgmlvciYFIILFICGNYILLNVFLAIAVDNL-----a......................
ENSGGOP00000002713  ..apesepsnstegetpcgssfavfYFISFYMLCAFLIINLFVAVIMDNF-----.......................
ENSGGOP00000000898  ....dpesdfgpgeeftcgsnfaiaYFISFFMLCAFLIINLFVAVIMDNF-----.......................
ENSGGOP00000005331  ...........elqpkyeeslymylYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000021823  ....dpesdfgpgeeftcgsnfaiaYFISFFMLCAFLIINLFVAVIMDNF-----.......................
ENSGGOP00000001185  ...............psypgmlvciYFIILFVCGNYILLNVFLAIAVDNL-----a......................
ENSGGOP00000008481  .......dknsgiltrecgnefayfYFVSFIFLCSFLMLNLFVAVIMDNF-----e......................
ENSGGOP00000001185  ....dpesdyapgeeytcgtnfayyYFISFYMLCAFLVINLFVAVIMDNF-----.......................
ENSGGOP00000023924  ....dpesdyapgeeytcgtnfayyYFISFYMLCAFLVINLFVAVIMDNF-----.......................
ENSGGOP00000022383  .........................WLTMLSMIVGATCYAMFIGHATALIQ----sldssr.................
ENSGGOP00000023204  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000023417  ...........elqpkyeeslymylYFVIFIIFGSFFTLNLFIGVIIDNFNQ---qk.....................
ENSGGOP00000024463  ..........dersclsslqfvsplYFVSFVLTAQFVLINVVVAVLM--------kh.....................
ENSGGOP00000016442  .........................VFSICVMLIGSLMYASIFGNVSAIIQR---.......................
ENSGGOP00000009882  ..........dersclsslqfvsplYFVSFVLTAQFVLINVVVAVLM--------kh.....................
ENSGGOP00000019923  ..epdttapsgqnenercgtdlayvYFVSFIFFCSFLMLNLFVAVIMDNF-----e......................
ENSGGOP00000017309  .......dknsgiltrecgnefayfYFVSFIFLCSFLMLNLFVAVIMDNF-----e......................
ENSGGOP00000017557  ..........dersclsslqfvsplYFVSFVLTAQFVLINVVVAVLM--------kh.....................
ENSGGOP00000010829  ..epdttapsgqnenercgtdlayvYFVSFIFFCSFLMLNLFVAVIMDNF-----e......................
ENSGGOP00000001185  ...........dvgpiynnrvemaiFFIIYIILIAFFMMNIFVGFVIVTFQE---q......................
ENSGGOP00000019172  .........................VFSICVMLIGSLMYASIFGNVSAIIQR---.......................
ENSGGOP00000019923  ...........drgpsrsnrmemsiFYVVYFVVFPFFFVNIFVALIIITFQE---.......................
ENSGGOP00000003342  .............estcyntvispiYFVSFVLTAQFVLVNVVIAVLMKHLEE---sn.....................
ENSGGOP00000023204  .............estcyntvispiYFVSFVLTAQFVLVNVVIAVLMKHLEE---sn.....................
ENSGGOP00000008481  .........................YFIPLIIIGSFFMLNLVLGVLSGEFAKE--r......................
ENSGGOP00000000501  .........................LFMVFFILGGLAMFASYVPEIIEL------i......................
ENSGGOP00000023924  ...........dvgpiynnrvemaiFFIIYIILIAFFMMNIFVGFVIVTFQE---q......................
ENSGGOP00000004729  ...........eqgpspgyrmelsiFYVVYFVVFPFFFVNIFVALIIITFQE---.......................
ENSGGOP00000027513  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000010829  ...........drgpsrsnrmemsiFYVVYFVVFPFFFVNIFVALIIITFQE---.......................
ENSGGOP00000004729  .........deqanatecgsdfayfYFVSFIFLCSFLMLNLFVAVIMDNF-----e......................
ENSGGOP00000001185  .........................YFVTLILLGSFFILNLVLGVLSGEFTKE--r......................
ENSGGOP00000023924  .........................YFVTLILLGSFFILNLVLGVLSGEFTKE--r......................
ENSGGOP00000000352  .........................VFMMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000007211  .........................VLAAGFALLGISFFALPAGILGSGF-----a......................
ENSGGOP00000028147  .........................VFMMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000020299  ....dpesdynpgeeytcgsnfaivYFISFYMLCAFLIINLFVAVIMDNF-----.......................
ENSGGOP00000013354  .........................ILIIYIIIQYFIFLNLVITVLVDSFQ----.......................
ENSGGOP00000008980  .........................VFMMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000010829  .........................YFIPLIIIGSFFVLNLVLGVLSGEFAKE--r......................
ENSGGOP00000024945  .........................VFLMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000012234  .........................VFLMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000021390  .........................VLAAGFALLGISFFALPAGILGSGF-----a......................
ENSGGOP00000023417  .........................VFMMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000005331  .........................VFMMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000002713  .........................YFVTLIIIGSFFVLNLVLGVLSGEFSKERE.......................
ENSGGOP00000020299  ...............psssgmivciYFIILFICGNYILLNVFLAIAVDNL-----a......................
ENSGGOP00000003602  ...............psssgmivciYFIILFICGNYILLNVFLAIAVDNL-----a......................
ENSGGOP00000012641  .........................VFLLVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000010638  .........................LFMVGDFLLAVMGFATIMGSMSS-------vi.....................
ENSGGOP00000020299  .........................YFVSLVIFGSFFVLNLVLGVLSGEFSKERE.......................
ENSGGOP00000004729  .........................YFIPLIIIGSFFMLNLVLGVLSGEFAKE--r......................
ENSGGOP00000016440  .....................tymiFFVLVIFLGSFYLVNLILAVVAMAYEEQ--n......................
ENSGGOP00000025809  .........................VYMMVMVIGNLVVLNLFLALLLSSF-----s......................
ENSGGOP00000006736  .........................WLTMLSMIVGATCYAMFIGHATALIQ----sldssr.................
ENSGGOP00000022082  .........................YFVSLVIFGSFFVLNLVLGVLSGEFSKERE.......................
ENSGGOP00000000352  .....................tymiFFVLVIFLGSFYLINLILAVVAMAYEEQ--n......................
ENSGGOP00000005331  .....................tymiFFVLVIFLGSFYLINLILAVVAMAYEEQ--n......................
ENSGGOP00000008980  .....................tymiFFVLVIFVGSFYLVNLILAVVAMAYEEQ--n......................
ENSGGOP00000012641  .....................iymiFFMLVIFLGSFYLVNLILAVVAMAYEEQ--n......................
ENSGGOP00000000898  ...............pffpgmlvciYFIILFICGNYILLNVFLAIAVDNL-----.......................
ENSGGOP00000028147  .....................tymiFFVLVIFLGSFYLINLILAVVAMAYEEQ--n......................
ENSGGOP00000003602  ...........nigpiynhrveisiFFIIYIIIVAFFMMNIFVGFVIVTFQE---q......................
ENSGGOP00000023417  .....................tymiFFVLVIFLGSFYLINLILAVVAMAYEEQ--n......................
ENSGGOP00000006310  .....................iymiFFVLVIFLGSFYLVNLILAVVTMAYEEQ--n......................
ENSGGOP00000006310  .........................LFLTVMVLGNLVVLNLFIALLLNSF-----s......................
ENSGGOP00000020299  ...........nigpiynhrveisiFFIIYIIIVAFFMMNIFVGFVIVTFQE---q......................
ENSGGOP00000023924  ...............psypgmlvciYFIILFVCGNYILLNVFLAIAVDNL-----a......................
ENSGGOP00000011260  .........................TFIMFFTLGSLILFANYIPEMVELFANKRK.......................
ENSGGOP00000012234  .....................tymiFFVVIIFLGSFYLINLILAVVAMAYAE---qn.....................
ENSGGOP00000024945  .....................tymiFFVVIIFLGSFYLINLILAVVAMAYAE---qn.....................
ENSGGOP00000021823  ...............pffpgmlvciYFIILFICGNYILLNVFLAIAVDNL-----.......................
ENSGGOP00000021823  ...........dhgpiynyrveisvFFIVYIIIIAFFMMNIFVGFVIITF-----r......................
ENSGGOP00000008481  ...........nqgpspgyrmemsiFYVVYFVVFPFFFVNIFVALIIITFQE---.......................
ENSGGOP00000000898  ...........dhgpiynyrveisvFFIVYIIIIAFFMMNIFVGFVIITF-----r......................
ENSGGOP00000017309  ...........nqgpspgyrmemsiFYVVYFVVFPFFFVNIFVALIIITFQE---.......................
ENSGGOP00000016440  .........................------------------------------ivfmlvmvignl...........
ENSGGOP00000022082  ...............psfpgmlvciYFIILFICGNYILLNVFLAIAVDNL-----a......................
ENSGGOP00000009838  .........................VFQLLNFFSGVFVFSSLIGQM---------rd.....................
ENSGGOP00000006428  .....................ysvfFFIVVIFLGSFYLINLTLAVVTMAYEEQNK.......................
ENSGGOP00000005127  .........................LLVVIMICVALVVLPLQFEELVYLWMERQKsggnysrhraqtekhvvlcvssl
ENSGGOP00000016918  .........................LLVVIMICVALVVLPLQFEELVYLWMERQKsggnysrhraqtekhvvlcvssl
ENSGGOP00000001687  .........................PLVWFWILVGLAYFAAVLSMIGDWLR----vlskktkeevgeikahaaewkan
ENSGGOP00000015184  .........................GVCLLTGIMGAGCTALVVAVVARKLE----ltkaekhvhnfmmdtqltkrvkn
ENSGGOP00000017557  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000022082  .........................------------------------------rsi....................
ENSGGOP00000006428  ........mwecmqeanassslcviVFILITVIGKLVVLNLFIALLLNSFS----ne.....................
ENSGGOP00000027687  .........................LFVVAMICVALVVLPIQFEQLAYLWMERQKsggnysrhraqtekhvvlcvssl
ENSGGOP00000002713  ...........dkgpiynyrveisiFFIIYIIIIAFFMMNIFVGFVIVTFQE---q......................
ENSGGOP00000007339  .........................YIHVFVFLGCMIGLTLFVGVVIANFN----e......................
ENSGGOP00000016934  .........................YIHVFVFLGCMIGLTLFVGVVIANFN----e......................
ENSGGOP00000025319  .........................PVVWFWILVGLAYFAAVLSMIGDWLR----viskktkeevgefrahaaewtan
ENSGGOP00000025813  .........................YLCMLYALFGIPLMFLVLT-----------dtgdilatilstsynrfrkf...
ENSGGOP00000003047  .........................AFCMFYAVLGIPLTLVMFQSLGERM-----ntfvryllkrikkccg.......
ENSGGOP00000025809  .........................------------------------------klfirgktyfsfnthtqwissey
ENSGGOP00000008617  .........................ALLAIQMLLGLMLEAFITGAFVAKIAR---pknrafsirftdiavvahmdgkp
ENSGGOP00000012511  .........................GVCLLTGIMGAGCTALVVAVVARKLE----ltkaekhvhnfmmdtqltkrlrs
ENSGGOP00000005228  .........................FMVVFQSIVGCIIDAFIIGAVMAKM-----a......................
ENSGGOP00000024187  .........................PVVWFWILVGLAYFAAVLSMIGDWLR----viskktkeevgefrahaaewtan
ENSGGOP00000007461  .........................VFCVFYALLGIPLNVIFLNHLGTGL-----rahlatierwedrprrsqv....
ENSGGOP00000016722  .........................VFQLLNYFTGVFAFSVMIGQM---------r......................
ENSGGOP00000027288  .........................VFCVFYALLGIPLNVIFLNHLGTGL-----rahlatierwedrprrsq.....
ENSGGOP00000005376  .........................IVCLCTGVMGVCCTALLVAVVARKLE----fnkaekhvhnfmmdiqytkemke
ENSGGOP00000006442  ................yameiggaiYFTIFITIGAFIGINLFVIVVTTNLEQM--m......................
ENSGGOP00000024150  .........................GVCLLTGIMGAGCTALVVAVVARKLE----ltkaekhvhnfmmdtqltkrllk
ENSGGOP00000001687  .........................IFCILYAIFGIPLFGFLLAGIGDQ------l......................
ENSGGOP00000009882  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000003047  .........................AFSFMYILVGLTVIGAFLNLVVLRF-----ltmnsederrdaeer........
ENSGGOP00000002078  .........................FYLMVILIGNLLVLYLFLALV---------ss.....................
ENSGGOP00000027711  .........................IAVVVQSIVGCVIDSFMIGTIMAKM-----a......................
ENSGGOP00000000658  .........................FMVVAQSIVGCIIDSFMIGAIMAKM-----a......................
ENSGGOP00000019229  .........................VLLLLQAILGSMVNAFMVGCMFVKI-----s......................
ENSGGOP00000000546  .........................IAVVVQSIVGCVIDSFMIGTIMAKM-----a......................
ENSGGOP00000007454  .........................LFCIFFALVGIPLNLVVLNRLGHLMQQ---gvnhc..................
ENSGGOP00000024187  .........................IFCIIYALLGIPLFGFLLAGVGD-------ql.....................
ENSGGOP00000018574  .........................LFCIFYALVGIPLFGILLAGVGDR------lgsslr.................
ENSGGOP00000001313  .........................LFCIFYALVGIPLFGILLAGVGDR------lgsslr.................
ENSGGOP00000022306  .........................ILLLVQAILGSIVNAFMVGCMFVKI-----s......................
ENSGGOP00000006045  ......................ssiYFILWLLLGSIIFRSIIVAMMVTNFQ----nir....................
ENSGGOP00000026587  .........................IGITCYLLLGLIAMLVVL------------etf....................
ENSGGOP00000003743  .........................ILLLIQSVLGSIVNAFMVGCMFVKI-----s......................
ENSGGOP00000005670  .........................GVCLLTGIMGAGCTALVVAVVARKLE----ltkaekhvhnfmmdtqltkrvkn
ENSGGOP00000025319  .........................IFCIIYALLGIPLFGFLLV-----------yi.....................
ENSGGOP00000003637  .........................LILIVQNIVGLMINAIMLGCIFM-------kt.....................
ENSGGOP00000010687  .........................IGITCYLLLGLIAMLVVLETFC--------elhelkkfrkmfyvkkdkded..
ENSGGOP00000005951  .........................YFVELWIYLGLAWLSLFVNWKVSMFVEVH-kaikkrrrrrke...........
ENSGGOP00000013120  .........................AAVVLQCIAGCVLDAFVVGAVMAKM-----a......................
ENSGGOP00000002078  ....dcdpdkinpgtqvrgdcgnpsVGIFYFVRSWLIIVNMYIVVVME-------fl.....................
ENSGGOP00000008753  .........................TVLILQNIVGLIINAVMLGCIFM-------kt.....................
ENSGGOP00000018872  .........................FFCMFYALLGIPLTLVTFQSLGER------lnavvrrl...............
ENSGGOP00000017068  .........................FFCMFYALLGIPLTLVTFQSLGER------lnavvrrl...............
ENSGGOP00000028458  .........................LMVILQSILSCIINTFIIGAALA-------km.....................
ENSGGOP00000025813  .........................LFFSIYIIIGMEIVFIAFKLVQNR------l......................
ENSGGOP00000019335  .........................IFLIFYGLVGCSSTILFFNLFLER------litiiayimkschqr........
ENSGGOP00000001313  .........................PLVWFWILLGLAYFASVLTTIGNWLR----vvsrrtraemggltaqaaswtg.
ENSGGOP00000027030  .........................ILFLFQSILGSIVDAFLIGCMFIKM-----s......................
ENSGGOP00000012459  .........................LGNFLFILLGVCCIYSLFNVISILIK----qvlnwmlrklscrccarccpap.
ENSGGOP00000026172  .........................LGNFLFILLGVCCIYSLFNVISILIK----qvlnwmlrklscrccarccpa..
ENSGGOP00000017309  .........................YFIPLIIIGSFFMLNLVLGVLSGEFAKE--r......................
ENSGGOP00000018574  .........................PLVWFWILLGLAYFASVLTTIGNWL-----rvvsrrtraem............
ENSGGOP00000004798  .........................FLLIFQSILGVIINSFMCGAILAKI-----s......................
ENSGGOP00000027211  .........................FLLIFQSILGVIINSFMCGAILAKI-----s......................
ENSGGOP00000018872  .........................AFSFLYILLGLTVTGAFLNPVVL-------rf.....................
ENSGGOP00000007946  .........................FANFVFILMGVCCIYSLFNVISIL------ik.....................
ENSGGOP00000009787  .........................AFSIAFALLGVPTTMLLLT-----------asaqrls................
ENSGGOP00000017068  .........................AFSFLYILLGLTVTGAFLNPVVL-------rf.....................
ENSGGOP00000012459  .........................AFLIAYGLFGCAGTILFFNLFLER------iisllafimr.............
ENSGGOP00000017225  .........................VLLIAQLVLTTILEIFITGTFLA-------kia....................
ENSGGOP00000024508  .........................VLLIAQLVLTTILEIFITGTFLA-------kia....................
ENSGGOP00000026172  .........................AFLIAYGLFGCAGTILFFNLFLER------iisllafimr.............
ENSGGOP00000007339  .................mwapvvaiYFILYHLFATLILLSLFVAVILDNL-----e......................
ENSGGOP00000012997  .........................FLLVAQLVITTLIEIFITGTFL--------akia...................
ENSGGOP00000016934  .................mwapvvaiYFILYHLFATLILLSLFVAVILDNL-----e......................
ENSGGOP00000009787  .........................VLVTVYLFLGLVAMVLVL------------qtf....................
ENSGGOP00000019335  .........................FANFVFILMGVCCIYSLFNVISILIK----qslnwilrkmdsgccpq......
ENSGGOP00000010687  .........................AFCIIYSVIGIPFTLLFLTAVVQR------itvhvtrrpvl............
ENSGGOP00000007461  ....................isvyrSLAAIWILLGLAWLALI-------------l......................
ENSGGOP00000005951  .........................LFCVFYGLFGVPLCLTWISALGKFF-----ggrakrl................
ENSGGOP00000007454  .........................NMVSLWILFGMAWLALI-------------n......................
ENSGGOP00000002078  ....................kvymiFFVVVSFLFSFYMASLFLGILAMAYEE---e......................
ENSGGOP00000011478  .........................AFCMVYAALGLPA-----------------slalmatlrhcllpv........
ENSGGOP00000027967  .........................YFVLWWLVSSVIWVNLFLALILENF-----lhk....................
ENSGGOP00000027288  .........................------------------------------pl.....................
ENSGGOP00000010343  .........................YFVLWWLVSSVIWVNLFLALILENF-----lhk....................
ENSGGOP00000021593  .........................GVCLLTGIMGAGCTALVVAVVARKL-----e......................
ENSGGOP00000007339  .........................YFITLIFFLAWLVKNVFIAVIIETFA----ei.....................
ENSGGOP00000016934  .........................YFITLIFFLAWLVKNVFIAVIIETFA----ei.....................
ENSGGOP00000004744  .........................FTIIFILLASFIFLNMFVGVMI--------mht....................
ENSGGOP00000010343  .........................FFIVFTVIGSLFLMNLLTAIIYSQF-----r......................
ENSGGOP00000027967  .........................FFIVFTVIGSLFLMNLLTAIIYSQF-----r......................
ENSGGOP00000025809  .........................------------------------------.......................
ENSGGOP00000024463  .........................YFILLIIVGSFFMINLCLVVIATQFSE---.......................
ENSGGOP00000002078  .........................YFINFIIFGVFLPLSMLITVIIDNFN----k......................
ENSGGOP00000010207  .........................LYFMTFYIVTMVVMTIIVAFILEAF-----v......................
ENSGGOP00000010203  .........................LYFMTFYIVTMVVMTIIVAFILEAF-----v......................
ENSGGOP00000003957  .........................------------------------------n......................
ENSGGOP00000011478  .........................LALLGYLLLGLLAMLLAVETF---------sel....................
ENSGGOP00000010203  .........................FFIVYLSIELYFIMNLLLAVVFDTF-----n......................
ENSGGOP00000010207  .........................FFIVYLSIELYFIMNLLLAVVFDTF-----n......................
ENSGGOP00000001755  .........................ILGMVWAGFAMIIVASYTANLAAFLV----ldrpeeritgindprlrnpsdkf
ENSGGOP00000018945  .........................ILGMVWAGFAMIIVASYTANLAAFLV----ldrpeeritgindprlrnpsdkf
ENSGGOP00000022444  ....................vlgpiYFTTFVFFMFFILLNMFLAIINDTYS----e......................
ENSGGOP00000018177  .........................------------------------------nv.....................
ENSGGOP00000003268  ....................vlgpiYFTTFVFFMFFILLNMFLAIINDTYS----e......................
ENSGGOP00000001590  .........................------------------------------nkr....................
ENSGGOP00000020483  ....................ilgpaYFVTYVFFVFFVLLNMFLAIINDTYS----e......................
ENSGGOP00000020927  ....................ilgpaYFVTYVFFVFFVLLNMFLAIINDTYS----e......................
ENSGGOP00000001815  ....................ilgpaYFVTYVFFVFFVLLNMFLAIINDTYS----e......................
ENSGGOP00000007339  ....ctpdeftywatdcgnyagalmYFCSFYVIIAYIMLNLLVAIIVENF-----s......................
ENSGGOP00000001254  .........................------------------------------a......................
ENSGGOP00000000981  .........................------------------------------rv.....................
ENSGGOP00000026559  .........................IVGGVWWFFTLIIISSYTANLAAF------l......................
ENSGGOP00000000982  .........................------------------------------se.....................
ENSGGOP00000009351  .........................IVGGVWWFFTLIIISSYTANLAAF------l......................
ENSGGOP00000014483  .........................------------------------------.......................
ENSGGOP00000023496  .........................------------------------------.......................
ENSGGOP00000016934  ....ctpdeftywatdcgnyagalmYFCSFYVIIAYIMLNLLVAIIVENF-----s......................
ENSGGOP00000016605  .........................IVGGVWWFFTLIIISSYTANLAAFL-----tv.....................
ENSGGOP00000014493  .........................IVGGVWWFFTLIIISSYTANLAAFL-----tv.....................
ENSGGOP00000012367  .........................IVGGVWWFFTLIIISSYTANLAAFL-----tv.....................
ENSGGOP00000027522  .........................IVGGVWWFFTLIIISSYTANLAAFL-----tv.....................


                                                             
                                                             
d1orqc_               .......................................
ENSGGOP00000011420  .......................................
ENSGGOP00000021753  .......................................
ENSGGOP00000000656  .......................................
ENSGGOP00000011744  .......................................
ENSGGOP00000003210  .......................................
ENSGGOP00000027568  .......................................
ENSGGOP00000007168  .......................................
ENSGGOP00000024337  .......................................
ENSGGOP00000002688  .......................................
ENSGGOP00000009305  .......................................
ENSGGOP00000006737  .......................................
ENSGGOP00000015335  .......................................
ENSGGOP00000015202  .......................................
ENSGGOP00000003820  .......................................
ENSGGOP00000008219  .......................................
ENSGGOP00000022687  .......................................
ENSGGOP00000013400  .......................................
ENSGGOP00000027450  .......................................
ENSGGOP00000000227  .......................................
ENSGGOP00000012818  .......................................
ENSGGOP00000008276  .......................................
ENSGGOP00000019798  .......................................
ENSGGOP00000006085  .......................................
ENSGGOP00000000958  .......................................
ENSGGOP00000002752  .......................................
ENSGGOP00000000831  .......................................
ENSGGOP00000002953  .......................................
ENSGGOP00000023230  .......................................
ENSGGOP00000001534  .......................................
ENSGGOP00000005162  .......................................
ENSGGOP00000001664  .......................................
ENSGGOP00000025520  .......................................
ENSGGOP00000016408  .......................................
ENSGGOP00000020811  .......................................
ENSGGOP00000008202  .......................................
ENSGGOP00000012351  .......................................
ENSGGOP00000028732  .......................................
ENSGGOP00000011126  .......................................
ENSGGOP00000012234  .......................................
ENSGGOP00000024945  .......................................
ENSGGOP00000008980  .......................................
ENSGGOP00000013052  .......................................
ENSGGOP00000012641  .......................................
ENSGGOP00000028610  .......................................
ENSGGOP00000006310  .......................................
ENSGGOP00000001711  .......................................
ENSGGOP00000017557  .......................................
ENSGGOP00000024463  .......................................
ENSGGOP00000009882  .......................................
ENSGGOP00000023204  .......................................
ENSGGOP00000003342  .......................................
ENSGGOP00000000352  .......................................
ENSGGOP00000028147  .......................................
ENSGGOP00000016440  .......................................
ENSGGOP00000008980  .......................................
ENSGGOP00000024463  .......................................
ENSGGOP00000017557  .......................................
ENSGGOP00000001541  .......................................
ENSGGOP00000009882  .......................................
ENSGGOP00000013701  .......................................
ENSGGOP00000021319  .......................................
ENSGGOP00000027513  .......................................
ENSGGOP00000023417  .......................................
ENSGGOP00000005331  .......................................
ENSGGOP00000025522  .......................................
ENSGGOP00000013502  .......................................
ENSGGOP00000025809  .......................................
ENSGGOP00000024945  .......................................
ENSGGOP00000012234  .......................................
ENSGGOP00000000352  .......................................
ENSGGOP00000013701  .......................................
ENSGGOP00000021319  .......................................
ENSGGOP00000027513  .......................................
ENSGGOP00000003602  .......................................
ENSGGOP00000017118  .......................................
ENSGGOP00000016440  .......................................
ENSGGOP00000015188  .......................................
ENSGGOP00000019923  .......................................
ENSGGOP00000003342  .......................................
ENSGGOP00000023204  .......................................
ENSGGOP00000010829  .......................................
ENSGGOP00000027293  .......................................
ENSGGOP00000026337  .......................................
ENSGGOP00000012641  .......................................
ENSGGOP00000026186  .......................................
ENSGGOP00000008627  .......................................
ENSGGOP00000012593  .......................................
ENSGGOP00000013701  .......................................
ENSGGOP00000021319  .......................................
ENSGGOP00000022082  .......................................
ENSGGOP00000028147  .......................................
ENSGGOP00000000898  .......................................
ENSGGOP00000022765  .......................................
ENSGGOP00000003013  .......................................
ENSGGOP00000006428  .......................................
ENSGGOP00000006310  .......................................
ENSGGOP00000017309  .......................................
ENSGGOP00000015727  .......................................
ENSGGOP00000008481  .......................................
ENSGGOP00000006428  .......................................
ENSGGOP00000004729  .......................................
ENSGGOP00000003342  .......................................
ENSGGOP00000001513  .......................................
ENSGGOP00000021823  .......................................
ENSGGOP00000021537  .......................................
ENSGGOP00000018103  .......................................
ENSGGOP00000003602  .......................................
ENSGGOP00000013701  .......................................
ENSGGOP00000021319  .......................................
ENSGGOP00000027513  .......................................
ENSGGOP00000002713  .......................................
ENSGGOP00000002713  .......................................
ENSGGOP00000000898  .......................................
ENSGGOP00000005331  .......................................
ENSGGOP00000021823  .......................................
ENSGGOP00000001185  .......................................
ENSGGOP00000008481  .......................................
ENSGGOP00000001185  .......................................
ENSGGOP00000023924  .......................................
ENSGGOP00000022383  .......................................
ENSGGOP00000023204  .......................................
ENSGGOP00000023417  .......................................
ENSGGOP00000024463  .......................................
ENSGGOP00000016442  .......................................
ENSGGOP00000009882  .......................................
ENSGGOP00000019923  .......................................
ENSGGOP00000017309  .......................................
ENSGGOP00000017557  .......................................
ENSGGOP00000010829  .......................................
ENSGGOP00000001185  .......................................
ENSGGOP00000019172  .......................................
ENSGGOP00000019923  .......................................
ENSGGOP00000003342  .......................................
ENSGGOP00000023204  .......................................
ENSGGOP00000008481  .......................................
ENSGGOP00000000501  .......................................
ENSGGOP00000023924  .......................................
ENSGGOP00000004729  .......................................
ENSGGOP00000027513  .......................................
ENSGGOP00000010829  .......................................
ENSGGOP00000004729  .......................................
ENSGGOP00000001185  .......................................
ENSGGOP00000023924  .......................................
ENSGGOP00000000352  .......................................
ENSGGOP00000007211  .......................................
ENSGGOP00000028147  .......................................
ENSGGOP00000020299  .......................................
ENSGGOP00000013354  .......................................
ENSGGOP00000008980  .......................................
ENSGGOP00000010829  .......................................
ENSGGOP00000024945  .......................................
ENSGGOP00000012234  .......................................
ENSGGOP00000021390  .......................................
ENSGGOP00000023417  .......................................
ENSGGOP00000005331  .......................................
ENSGGOP00000002713  .......................................
ENSGGOP00000020299  .......................................
ENSGGOP00000003602  .......................................
ENSGGOP00000012641  .......................................
ENSGGOP00000010638  .......................................
ENSGGOP00000020299  .......................................
ENSGGOP00000004729  .......................................
ENSGGOP00000016440  .......................................
ENSGGOP00000025809  .......................................
ENSGGOP00000006736  .......................................
ENSGGOP00000022082  .......................................
ENSGGOP00000000352  .......................................
ENSGGOP00000005331  .......................................
ENSGGOP00000008980  .......................................
ENSGGOP00000012641  .......................................
ENSGGOP00000000898  .......................................
ENSGGOP00000028147  .......................................
ENSGGOP00000003602  .......................................
ENSGGOP00000023417  .......................................
ENSGGOP00000006310  .......................................
ENSGGOP00000006310  .......................................
ENSGGOP00000020299  .......................................
ENSGGOP00000023924  .......................................
ENSGGOP00000011260  .......................................
ENSGGOP00000012234  .......................................
ENSGGOP00000024945  .......................................
ENSGGOP00000021823  .......................................
ENSGGOP00000021823  .......................................
ENSGGOP00000008481  .......................................
ENSGGOP00000000898  .......................................
ENSGGOP00000017309  .......................................
ENSGGOP00000016440  .......................................
ENSGGOP00000022082  .......................................
ENSGGOP00000009838  .......................................
ENSGGOP00000006428  .......................................
ENSGGOP00000005127  kidllmdflnefyah........................
ENSGGOP00000016918  kidllmdflnefyah........................
ENSGGOP00000001687  vtaefretrrrlsveihdk....................
ENSGGOP00000015184  aaanvlretwliyk.........................
ENSGGOP00000017557  .......................................
ENSGGOP00000022082  .......................................
ENSGGOP00000006428  .......................................
ENSGGOP00000027687  kidllmdflnefyah........................
ENSGGOP00000002713  .......................................
ENSGGOP00000007339  .......................................
ENSGGOP00000016934  .......................................
ENSGGOP00000025319  vtaefketrrrlsveiydk....................
ENSGGOP00000025813  .......................................
ENSGGOP00000003047  .......................................
ENSGGOP00000025809  qlytvvswiv.............................
ENSGGOP00000008617  nl.....................................
ENSGGOP00000012511  vkme...................................
ENSGGOP00000005228  .......................................
ENSGGOP00000024187  vtaefketrrrlsveiydk....................
ENSGGOP00000007461  .......................................
ENSGGOP00000016722  .......................................
ENSGGOP00000027288  .......................................
ENSGGOP00000005376  saarvlqeawmfykhtrkk....................
ENSGGOP00000006442  .......................................
ENSGGOP00000024150  .......................................
ENSGGOP00000001687  .......................................
ENSGGOP00000009882  .......................................
ENSGGOP00000003047  .......................................
ENSGGOP00000002078  .......................................
ENSGGOP00000027711  .......................................
ENSGGOP00000000658  .......................................
ENSGGOP00000019229  .......................................
ENSGGOP00000000546  .......................................
ENSGGOP00000007454  .......................................
ENSGGOP00000024187  .......................................
ENSGGOP00000018574  .......................................
ENSGGOP00000001313  .......................................
ENSGGOP00000022306  .......................................
ENSGGOP00000006045  .......................................
ENSGGOP00000026587  .......................................
ENSGGOP00000003743  .......................................
ENSGGOP00000005670  aaanvlretwliykht.......................
ENSGGOP00000025319  .......................................
ENSGGOP00000003637  .......................................
ENSGGOP00000010687  .......................................
ENSGGOP00000005951  .......................................
ENSGGOP00000013120  .......................................
ENSGGOP00000002078  .......................................
ENSGGOP00000008753  .......................................
ENSGGOP00000018872  .......................................
ENSGGOP00000017068  .......................................
ENSGGOP00000028458  .......................................
ENSGGOP00000025813  .......................................
ENSGGOP00000019335  .......................................
ENSGGOP00000001313  .......................................
ENSGGOP00000027030  .......................................
ENSGGOP00000012459  .......................................
ENSGGOP00000026172  .......................................
ENSGGOP00000017309  .......................................
ENSGGOP00000018574  .......................................
ENSGGOP00000004798  .......................................
ENSGGOP00000027211  .......................................
ENSGGOP00000018872  .......................................
ENSGGOP00000007946  .......................................
ENSGGOP00000009787  .......................................
ENSGGOP00000017068  .......................................
ENSGGOP00000012459  .......................................
ENSGGOP00000017225  .......................................
ENSGGOP00000024508  .......................................
ENSGGOP00000026172  .......................................
ENSGGOP00000007339  .......................................
ENSGGOP00000012997  .......................................
ENSGGOP00000016934  .......................................
ENSGGOP00000009787  .......................................
ENSGGOP00000019335  .......................................
ENSGGOP00000010687  .......................................
ENSGGOP00000007461  .......................................
ENSGGOP00000005951  .......................................
ENSGGOP00000007454  .......................................
ENSGGOP00000002078  .......................................
ENSGGOP00000011478  .......................................
ENSGGOP00000027967  .......................................
ENSGGOP00000027288  .......................................
ENSGGOP00000010343  .......................................
ENSGGOP00000021593  .......................................
ENSGGOP00000007339  .......................................
ENSGGOP00000016934  .......................................
ENSGGOP00000004744  .......................................
ENSGGOP00000010343  .......................................
ENSGGOP00000027967  .......................................
ENSGGOP00000025809  .......................................
ENSGGOP00000024463  .......................................
ENSGGOP00000002078  .......................................
ENSGGOP00000010207  .......................................
ENSGGOP00000010203  .......................................
ENSGGOP00000003957  .......................................
ENSGGOP00000011478  .......................................
ENSGGOP00000010203  .......................................
ENSGGOP00000010207  .......................................
ENSGGOP00000001755  iyatvkqssvdiyfrrqvelstmyrhmekhnyesaaeai
ENSGGOP00000018945  iyatvkqssvdiyfrrqvelstmyrhmekhnyesaaeai
ENSGGOP00000022444  .......................................
ENSGGOP00000018177  .......................................
ENSGGOP00000003268  .......................................
ENSGGOP00000001590  .......................................
ENSGGOP00000020483  .......................................
ENSGGOP00000020927  .......................................
ENSGGOP00000001815  .......................................
ENSGGOP00000007339  .......................................
ENSGGOP00000001254  .......................................
ENSGGOP00000000981  .......................................
ENSGGOP00000026559  .......................................
ENSGGOP00000000982  .......................................
ENSGGOP00000009351  .......................................
ENSGGOP00000014483  .......................................
ENSGGOP00000023496  .......................................
ENSGGOP00000016934  .......................................
ENSGGOP00000016605  .......................................
ENSGGOP00000014493  .......................................
ENSGGOP00000012367  .......................................
ENSGGOP00000027522  .......................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0041998 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Meiothermus ruber DSM 1279
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] torques
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Enterococcus faecalis 62
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc citreum KM20
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Prevotella intermedia 17
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Simkania negevensis Z
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema brennaborense DSM 12168
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Aquifex aeolicus VF5
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Collimonas fungivorans Ter331
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium radiobacter K84
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Hyphomicrobium sp. MC1
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Oceanimonas sp. GK1
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
No