SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Voltage-gated potassium channels alignments in Tursiops truncatus 76_1

These alignments are sequences aligned to the 0041998 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                10        20         30                             
                                                 |         |          |                             
d1orqc_               ..............igdv----MEHPLVELGVSYAALLSVIVVVVE.CTMQ...........................
ENSTTRP00000010419  ...............sgp------ARVIAIVSVMVILISIVIFCLE.TLPElkddkdftgtvhrldnttvv.......
ENSTTRP00000004039  ...............sva------AKILAIISIMFIVLSTIALSLN.TLPE...........................
ENSTTRP00000006570  ..............sspa-------RGIAIVSVLVILISIVIFCLE.TLPEfrddrdlitalstgghsgllndtsaph
ENSTTRP00000006832  ..............argi----------AIVSVLVILISIVIFCLE.TLPQfradgrggsngggvspvsrgsqeeeed
ENSTTRP00000012947  ...............sta------ALVFYYVTGFFIAVSVIANVVE.TIPCrgparrppreqp...............
ENSTTRP00000009306  .............ssaar--------GVAMVSVLVVVISITVFCLE.TLPEfqedrelkvvrdsslnmsktvl.....
ENSTTRP00000015380  ...............tst-----MALVFYYVTGFFIAVSVIANVVE.TVPCgsspghikelp................
ENSTTRP00000012489  ...............scp------ARVVAVLSFLLILVSSVVMCMG.TIPE...........................
ENSTTRP00000004829  ...............stl------ALVFYYVTGFFIAVSVITNVVE.TVPCgtvpgskelp.................
ENSTTRP00000015083  .............iaiss--------------LSVVLASIVAMCIH.SMSE...........................
ENSTTRP00000001235  ................sr-----AARVVAFASLFFILVSITTFCLE.THEAfnidrnvteihrvgnttsvrfr.....
ENSTTRP00000012542  ................sr-----AARFIAFASLFFILVSITTFCLE.THEAfnivknktepvingtsvvlq.......
ENSTTRP00000006964  .............kaigv------------ASSLFVLISVVALALN.TVEE...........................
ENSTTRP00000002262  .................s----RAARYVAFASLFFILISITTFCLE.THEGfihisnktvtqaspipgappenitn..
ENSTTRP00000004325  .................v----------------------------.----...........................
ENSTTRP00000007208  ..................PGYSLPSKLFSCVSIGVVLASIAAMCIH.SLPEyqareaaaavaavaagrra........
ENSTTRP00000010081  ..............glpg-------KVFACLSVLFVTVTAVNLSIS.TLPSlreeeekg...................
ENSTTRP00000013879  ...............sgp------ARIIAIVSVMVILISIVSFCLE.TLPIfrdenedmhgsgvtfhtysnstigyq.
ENSTTRP00000012173  ...............lpg-------KIFACLSILFVATMAVSLCVS.TMPD...........................
ENSTTRP00000012038  .................h------------VSVVFVIVSMVVLCAS.TLPDwraaaadnrslddrsr...........
ENSTTRP00000013799  ..................PGSSTAARIFGVISIIFVAVSIVNMALM.SAEL...........................
ENSTTRP00000013153  .................s----RYARYVAFASLFFILVSITTFCLE.THERfnpivnkteienvrngtqvryy.....
ENSTTRP00000014995  .................w------AFVYHAFVFLLVFGCLILSVFS.TIPE...........................
ENSTTRP00000001573  ..................-HYSPFKAVWDWLILLLVIYTAIFTPYS.AAFL...........................
ENSTTRP00000005694  ..................-HYSPFKAVWDWLILLLVIYTAIFTPYS.AAFL...........................
ENSTTRP00000014511  ................fk-------TTWDWVILILTFYTAIMVPYN.VSF-...........................
ENSTTRP00000008933  .................h-------SWFETFIIFMILLSSGALAFEdIYLE...........................
ENSTTRP00000006619  ................hn--------WFETFIVFMILLSSGALAFEdIYIE...........................
ENSTTRP00000012773  .................i-----------------VLGCLILAVLT.TFRE...........................
ENSTTRP00000000204  .................h-------KMFDHVVLVIIFLNCITIAMErPKID...........................
ENSTTRP00000013305  .................h-------SWFESFIIFMILLSSGALAFEdFYLD...........................
ENSTTRP00000000629  ..................------HKLFDYVVLAFIFLNCITIALErPQIE...........................
ENSTTRP00000013138  .................q--------AFDIVIMMLICLNMVTMMVE.TDT-...........................
ENSTTRP00000010790  ................hn--------WFETFIVFMILLSSGALAFEdIYID...........................
ENSTTRP00000000364  .................h-------KMFDHVVLVFIFLNCITIALErPDID...........................
ENSTTRP00000005250  .................k-------QVFDISIMILICLNMVTMMVE.TDD-...........................
ENSTTRP00000004176  .................s---GPAGKLFACVSVAFVAVTAVGLCLS.TMPDiraeeerxxxxxxxxxxxxxxx.....
ENSTTRP00000000364  .................s-------KYFNRGIMVAILTNTLSMGIE.YHE-...........................
ENSTTRP00000010790  .................r-------QVFDISIMILICLNMVTMMVE.TDD-...........................
ENSTTRP00000000629  .................s-------KYFSRGIMMAILVNTVSMGIE.YHQ-...........................
ENSTTRP00000003584  .................q--------AFDIAIMVLICLNMVTMMVE.KEG-...........................
ENSTTRP00000000204  .................s-------KYFGRGIMIAILVNTLSMGIE.YHE-...........................
ENSTTRP00000006619  .................q--------AFDITIMILICLNMVTMMVE.TDD-...........................
ENSTTRP00000014856  ..................HPYSDFRFYWDLTMLLLMVGNLIIIPVG.ITF-...........................
ENSTTRP00000008933  .................q--------AFDVTIMFLICLNMVTMMVE.TDD-...........................
ENSTTRP00000005715  ..................DPSNNMYYHWLTIIAVPIFYNWCLLVCRaCFDE...........................
ENSTTRP00000016088  .................k--------PFDILILLTIFANCVALGVY.IPFP...........................
ENSTTRP00000011516  ..................HPYSDFRFYWDLIMLIMMVGNLVIIPVG.ITF-...........................
ENSTTRP00000008973  ..................HPYSDFRFYWDLIMLLLMVGNLIVLPVG.ITF-...........................
ENSTTRP00000001468  .................r-------QVFDISIMILICLNMVTMMVE.TDD-...........................
ENSTTRP00000013323  .................h-------SWFESFIIFVILLSSGALVFEdIYLG...........................
ENSTTRP00000002836  .................t--------YFEYLMFVLILLNTICLAMQ.HYG-...........................
ENSTTRP00000003584  .................h-------SWFESFIVLMILLSSGALAFEdIYIE...........................
ENSTTRP00000001468  ................hn--------WFETFIVFMILLSSGALAFEdIYIE...........................
ENSTTRP00000000204  ..................-------PWFERISMLVILLNCVTLGMF.RPCEdia........................
ENSTTRP00000000364  ..................-------PWFEHVSMLVIMLNCVTLGMF.RPCEdve........................
ENSTTRP00000013136  .................a-------QSFYWVVLCVVALNTLCVAMV.HYN-...........................
ENSTTRP00000011356  .................s-------PPFEYTIMAMIALNTIVLMMK.FYG-...........................
ENSTTRP00000008021  ...............stf------KAGWDWLILLATFYVAVTVPYN.VCFIgn.........................
ENSTTRP00000013018  .................s-------RVFYWLVILIVALNTLSIASE.HHH-...........................
ENSTTRP00000011356  .................w-------PPFEYMILATIIANCIVLALE.QHLP...........................
ENSTTRP00000003295  .................s-------PSFEYTIMAMIALNTVVLMMK.YYS-...........................
ENSTTRP00000005250  ..................-------PFVDLAITICIVLNTLFMAME.HYP-...........................
ENSTTRP00000001723  ..................----------------------------.----...........................
ENSTTRP00000013323  ..................------HQVFDIIIIILIFLNMVSMMAE.SYG-...........................
ENSTTRP00000013138  ..................-------PFVDLAITICIVLNTLFMAME.HHP-...........................
ENSTTRP00000000629  .................s-------HYLDIFITCIICLNVVTMSLE.HYN-...........................
ENSTTRP00000013018  .................s-------SYFEYLMFALIMLNTICLGMQ.HYN-...........................
ENSTTRP00000000204  ................sh--------YLDLFITGVIGLNVVTMAME.HYQ-...........................
ENSTTRP00000003584  ................st--------AFSMLIMCTILTNCIFMTMS.----...........................
ENSTTRP00000001827  ............gkfqvi---------------LVFVLSIGSLIIY.FINS...........................
ENSTTRP00000003295  .................w-------PPFEYMILATIIANCIVLALEqHLPE...........................
ENSTTRP00000011644  .................v--------TFYWLVIVLVFLNTLTISSE.HYN-...........................
ENSTTRP00000015837  ..............yyrl-----------FVIAMPVLYSWCLLVAR.ACD-...........................
ENSTTRP00000010790  ..................-------PFVDLAITICIVLNTLFMAME.HYP-...........................
ENSTTRP00000000781  .................l----------------------------.----...........................
ENSTTRP00000001468  .................p--------FVDLPITICIVLNTLFMAME.HYP-...........................
ENSTTRP00000013136  .................w-------PPFEYMILATIIANCIVLALEqHFPD...........................
ENSTTRP00000011644  .................p---------FEYMMFVLIMLNTLCLAMQ.HYE-...........................
ENSTTRP00000012570  ..................----------------------------.----...........................
ENSTTRP00000006619  ..................-------PFVDLGITICIVLNTLFMAME.HYP-...........................
ENSTTRP00000001468  ................hs--------LFSMLIMCTILTNCVFMTLS.----...........................
ENSTTRP00000002836  ................xe----------------------------.----...........................
ENSTTRP00000012822  .................l----------------------------.----...........................
ENSTTRP00000002689  ..................--YGHAAPGTDAGKAFCMFYAVLGIPLT.LVMF...........................
ENSTTRP00000013138  ................hs--------LFSMIIMCTILTNCVFMTFS.NPP-...........................
ENSTTRP00000010790  ................hs--------LFSMLIMCTILTNCVFMTMS.----...........................
ENSTTRP00000006356  ..................DPSGDYYYWWLNTMVFPVMYNLIIVVCRaCFPD...........................
ENSTTRP00000005250  .................h-------SLFNVLIMCTILTNCVFMTMS.----...........................
ENSTTRP00000011644  .................h-------HIFTNLILVFIMLSSAALAAE.DPIR...........................
ENSTTRP00000013138  ................hn--------WFETFIIFMILLSSGALAFEdIYIE...........................
ENSTTRP00000013305  .................h-------SWFSLFITITILVNCVGMTQT.ELP-...........................
ENSTTRP00000016088  .................h-------HVFTNLILVFIILSSVSLAAE.DPIR...........................
ENSTTRP00000006619  ................hs--------LFSMFIMITILTNCVFMTMS.DPP-...........................
ENSTTRP00000002836  ................ss--------VFYWLVIFLVFLNTLTIASE.HYN-...........................
ENSTTRP00000013323  ................hs--------LFSMFIICTVIINCVFMAMT.RGK-...........................
ENSTTRP00000003295  .................s-------QVFYWIVLSLVALNTACVAIV.HHN-...........................
ENSTTRP00000013305  ...............fae-----------LTITLCIVVNTIFMAME.HYG-...........................
ENSTTRP00000010733  ..................HPDSDFRFYWDFTMLLFMVGNLIIIPVG.ITF-...........................
ENSTTRP00000003584  ..................-------PFVDLAITICIVLNTLFMAME.HHP-...........................
ENSTTRP00000013136  .................s-------PPFEYFIMAMIALNTVVLMMK.FYD-...........................
ENSTTRP00000006224  ..................----------------------------.----...........................
ENSTTRP00000002836  ................xx----------------------------.----...........................
ENSTTRP00000009920  ..................----------------------------.----...........................
ENSTTRP00000013018  ................kp---------FETIILLTIFANCVALAAY.LPMP...........................
ENSTTRP00000002368  .................l----------------------------.----...........................
ENSTTRP00000011644  .................p---------FDIFILLAIFANCVALAIY.IPFP...........................
ENSTTRP00000000825  .................l----------------------------.----...........................
ENSTTRP00000011711  ..................----------------------------.----...........................
ENSTTRP00000005250  ................hn--------WFETFIVFMILLSSGALAFEdIYIE...........................
ENSTTRP00000013305  .................g----------------------------.----...........................
ENSTTRP00000003295  ................xx----------------------------.----...........................
ENSTTRP00000002153  .................r-----FYLLWLLLVTIAFNWNCWLIPLRiIFPY...........................
ENSTTRP00000000364  ................ld----------------------------.----...........................
ENSTTRP00000016088  .................a--------AFEYLMFLLILLNTVALAMQ.HYE-...........................
ENSTTRP00000006664  .......rfrhwfvakly----------------------------.----...........................
ENSTTRP00000002958  ...............gqr----------------------------.----...........................
ENSTTRP00000008624  ...........wnvsqtk----------------------------.----...........................
ENSTTRP00000009742  ....rakrglgmrradvs----------------------------.----...........................
ENSTTRP00000000400  ................qv----------------------------.----...........................
ENSTTRP00000000399  .................w----------------------------.----...........................
ENSTTRP00000011701  ...............ckt----------------------------.----...........................
ENSTTRP00000012365  ..................--YGHTVPLSDGGKAFCIIYSVIGIPFT.LLFL...........................
ENSTTRP00000001716  .............vrety----------------------------.----...........................
ENSTTRP00000003616  .................c---------FKCFIGLVTLLSTGALAFEdIYID...........................
ENSTTRP00000005061  ..............ksqr----------------------------.----...........................
ENSTTRP00000009742  ................rt----------------------------.----...........................
ENSTTRP00000008624  .................m----------------------------.----...........................
ENSTTRP00000003072  ................ll----------------------------.----...........................
ENSTTRP00000009040  ..............qety----------------------------.----...........................
ENSTTRP00000005008  ............nvrety----------------------------.----...........................
ENSTTRP00000013018  .................a-------TWFTNFILLFILLSSAALAAE.DPIR...........................
ENSTTRP00000014295  .............nireq----------------------------.----...........................
ENSTTRP00000007445  .................a----------------------------.----...........................
ENSTTRP00000000398  .................l----------------------------.----...........................
ENSTTRP00000000398  .................r----------------------------.----...........................
ENSTTRP00000003616  ..................-------PFTDLFLTICIILNVHFLALE.HYP-...........................
ENSTTRP00000009762  ......ifmkwqvppelv----------------------------.----...........................
ENSTTRP00000000629  .................l--------WWWCISMLVILLNCVTLGMY.QPCDdmdclserckilqxxxxxxxxxxxxxx
ENSTTRP00000003616  .................k--------VFNIIIMVLIFFQAITIMIQ.SDE-...........................
ENSTTRP00000003528  ................ts----------------------------.----...........................
ENSTTRP00000002957  .............gsyvv----------------------------.----...........................
ENSTTRP00000012888  ...............svv----------------------------.----...........................
ENSTTRP00000009192  ..............alla----------------------------.----...........................
ENSTTRP00000004010  ............lnedtg----------------------------.----...........................
ENSTTRP00000009192  ............plswls----------------------------.----...........................
ENSTTRP00000001715  ................kr----------------------------.----...........................
ENSTTRP00000014553  ................ly----------------------------.----...........................
ENSTTRP00000006420  ..............vfhm------------FILSMVTVDVIVAASNyHKGE...........................
ENSTTRP00000000399  .........carmlgvtw----------------------------.----...........................
ENSTTRP00000000400  hlttlerwedqprrsqll----------------------------.----...........................
ENSTTRP00000004010  .........clagwkpsv----------------------------.----...........................
ENSTTRP00000011356  .................l-------RYFEMCILMVIAMSSIALAAE.DPVQ...........................
ENSTTRP00000011356  .................q--------AFYWTVLSLVALNTLCVAIV.HYN-...........................
ENSTTRP00000006319  .................y---SVPKAIWDGLILLATFYVAVTVPYN.VCFS...........................
ENSTTRP00000003616  ..................------HPFFRLLILISILIDCIFMSMT.DLP-...........................
ENSTTRP00000010014  .................x----------------------------.----...........................
ENSTTRP00000004968  ..............lgip----------------------------.----...........................
ENSTTRP00000008933  ................hs--------LFSMLIMCTILTNCVFMAQR.DPPPwtkyvxxxxxxxxxxxxxxxxxxxxxx
ENSTTRP00000002091  ................aq---------TLTGRVLVVLVFALSIGAL.VIYF...........................
ENSTTRP00000004968  .............ealrk----------------------------.----...........................
ENSTTRP00000007963  ..................DPTTNMYIVWLFFVVLAWNWNCWLIVRW.AFPY...........................
ENSTTRP00000012888  .................r----------------------------.----...........................
ENSTTRP00000010014  .................l----------------LVFSCLVLSVLS.TIPE...........................
ENSTTRP00000006420  ..................-------PWVHSLLRICAIISVISVCMN.TPMT...........................
ENSTTRP00000013323  ..................-------PFTELAITICIIINTLFLAME.HYQ-...........................
ENSTTRP00000000582  .................h-------PAFHLLLAVLLVVNAITIALR.TNSVldqxxxxxxxxxxxxxxxxxxxxxxxx
ENSTTRP00000006420  .................t--------YLDWVMIIVTICSCISMMFE.SPFRrvmhaptlqiaeyxxxxxxxxxxxxxx
ENSTTRP00000002134  ..................--YGHMAPLSAGGKAFCVVYTALGLPAS.LAL-...........................
ENSTTRP00000013136  .................m-------RYFEMSILVVIALSSIALAAE.DPVQ...........................
ENSTTRP00000016088  .................y-----------WAVLLLVFLNTLTIASE.HHG-...........................
ENSTTRP00000000047  ..............ellg----------------------------.----...........................
ENSTTRP00000009762  ................tt----------------------------.----...........................
ENSTTRP00000010378  .................y----------------------------.----...........................
ENSTTRP00000004338  .................s-------KAFQYFMYLVVAVNGVWILVE.TFML...........................
ENSTTRP00000007759  ..................---------FEYVGYLVILMNIFPIIIS.WISV...........................
ENSTTRP00000006420  ...............xxx----------------------------.----...........................
ENSTTRP00000011228  .................h-------HYFDYLGNLMALGNLVTICVF.LVLD...........................
ENSTTRP00000016320  .............nireq----------------------------.----...........................
ENSTTRP00000014317  ................ah--------RFQVIIICLVVLDALLVLAE.LVLDlkiiqpd....................
ENSTTRP00000011228  ..................--YSSTSQWTLSFTIFLILALAFIETPS.SLTS...........................
ENSTTRP00000004338  ..............yvha----------------------------.----...........................
ENSTTRP00000014427  .............flaac----------------------------.----...........................
ENSTTRP00000005277  ............rliffv----------------------------.----...........................
ENSTTRP00000001972  ..............edal----------------------------.----...........................
ENSTTRP00000008933  ................fa----------DLTITMCIVINTLFMALE.HYNMttefeemlqvgnlxxxxxxxxxxxxxx
ENSTTRP00000002589  .............fayig----------------------------.----...........................
ENSTTRP00000011285  .............igcei----------------------------.----...........................
ENSTTRP00000011701  .................e----------------------------.----...........................
ENSTTRP00000005251  ..............yeiw----------------------------.----...........................
ENSTTRP00000006684  ..........eiwmcivf----------------------------.----...........................


                                                                            40         50        60 
                                                                             |          |         | 
d1orqc_               ......................................LSGE..........YLVRLYLVDLI.LVIILWADYAYRAY
ENSTTRP00000010419  ......................................YSVNi.........FTDPFFIVETL.CIIWFSFELVVRFF
ENSTTRP00000004039  ......................................LQSLdefgqtt...DNPQLAHVEAV.CIAWFTMEYLLRFL
ENSTTRP00000006570  ..................................pensGHTI..........FNDPFFIVETV.CIVWFSFEFVVRCF
ENSTTRP00000006832  ...........eddsytfhpgitaggmvaggssplstlGGSF..........FTDPFFLVETL.CIVWFTFELLVRFS
ENSTTRP00000012947  ......................................CGER..........FPLAFFCMDTA.CVLIFTGEYLLRLF
ENSTTRP00000009306  ......................................SHTM..........FTDPFFVVEST.CIMWFTFELVLRFV
ENSTTRP00000015380  ......................................CGER..........YAVAFFCLDTA.CVMIFTVEYLLRLA
ENSTTRP00000012489  ......................................LQVLdaegnrv...EHPTLENVETA.CIGWFTLEYLLRLL
ENSTTRP00000004829  ......................................CGER..........YSVAFFCLDTA.CVMIFTVEYLLRLF
ENSTTRP00000015083  ......................................FQNEdgev......DDPVLEGVEIA.CIAWFTVELAVRLV
ENSTTRP00000001235  ......................................REVE..........TEPILTYIEGV.CVLWFTLEFLVRIV
ENSTTRP00000012542  ......................................YEIE..........TDPALTYVEGV.CVVWFTFEFLVRIV
ENSTTRP00000006964  ......................................MQQQtgqgagsgn.PQPFLEHVEML.CMAFFTLEFLLRLA
ENSTTRP00000002262  ......................................VEVE..........TEPFLTYVEGV.CVVWFTFEFLMRIT
ENSTTRP00000004325  ......................................----..........-----------.-CIAWTMEYLLRFL
ENSTTRP00000007208  ......................................EGLR..........DDPVLRHLEYF.CIAWFSFEVSSRLL
ENSTTRP00000010081  ......................................QCSQ..........MCRNIFIVESV.CVGWFSLEFLLRLI
ENSTTRP00000013879  ......................................QSTS..........FTDPFFIVETL.CIIWFSFEFLVRFF
ENSTTRP00000012173  ......................................LRAEedkgecsq..KCYYIFIVETV.CVAWFSLEFCLRFV
ENSTTRP00000012038  ......................................YSAGp.........GREPSGIIEAI.CIGWFTAECIVRFI
ENSTTRP00000013799  ......................................--SW..........LDLQLLEILYV.CISWFTGEFVLRFL
ENSTTRP00000013153  ......................................REAE..........TEAFLTYIEGV.CVVWFTFEFLMRVV
ENSTTRP00000014995  ......................................HTKL..........ASSCLLILEFV.MIVVFGLEFIIRIW
ENSTTRP00000001573  ......................................LGDQdkpqradcgyTCSPLTTVDLI.VDIMFVVDIVINFR
ENSTTRP00000005694  ......................................LNDReeqkrrecgySCSPLNVVDLI.VDIMFIIDILINFR
ENSTTRP00000014511  ......................................KTKQ..........NNIAWLVLDSV.VDVIFLVDIVLNFH
ENSTTRP00000008933  ......................................ERKT..........IKVLLEYADKM.FTYIFVLEMLLKWV
ENSTTRP00000006619  ......................................QRRV..........IRTILEYADKV.FTYIFIMEMLLKWV
ENSTTRP00000012773  ......................................YETV..........SGDWLLLLETF.AIFIFGAEFALRIW
ENSTTRP00000000204  ......................................PHSA..........ERIFLTLSNYI.FTAVFLAEMTVKVV
ENSTTRP00000013305  ......................................QKPT..........VKALLEYTDRV.FTFIFVFEMLLKWV
ENSTTRP00000000629  ......................................AGST..........ERIFLTVSNYI.FTAIFVGEMTLKVV
ENSTTRP00000013138  ......................................QSKQ..........MENILYWINLV.FVIFFTCECVLKMF
ENSTTRP00000010790  ......................................QRKT..........IKTMLEYADKV.FTYIFILEMLLKWV
ENSTTRP00000000364  ......................................PGST..........ERVFLSISNYI.FTAIFVAEMMVKVV
ENSTTRP00000005250  ......................................QSQE..........MTNILYWINLV.FIVLFTGECVLKLI
ENSTTRP00000004176  ......................................X---..........-----------.XXXXXXXXXLLRSL
ENSTTRP00000000364  ......................................QPDE..........LTNALEISNIV.FTSMFALEMLLKLL
ENSTTRP00000010790  ......................................QSEY..........VTSILSRINLV.FIVLFTGECVLKLI
ENSTTRP00000000629  ......................................QPEE..........LTNILEICNVV.FTSMFALEMLLKLA
ENSTTRP00000003584  ......................................QSAY..........MTEVLYWINVV.FVILFTGECVLKLI
ENSTTRP00000000204  ......................................QPEE..........LTNALEISNIV.FTSLFALEMLLKLL
ENSTTRP00000006619  ......................................QSQL..........KVDILYNVNMV.FIIIFTGECMLKML
ENSTTRP00000014856  ......................................FKDE..........NTTPWIVFNVV.SDTFFLIDLVLNFR
ENSTTRP00000008933  ......................................QSPE..........KVNILAKINLL.FVAIFTGECIVKMA
ENSTTRP00000005715  ......................................LQSE..........HLMLWLVLDYS.ADFLYGFDVLVRAR
ENSTTRP00000016088  ......................................EDDSnt........ANHNLEQVEYV.FLVIFTVETVLKIV
ENSTTRP00000011516  ......................................FTEQ..........TTTPWIIFNVA.SDTVFLLDLIMNFR
ENSTTRP00000008973  ......................................FKEE..........NSPPWIVFNVL.SDTFFLMDLVLNFR
ENSTTRP00000001468  ......................................QSKY..........MTLVLSRINLV.FIILFTGEFVLKLI
ENSTTRP00000013323  ......................................TQPK..........IQKILNCTDSI.FTYIFILEMGLKWV
ENSTTRP00000002836  ......................................QSCL..........FKIAMNILNML.FTGLFTVEMILKLI
ENSTTRP00000003584  ......................................KKKT..........IKIILEYADKI.FTYIFILEMLLKWI
ENSTTRP00000001468  ......................................QRKT..........IKTMLEYADKA.FTYIFILEMLPQXX
ENSTTRP00000000204  ......................................CDSQ..........RCRILQAFDDF.IFAFFAVEMVVKMV
ENSTTRP00000000364  ......................................CRSE..........RCSILEAFDDF.IFAFFAVEMVIKMI
ENSTTRP00000013136  ......................................QPQR..........LTTALYFAEFV.FLGLFLTEMSLKMY
ENSTTRP00000011356  ......................................ASVA..........YENALRVFNIV.FTSLFSLECVLKVM
ENSTTRP00000008021  ......................................DDLS..........TTRSTTVSDIA.VEILFIIDIILNFR
ENSTTRP00000013018  ......................................QPLW..........LTHLQDIANRV.LLALFTVEMLMKMY
ENSTTRP00000011356  ......................................DDDKtp........MSERLDDTEPY.FIGIFCFEAGIKII
ENSTTRP00000003295  ......................................APCT..........YELALKYLNIA.FTMVFSLECVLKII
ENSTTRP00000005250  ......................................MTEQ..........FSSVLSVGNLV.FTGIFTAEMFLKII
ENSTTRP00000001723  ......................................----..........-----------.--------------
ENSTTRP00000013323  ......................................QSRA..........MELFLERLNLA.FVAVFTTECLIKIF
ENSTTRP00000013138  ......................................MTPQ..........FEHVLTVGNLV.FTGIFTAEMFLKLI
ENSTTRP00000000629  ......................................QPTS..........LETALKYCNYM.FTTVFVLEAVLKLV
ENSTTRP00000013018  ......................................QSEQ..........MDHISDILNVA.FTTIFTVEMVLKLM
ENSTTRP00000000204  ......................................QPQI..........LDEALKICNYI.FTVIFVLESVFKLV
ENSTTRP00000003584  ......................................---N..........PPDWTKNVEYT.FTGIYTFESLVKIL
ENSTTRP00000001827  ......................................TDPFgscss.....YQDKTIPIDLT.FNAFFSFYFGLRFL
ENSTTRP00000003295  ......................................DDKTp.........MSRRLEKTEPY.FIGIFCFEAGIKIV
ENSTTRP00000011644  ......................................QPDW..........LTQIQDIANKV.LLALFTCEMLVKMY
ENSTTRP00000015837  ......................................LQKD..........YCIVWLVLDYF.SDVVYIADLFIRLR
ENSTTRP00000010790  ......................................MTDH..........FNNVLTVGNLV.FTGIFTAEMFLKII
ENSTTRP00000000781  ......................................----..........-----------.--------------
ENSTTRP00000001468  ......................................MTGQ..........FSSVLTVGNLV.FTGIFTAEMVLKII
ENSTTRP00000013136  ......................................GDKTp.........MSERMDDTEPY.FIGIFCLEAGMKIV
ENSTTRP00000011644  ......................................QSKM..........FNDAMDILNMV.FTGVFTVEMVLKVI
ENSTTRP00000012570  ......................................----..........-----------.--------------
ENSTTRP00000006619  ......................................MTEQ..........FDRVLNVGNLV.FTGIFTAEMVLKLI
ENSTTRP00000001468  ......................................---N..........PPDWTKNVEYT.FTGIYTFESLIKIL
ENSTTRP00000002836  ......................................----..........------RVEYL.FLIIFTVEAFLKVV
ENSTTRP00000012822  ......................................----..........-----------.--------------
ENSTTRP00000002689  ......................................QSLG..........ERMNTFVRY--.--------------
ENSTTRP00000013138  ......................................----..........--EWSKNVEYT.FTGIYTFESLVKII
ENSTTRP00000010790  ......................................---N..........PPDWTKNVEYT.FTGIYTFESLIKII
ENSTTRP00000006356  ......................................LQRY..........YLVAWLVLDCT.SDLLYLLDIVVRFH
ENSTTRP00000005250  ......................................---N..........PPDWTKNVEYT.FTGIYTFESLIKIL
ENSTTRP00000011644  ......................................SHSF..........RNTILGYFDYA.FTAIFTVEILLKMT
ENSTTRP00000013138  ......................................QRKT..........IRTILEYADKV.FTYIFILEMLLKWI
ENSTTRP00000013305  ......................................----..........-----ERMEYV.FTVIYTFEALIKIL
ENSTTRP00000016088  ......................................AHSF..........RNHILGYFDYA.FTSIFTVEILLKMT
ENSTTRP00000006619  ......................................----..........--SWSKHVEYT.FTGIYTFESLIKIL
ENSTTRP00000002836  ......................................QPHW..........LTEVQDTANKA.LLALFTAEMLLKMY
ENSTTRP00000013323  ......................................--DS..........INIDTESAEYV.FTGIYIFEALVKIL
ENSTTRP00000003295  ......................................QPQW..........LTHLLYYAEFL.FLGLFLLEMSLKMY
ENSTTRP00000013305  ......................................MSPA..........FEAMLQIGNIV.FTVFFTAEMVFKII
ENSTTRP00000010733  ......................................FKDE..........TTAPWIVFNVV.SDTFFLMDLVLNFR
ENSTTRP00000003584  ......................................MTD-..........EFKNVLTVGNL.FTGIFAAEMVLKLI
ENSTTRP00000013136  ......................................APYE..........YELMLKCLNIV.FTSMFSMECALKII
ENSTTRP00000006224  ......................................----..........-----------.--------------
ENSTTRP00000002836  ......................................----..........--XILFYFDIV.FTTIFTIEIALKMT
ENSTTRP00000009920  ......................................----..........-----------.--------------
ENSTTRP00000013018  ......................................EDDSsa........LNLGLEKXXXX.XXXXXXXEATMKII
ENSTTRP00000002368  ......................................----..........-----------.--------------
ENSTTRP00000011644  ......................................EDDSns........TNHNLEKVEYA.FLIIFTVETFLKII
ENSTTRP00000000825  ......................................----..........-----------.--------------
ENSTTRP00000011711  ......................................----..........-----------.--------------
ENSTTRP00000005250  ......................................QRKT..........IKTMLEYADKV.FTYIFILEMLLKWV
ENSTTRP00000013305  ......................................----..........-----------.-------ECVMKMF
ENSTTRP00000003295  ......................................----..........--XVLRYFDYV.FTGVFTFEMVIKMI
ENSTTRP00000002153  ......................................QTPN..........NARYWLITDII.CDAIYLFDLLLIQP
ENSTTRP00000000364  ......................................----..........--EALKYCNYV.FTIVFVFEALLKLV
ENSTTRP00000016088  ......................................QTAP..........FNYVMDILNMV.FTGLFTVEMVLKII
ENSTTRP00000006664  ......................................----..........-----------.--------------
ENSTTRP00000002958  ......................................----..........-----------.--------------
ENSTTRP00000008624  ......................................----..........-----------.--------------
ENSTTRP00000009742  ......................................----..........-----------.--------------
ENSTTRP00000000400  ......................................----..........-----------.--------------
ENSTTRP00000000399  ......................................----..........-----------.--------------
ENSTTRP00000011701  ......................................----..........-----------.--------------
ENSTTRP00000012365  ......................................TAVV..........QRVTIHVT---.--------------
ENSTTRP00000001716  ......................................----..........-----------.--------------
ENSTTRP00000003616  ......................................QRKT..........IKILLEYGDMI.FTYIFILEMLLKWM
ENSTTRP00000005061  ......................................----..........-----------.--------------
ENSTTRP00000009742  ......................................----..........-----------.--------------
ENSTTRP00000008624  ......................................----..........-----------.--------------
ENSTTRP00000003072  ......................................----..........-----------.--------------
ENSTTRP00000009040  ......................................----..........-----------.--------------
ENSTTRP00000005008  ......................................----..........-----------.--------------
ENSTTRP00000013018  ......................................TESV..........RNQILGYFDIV.FTSVFTVEIVLKXX
ENSTTRP00000014295  ......................................----..........-----------.--------------
ENSTTRP00000007445  ......................................----..........-----------.--------------
ENSTTRP00000000398  ......................................----..........-----------.--------------
ENSTTRP00000000398  ......................................----..........-----------.--------------
ENSTTRP00000003616  ......................................MSLE..........MNNILNIENQV.FIGIFTAEMIFKII
ENSTTRP00000009762  ......................................----..........-----------.--------------
ENSTTRP00000000629  ....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxmveYSLD..........L----------.--------------
ENSTTRP00000003616  ......................................QNPK..........IDIAVYWINSV.FVTLYTGECVLKLI
ENSTTRP00000003528  ......................................----..........-----------.--------------
ENSTTRP00000002957  ......................................----..........-----------.--------------
ENSTTRP00000012888  ......................................----..........-----------.--------------
ENSTTRP00000009192  ......................................----..........-----------.--------------
ENSTTRP00000004010  ......................................----..........-----------.--------------
ENSTTRP00000009192  ......................................----..........-----------.--------------
ENSTTRP00000001715  ......................................----..........-----------.--------------
ENSTTRP00000014553  ......................................----..........-----------.--------------
ENSTTRP00000006420  ......................................TFRR..........QYDEFYLAEVA.FTVLFDLEALLKIW
ENSTTRP00000000399  ......................................----..........-----------.--------------
ENSTTRP00000000400  ......................................----..........-----------.--------------
ENSTTRP00000004010  ......................................----..........-----------.--------------
ENSTTRP00000011356  ......................................PNAP..........RNNVLRYFDYV.FTGVFTFEMVIKMI
ENSTTRP00000011356  ......................................QPEW..........LSDFLYYAEFI.FLGLFMSEMFIKMY
ENSTTRP00000006319  ......................................DDDDtpi.......TSRHTLVSDIA.VEMLFILDIILNFR
ENSTTRP00000003616  ......................................----..........--KWGPALQNT.LLGIYTFEILVKLI
ENSTTRP00000010014  ......................................----..........-----------.--------------
ENSTTRP00000004968  ......................................----..........-----------.--------------
ENSTTRP00000008933  ...........xxxxxxxxxxxxxxxxxxxxxxyttefVD--..........-----------.--------------
ENSTTRP00000002091  ......................................IDSSnpiescqnf.YKDFTLQIDMA.FNVFFLLYFGLRFI
ENSTTRP00000004968  ......................................----..........-----------.--------------
ENSTTRP00000007963  ......................................QMDI..........HFLLVDYCDFIyFLDITVFQLRLQFV
ENSTTRP00000012888  ......................................----..........-----------.--------------
ENSTTRP00000010014  ......................................HQEI..........ANECLLILEFV.MIVVFGLEYIIRIW
ENSTTRP00000006420  ......................................FEHYpp........LQYVTFTLDTL.LMFLYTAEMIAKMH
ENSTTRP00000013323  ......................................MDQS..........FENMLYTGNLV.FTGIFMAEMCLKII
ENSTTRP00000000582  ..................................xxxxX---..........-----------.--------------
ENSTTRP00000006420  ...............xxxxxxxxxxxxxxxxxxxxxxxX---..........-----------.--------------
ENSTTRP00000002134  ......................................----..........-----------.--------------
ENSTTRP00000013136  ......................................TDSP..........RNNVLKYMDYI.FTGVFTFEMVIKXI
ENSTTRP00000016088  ......................................QPIW..........LTQIQEYANKV.LLCLFTVEMLLKLY
ENSTTRP00000000047  ......................................----..........-----------.--------------
ENSTTRP00000009762  ......................................----..........-----------.--------------
ENSTTRP00000010378  ......................................----..........-----------.--------------
ENSTTRP00000004338  ......................................KGGNf.........FSKHVPWSYLV.FLTIYGVELFLKVA
ENSTTRP00000007759  ......................................LNDI..........YELELAYANYS.FLAFYITEALLKIA
ENSTTRP00000006420  ......................................----..........-----------.--FIFVLEVTMKII
ENSTTRP00000011228  ......................................AHVLpkdr......DDFVLGIVSCV.IIRYYLLEMLLKVA
ENSTTRP00000016320  ......................................----..........-----------.--------------
ENSTTRP00000014317  ......................................KNNY..........AARVFHYMSIA.ILTFFMMEIFFKIF
ENSTTRP00000011228  ......................................TSDVryrpapwep.PCGLTEGVEAL.CLLVFVADVSVKSY
ENSTTRP00000004338  ......................................----..........------TLELF.ALMVVVFELCMKLR
ENSTTRP00000014427  ......................................----..........-----EIIFCF.FILYYVVEEILEIR
ENSTTRP00000005277  ......................................----..........-----------.--------------
ENSTTRP00000001972  ......................................----..........-----------.--------------
ENSTTRP00000008933  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxX---..........-----------.--------------
ENSTTRP00000002589  ......................................----..........-----------.--------------
ENSTTRP00000011285  ......................................----..........-------IFCI.FIFYYVVEESLELH
ENSTTRP00000011701  ......................................----..........-----------.--------------
ENSTTRP00000005251  ......................................----..........-----------.--------------
ENSTTRP00000006684  ......................................----..........-----------.--------------


                                                               70            80        90           
                                                                |             |         |           
d1orqc_               KS.........................GDP.........AGYVK..K..TLYEIPALVPAGLLALIE...........
ENSTTRP00000010419  AC.........................PSK.........TDFFK..NimNFIDIVAIIPYFITLGTEiaeqegnqkge
ENSTTRP00000004039  SS.........................PKK.........WKFFKg.Pl.NAIDLLAILPYYVTIFLTesnksvlqfq.
ENSTTRP00000006570  AC.........................PSQ.........ALFFK..NimNIIDIVSILPYFITLGTDlaqqqgggng.
ENSTTRP00000006832  AC.........................PSK.........PAFFR..NimNIIDLVAIFPYFITLGTElvqqqgqqsas
ENSTTRP00000012947  AA.........................PSR.........CRFLR..SvmSLIDVVAILPYYIGLLVPkne........
ENSTTRP00000009306  VC.........................PSK.........TDFFR..NiiNIIDIISIIPYFATLITElvqetepstq.
ENSTTRP00000015380  AA.........................PSR.........YRFVR..SvmSIIDVVAILPYYIGLVMTdne........
ENSTTRP00000012489  SS.........................PNK.........LHFAL..SfmNIVDVLAILPFYVSLTLThlgarmmelt.
ENSTTRP00000004829  AA.........................PSR.........YRFIR..SvmSIIDVVAIMPYYIGLVMTnne........
ENSTTRP00000015083  AA.........................PCQ.........KKFWKn.Pl.NIIDFISIIPFYATLAVDtkkeesedie.
ENSTTRP00000001235  CC.........................PDT.........LDFVK..NllNIIDFVAILPFYLEVGLSglsskaar...
ENSTTRP00000012542  FS.........................PNK.........LEFIK..NllNIIDFVAILPFYLEVGLSglsskaak...
ENSTTRP00000006964  ST.........................PDL.........RRFAQ..SalNLVDLVAILPLYLQLLLEcftsedhehdl
ENSTTRP00000002262  FC.........................PDK.........VEFLK..SslNIIDCVAILPFYLEVGLSglsskaak...
ENSTTRP00000004325  SS.........................PNK.........WKFFKg.Pl.NVIDLLAILPYYVTIFLTesnksvlqfq.
ENSTTRP00000007208  LA.........................PST.........RNFFCh.Pl.NLIDIVSVLPFYLTLLAGvalqdrggagg
ENSTTRP00000010081  QA.........................PSK.........FAFLR..SplTLIDMVAILPYYITLLVDgaaadrrkpgt
ENSTTRP00000013879  AC.........................PSK.........AGFFT..NimNIIDIVAIIPYFITLGTElaekpedaqq.
ENSTTRP00000012173  QA.........................QNK.........CQFFQg.Pl.NIIDILAISPYYVSLAVSdepqgdgerps
ENSTTRP00000012038  VS.........................KNK.........CEFVKr.Pl.NIIDLLAITPYYISVLMTvftgensqlq.
ENSTTRP00000013799  CV.........................RDR.........CRFLR..KvpNIIDLLAILPFYITLLVEslssqttqel.
ENSTTRP00000013153  FC.........................PNK.........VEFIKn.Sl.NIIDFVAILPFYLEVGLSglsskaak...
ENSTTRP00000014995  SA.........................GCCcryrgwqgrLRFARk.Pf.CVIDTIVLIASIAVVSAK...........
ENSTTRP00000001573  TTyvnandevvshpr............RIA.........VHYFKg.W..FLIDMVAAIPFDLLIFRTgsd........
ENSTTRP00000005694  TTyvnqneevvsdpa............KIA.........IHYFKg.W..FLIDMVAAIPFDLLIFGSgsd........
ENSTTRP00000014511  TTfvgpggevisdpk............LIR.........MNYLKt.W..FVIDLLSCLPYDIINAFE...........
ENSTTRP00000008933  AY.........................GFK.........KYFTNa.W..CWLDFLIVGVSLISLVAN...........
ENSTTRP00000006619  AY.........................GFK.........VYFTNa.W..CWLDFLIVDVSIISLVANwlgy.......
ENSTTRP00000012773  AAgcccrykgw................RGR.........LKFARk.Pl.CMLDIFVLIASVPVVAVG...........
ENSTTRP00000000204  AL.........................GWCfge......QAYLRssW..NVLDGLLVLISIIDILVSmvsdsgt....
ENSTTRP00000013305  AY.........................GFK.........SYFTNa.W..CWLDFLIVNISLTSLIAKvlqy.......
ENSTTRP00000000629  SL.........................GLYfge......QAYLRssW..NVLDGFLVFVSIIDIVVSlasagga....
ENSTTRP00000013138  AL.........................RHY.........YFTIG..W..NIFDFVVVILSIVGMFLAdiiekyf....
ENSTTRP00000010790  AY.........................GYQ.........TYFTNa.W..CWLDFLIVDVSLVSLTANalgy.......
ENSTTRP00000000364  AL.........................GLVsgeh.....AYLQSs.W..NILDGLLVLVSLVDIIVAmasagga....
ENSTTRP00000005250  SL.........................RYY.........YFTIG..W..NIFDFVVVILSIVGMFLAeliekyf....
ENSTTRP00000004176  QA.........................ESK.........CAFLRt.Pl.NIIDILAILPFYVSLLVGlaarpgaggnk
ENSTTRP00000000364  AF.........................GPL.........GYIRN..Py.NIFDGIIVVISVWEIIGQ...........
ENSTTRP00000010790  SL.........................RHY.........YFTIG..W..NIFDFVVVILSIVGMFLAeliekyf....
ENSTTRP00000000629  AF.........................GLF.........DYLRN..Py.NIFDSIIVIISIWEIVGQ...........
ENSTTRP00000003584  SL.........................RCY.........YFTVG..W..NIFDFVVVILSIVGMFLAdlieryf....
ENSTTRP00000000204  VY.........................GPF.........GYIKN..Py.NIFDGVIVVISVWEIVGQ...........
ENSTTRP00000006619  AL.........................RQY.........YFTIG..W..NIFDFVVVILSIVGLALSdliqkyf....
ENSTTRP00000014856  TGivvednteiildpq...........RIK.........MKYLKs.W..FVVDFISSIPVDYIFLIVetridsevy..
ENSTTRP00000008933  AL.........................RYY.........YFTNS..W..NIFDFVVVILYIVGTVLSdiiqkyf....
ENSTTRP00000005715  TGfleqgllvtdan.............RLW.........KHYTK..TlhFKLDMLSLVPTDLAYFK-...........
ENSTTRP00000016088  AY.........................GLVlhp......SAYIRngW..NLLDFIIVVVGLFSVLLEqgpgrpgdaph
ENSTTRP00000011516  TGtvnedsseiildpk...........VIK.........MNYLKs.W..FVVDFISSIPVDYIFLIV...........
ENSTTRP00000008973  TGivveegaeillapr...........AIR.........TRYLRt.W..FLVDLISSIPVDYIFLVVeleprldtevy
ENSTTRP00000001468  SL.........................RYY.........YFTIG..W..NIFDFVVVILSIVGMFLAeliekyf....
ENSTTRP00000013323  AF.........................GFR.........KYFTSa.W..CWLDFIIVIVSVTSLI--...........
ENSTTRP00000002836  AF.........................KPK.........HYFCDa.W..NTFDALIVVGSIVDIAITevnpaehtqcs
ENSTTRP00000003584  AY.........................GYK.........TYFTNa.W..CWLDFLIVDVSLVTLVANtlgy.......
ENSTTRP00000001468  AY.........................GFQ.........TYFTNa.W..CWLDFLIVDVSLVSLVANalgy.......
ENSTTRP00000000204  ALgif......................GKK.........CYLGDt.W..NRLDFFIVIAGMLEYSLD...........
ENSTTRP00000000364  ALglf......................GQK.........CYLGDt.W..NRLDFFIVMAGXXXSYSLd..........
ENSTTRP00000013136  GL.........................GPR.........SYFRS..Sf.NCFDFGVIVGSIFEVVWAaikp.......
ENSTTRP00000011356  AF.........................GIL.........NYFRDa.W..NIFDFVTVLGSITDILVTefg........
ENSTTRP00000008021  TTyvsksgqvifear............SIC.........IHYVTt.W..FIIDLIAALPFDLLYAFNv..........
ENSTTRP00000013018  GL.........................GLR.........QYFMSi.F..NRFDCFVVCSGLLEILLV...........
ENSTTRP00000011356  AL.........................GFAfhk......GSYLRngW..NVMDFVVVLTGILATVGT...........
ENSTTRP00000003295  AF.........................GFL.........NYFRDt.W..NIFDFITVIGSITEIILTdsklvn.....
ENSTTRP00000005250  AM.........................DPY.........YYFQEg.W..NIFDGLIVSLSLMELGLA...........
ENSTTRP00000001723  --.........................---.........-----..-..------------------...........
ENSTTRP00000013323  AL.........................RQY.........YFTSG..W..NLFDCVIVVISIVSTIVSalktqahip..
ENSTTRP00000013138  AM.........................DPY.........YYFQEg.W..NIFDGFIVSLSLMELSLA...........
ENSTTRP00000000629  AF.........................GLR.........RFFKDr.W..NQLDLAIVLLSVMGITLE...........
ENSTTRP00000013018  AF.........................KAR.........GYFGDp.W..NVFDFLIVIGSIIDVILS...........
ENSTTRP00000000204  AF.........................GFR.........RFFQDr.W..NQLDLAIVLLSIMGITLEeievna.....
ENSTTRP00000003584  AR.........................GFCvge......FTFLRdpW..NWLDFIVIVFAYVTEFV-...........
ENSTTRP00000001827  AA.........................DDK.........VKFWLemN..SIVDIFTIPPTFISYYLK...........
ENSTTRP00000003295  AL.........................GFIfhk......GSYLRngW..NVMDFIVVLSGILATAGThf.........
ENSTTRP00000011644  SL.........................GLQ.........AYFVS..Lf.NRFDCFVVCGGITETILV...........
ENSTTRP00000015837  TGfleqgllvkdtk.............MLR.........DNYIH..TlqFKLDVASIIPTDLIYFP-...........
ENSTTRP00000010790  AM.........................DPY.........YYFQEg.W..NIFDGFIVTLSLVELGLA...........
ENSTTRP00000000781  --.........................---.........-----..-..------------------...........
ENSTTRP00000001468  AM.........................DPY.........YYFQEg.W..NIFDGIIVSLSLMELGLA...........
ENSTTRP00000013136  AL.........................GFVlhk......GSYLRngW..NVMDFVVVLTGILATAG-...........
ENSTTRP00000011644  AF.........................KPK.........GYFSDa.W..NTFDSLIVIGSIVDVALSeadptesenvp
ENSTTRP00000012570  --.........................---.........-----..-..------------------...........
ENSTTRP00000006619  AM.........................DPY.........EYFQQg.W..NIFDSIIVTLSLVELGLA...........
ENSTTRP00000001468  AR.........................GFCled......FTFLRdpW..NWLDFSVIVMAYVTEFV-...........
ENSTTRP00000002836  AY.........................GLLfhp......NAYLRngW..NLLDFIIVVVGLFSAILEqatkadganal
ENSTTRP00000012822  --.........................---.........-----..-..------------------...........
ENSTTRP00000002689  --.........................---.........-----..-..------------------...........
ENSTTRP00000013138  AR.........................GFCidg......FTFLRdpW..NWLDFSVIMMAYITEFV-...........
ENSTTRP00000010790  AR.........................GFCled......FTFLRdpW..NWLDFTVITFAYVTEFV-...........
ENSTTRP00000006356  TGfleqgilvvdg..............RIS.........SRYVRt.Ws.FFLDLASLLPTEVAYVSL...........
ENSTTRP00000005250  AR.........................GFCled......FTFLRdpW..NWLDFTVITFAYVTEFV-...........
ENSTTRP00000011644  TFgaf......................LHK.........GAFCR..NyfNLLDMLVVGVSLVSFGIQ...........
ENSTTRP00000013138  AY.........................GFV.........KFFTNa.W..CWLDFLIVAVSLVSLIANalgy.......
ENSTTRP00000013305  AR.........................GFClne......FTYLRdpW..NWLDFSVITLAYVGEAI-...........
ENSTTRP00000016088  VFgaf......................LHR.........GSFCRs.Wf.NLLDLLVVSVSLISFGIH...........
ENSTTRP00000006619  AR.........................GFCied......FTFLRdpW..NWLDFSVIMMAYLTEFV-...........
ENSTTRP00000002836  SL.........................GLQ.........AYFVS..Lf.NRFDCFIVCGGILETILV...........
ENSTTRP00000013323  AR.........................GFIlde......FSFLRdpW..NWLDSIVIATAFVSYSPYik.........
ENSTTRP00000003295  GM.........................GPR.........LYFHS..Sf.NCFDFGVTVGSIFEVVWAifrp.......
ENSTTRP00000013305  AF.........................DPY.........YYFQKk.W..NIFDCIIVTVSLIELGAV...........
ENSTTRP00000010733  TGiviednteiildpe...........KIK.........KKYLRt.W..FVVDFVSSIPVDYIFLIV...........
ENSTTRP00000003584  AM.........................DPY.........EYFQVr.W..NIFDSLIVTLSLVELFLA...........
ENSTTRP00000013136  AF.........................GVL.........NYFRDa.W..NVFDFVTVLGSITDVLVTeiagt......
ENSTTRP00000006224  --.........................---.........-----..-..------------------...........
ENSTTRP00000002836  AYgaf......................LHK.........GSFCR..NyfNILDLLVVSVSLISFGIQ...........
ENSTTRP00000009920  --.........................---.........-----..-..------------------...........
ENSTTRP00000013018  AY.........................GFLfhp......DAYLRsgW..NVLDFIIVFLGVFTVILEqvnviqtntap
ENSTTRP00000002368  --.........................---.........-----..-..------------------...........
ENSTTRP00000011644  AY.........................GLLlhp......NAYVRngW..NLLDFVIVIVGLFSVILEqltketeggnh
ENSTTRP00000000825  --.........................---.........-----..-..------------------...........
ENSTTRP00000011711  --.........................---.........-----..-..------------------...........
ENSTTRP00000005250  AY.........................GFQ.........VYFTNa.W..CWLDFLIVDVSLVSLTANalgy.......
ENSTTRP00000013305  AL.........................RHY.........YFTNG..W..NVFDLIVVVLSIGSLVFSailtslgnl..
ENSTTRP00000003295  DQ.........................GLIlqd......GSYFRdlW..NILDFVVVVGALVAFALA...........
ENSTTRP00000002153  RLqfirrgdiivdsn............ELK.........RHYWS..StkFQLDVASIMPFDVFYLF-...........
ENSTTRP00000000364  AF.........................GFR.........RFFKDr.W..NQLDLAIVLLSIMGITLEeiemna.....
ENSTTRP00000016088  AF.........................KPK.........HYFTDa.W..NTFDALIVVGSVVDIAVTevnng......
ENSTTRP00000006664  --.........................---.........-----..-..------------------...........
ENSTTRP00000002958  --.........................---.........-----..-..------------------...........
ENSTTRP00000008624  --.........................---.........-----..-..------------------...........
ENSTTRP00000009742  --.........................---.........-----..-..------------------...........
ENSTTRP00000000400  --.........................---.........-----..-..------------------...........
ENSTTRP00000000399  --.........................---.........-----..-..------------------...........
ENSTTRP00000011701  --.........................---.........-----..-..------------------...........
ENSTTRP00000012365  --.........................---.........-----..-..------------------...........
ENSTTRP00000001716  --.........................---.........-----..-..------------------...........
ENSTTRP00000003616  AY.........................GFK.........AYFTNg.W..YQLDFMVVIVFCLSLIGK...........
ENSTTRP00000005061  --.........................---.........-----..-..------------------...........
ENSTTRP00000009742  --.........................---.........-----..-..------------------...........
ENSTTRP00000008624  --.........................---.........-----..-..------------------...........
ENSTTRP00000003072  --.........................---.........-----..-..----------------YF...........
ENSTTRP00000009040  --.........................---.........-----..-..------------------...........
ENSTTRP00000005008  --.........................---.........-----..-..------------------...........
ENSTTRP00000013018  XXxxxxxxxxxxxxxxxxxxxxxxxxxX--.........-----..-..-----------------Xxxxxxs.....
ENSTTRP00000014295  --.........................---.........-----..-..------------------...........
ENSTTRP00000007445  --.........................---.........-----..-..------------------...........
ENSTTRP00000000398  --.........................---.........-----..-..------------------...........
ENSTTRP00000000398  --.........................---.........-----..-..------------------...........
ENSTTRP00000003616  TM.........................HPY.........GYFQVg.W..NIYDSLIVFHGLVELYVT...........
ENSTTRP00000009762  --.........................---.........-----..-..------------------...........
ENSTTRP00000000629  --.........................---.........-----..-..------------------...........
ENSTTRP00000003616  VF.........................RYN.........YFTNG..W..NLFDFMVVVFSMTGLFLPlmv........
ENSTTRP00000003528  --.........................---.........-----..-..------------------...........
ENSTTRP00000002957  --.........................---.........-----..-..------------------...........
ENSTTRP00000012888  --.........................---.........-----..-..------------------...........
ENSTTRP00000009192  --.........................---.........-----..-..------------------...........
ENSTTRP00000004010  --.........................---.........-----..-..------------------...........
ENSTTRP00000009192  --.........................---.........-----..-..------------------...........
ENSTTRP00000001715  --.........................---.........-----..-..------------------...........
ENSTTRP00000014553  --.........................---.........-----..-..------------------...........
ENSTTRP00000006420  CL.........................GFT.........GYISS..Sl.HKFELLLVIGTTLHVYP-...........
ENSTTRP00000000399  --.........................---.........-----..-..------------------...........
ENSTTRP00000000400  --.........................---.........-----..-..------------------...........
ENSTTRP00000004010  --.........................---.........-----..-..------------------...........
ENSTTRP00000011356  DL.........................GLVlhq......GAYFRdlW..NILDFIVVSGALVAFAFTgnskg......
ENSTTRP00000011356  GL.........................GTR.........PYFHS..Sf.NCFDCGXXXXXXXXXXXXxxxx.......
ENSTTRP00000006319  TTyvsqsgqvvsapr............SIG.........LHYLAt.W..FFVDLIAALPFDLLYVFNi..........
ENSTTRP00000003616  AR.........................GIWags......FYFFGdpW..NWLDFSVTLFEHISRYS-...........
ENSTTRP00000010014  --.........................---.........-----..-..------------------...........
ENSTTRP00000004968  --.........................---.........-----..-..------------------...........
ENSTTRP00000008933  --.........................---.........-----..-..------------------...........
ENSTTRP00000002091  AA.........................NDK.........LWFWLevN..SVVDFFTVPPVFVSVYLN...........
ENSTTRP00000004968  --.........................---.........-----..-..------------------...........
ENSTTRP00000007963  RGgdiitdkk.................EMR.........NNYLK..SqrFKMDMLCLLPLDFLYLK-...........
ENSTTRP00000012888  --.........................---.........-----..-..------------------...........
ENSTTRP00000010014  SA.........................GCCcryrgwqgrFRFARk.Pf.CVIDFIVFVASVAVIAAG...........
ENSTTRP00000006420  IR.........................GIVkgd......SSYVKdrW..CVFDGFMVFCLWVSLVLQvfeiadivdqm
ENSTTRP00000013323  AL.........................DPY.........HYFHGg.W..NIFDSIVALLSFAEVIIN...........
ENSTTRP00000000582  --.........................-XX.........XXXDG..W..NILNFLIIFILLLGFFVN...........
ENSTTRP00000006420  --.........................---.........-----..-..-------XXVSLIFLCWM...........
ENSTTRP00000002134  --.........................---.........-----..-..------------------...........
ENSTTRP00000013136  DL.........................GLLlhp......GAYFRdlW..NILDFVVVSGALVAFAFSxx.........
ENSTTRP00000016088  GL.........................GPS.........VYVSS..Ff.NRFDCFVVCGGILETTLV...........
ENSTTRP00000000047  --.........................---.........-----..-..------------------...........
ENSTTRP00000009762  --.........................---.........-----..-..------------------...........
ENSTTRP00000010378  --.........................---.........-----..-..------------------...........
ENSTTRP00000004338  GL.........................GPV.........EYLSSg.W..NLFDFFVTAFAFLGLLALa..........
ENSTTRP00000007759  AM.........................KKE.........YFLHA..W..NLFELTITLIGIIDVMLIetnsi......
ENSTTRP00000006420  AM.........................SPA.........GFWQS..Rr.NRYDLLVTSLGIVWVVLHfal........
ENSTTRP00000011228  L-.........................GLR.........GYLVSs.S..NVFDGLLTAVLLVLEISTlavyrfphpgw
ENSTTRP00000016320  --.........................---.........-----..-..------------------...........
ENSTTRP00000014317  VF.........................RLE.........FFHHK..F..EILDAIVVVVSFILDVVLlfre.......
ENSTTRP00000011228  LV.........................GWA.........QFRKNp.W..LLAYLVVLLVSLVDWTVS...........
ENSTTRP00000004338  WL.........................GLH.........TFIRHr.RtmVKTSVLVVQFVEAIVVLV...........
ENSTTRP00000014427  IH.........................KLH.........YFRSF..W..NCLDVVIIVLSVVAAGINihrtsnvevll
ENSTTRP00000005277  --.........................---.........-----..-..------------------...........
ENSTTRP00000001972  --.........................---.........-----..-..------------------...........
ENSTTRP00000008933  --.........................---.........-----..-..------------------...........
ENSTTRP00000002589  --.........................---.........-----..-..------------------...........
ENSTTRP00000011285  IH.........................WLR.........YLSSI..W..NILDLVVILLSIVDVGFHifrtlavnrlm
ENSTTRP00000011701  --.........................---.........-----..-..------------------...........
ENSTTRP00000005251  --.........................---.........-----..-..------------------...........
ENSTTRP00000006684  --.........................---.........-----..-..------------------...........


                                                                              100        110        
                                                                                |          |        
d1orqc_               ....................G...HLAG..........................LGLFRLVRLLRFLR.ILLIISRGS
ENSTTRP00000010419  ..................qaT...SLAI..........................LRVIRLVRVFRIFK.LSRHSKGLQ
ENSTTRP00000004039  ....................N...VRRV..........................VQIFRIMRILRILK.LARHSTGLQ
ENSTTRP00000006570  ....................Q...---Qqqamsfai..................LRIIRLVRVFRIFK.LSRHSKGLQ
ENSTTRP00000006832  ................ggggQ...---Ngqqamslai.................LRVIRLVRVFRIFK.LSRHSKGLQ
ENSTTRP00000012947  ....................D...VSGA..........................FVTLRVFRVFRIFK.FSRHSQGLR
ENSTTRP00000009306  ....................Q...---Nmslai.....................LRVIRLVRVFRIFK.LSRHSKGLQ
ENSTTRP00000015380  ....................D...VSGA..........................FVTLRVFRVFRIFK.FSRHSQGLR
ENSTTRP00000012489  ....................N...VQQA..........................VQALRIMRIARIFK.LARHSSGLQ
ENSTTRP00000004829  ....................D...VSGA..........................FVTLRVFRVFRIFK.FSRHSQGLR
ENSTTRP00000015083  ....................N...MGKV..........................VQILRLMRIFRILK.LARHSVGLR
ENSTTRP00000001235  ....................D...VLGF..........................LRVVRFVRILRIFK.LTRHFVGLR
ENSTTRP00000012542  ....................D...VLGF..........................LRVVRFVRILRIFK.LTRHFVGLR
ENSTTRP00000006964  .............etmgrvgQ...VGQV..........................LRVMRLLRIFRILK.LARHSTGLR
ENSTTRP00000002262  ....................D...VLGF..........................LRVVRFVRILRIFK.LTRHFVGLR
ENSTTRP00000004325  ....................N...VRRV..........................VQIFRIMRILRILK.LARHSTGLQ
ENSTTRP00000007208  ................eelgD...LGKV..........................VQVFRLMRIFRVLK.LARHSTGLR
ENSTTRP00000010081  ..............gnsyldK...VGLV..........................LRVLRALRILYVMR.LARHSLGLQ
ENSTTRP00000013879  ....................G...---Qqamslai...................LRVIRLVRVFRIFK.LSRHSKGLQ
ENSTTRP00000012173  ..............rssyveK...VGLA..........................LRVLRALRILYVMR.LARHSLGLQ
ENSTTRP00000012038  ....................R...AGVT..........................LRVLRMMRIFWVIK.LARHFIGLQ
ENSTTRP00000013799  ....................E...N---..........................VGRIVQVLLPRALRmLKLHSTGLR
ENSTTRP00000013153  ....................D...VLGF..........................LRVVRFVXXXXXXX.XXXXXXXXX
ENSTTRP00000014995  ....................T...QGNIfatsa.....................LRSLRFLQILRMVR.MDRRGGTWK
ENSTTRP00000001573  ....................E...TTTL..........................IGLLKTARLLRLVR.VARKLDRYS
ENSTTRP00000005694  ....................E...TTTL..........................IGLLKTARLLRLVR.VARKLDRYS
ENSTTRP00000014511  ....................N...VDEGissl......................FSSLKVVRLLRLGR.VARKLDHYL
ENSTTRP00000008933  ....................A...LGFAemgp......................IKSLRTLRALRPLR.ALSRFEGMR
ENSTTRP00000006619  ....................S...ELGP..........................IKSLRTLRALRPLR.ALSRFEGMR
ENSTTRP00000012773  ....................N...QGNVlats......................LRSLRFLQILRMLR.MDRRGGTWK
ENSTTRP00000000204  ....................K...ILGM..........................LRVLRLLRTLRPLR.VISRAQGLK
ENSTTRP00000013305  ....................S...DMAS..........................IKALRTLRALRPLR.ALSRFEGMR
ENSTTRP00000000629  ....................K...ILGV..........................LRVLRLLRTLRPLR.VISRAPGLK
ENSTTRP00000013138  ....................V...SPTL..........................FRVIRLARIGRILR.LIKGAKGIR
ENSTTRP00000010790  ....................S...ELGA..........................IKSLRTLRALRPLR.ALSRFEGMR
ENSTTRP00000000364  ....................K...ILGI..........................LRVLRLLRTLRPLR.VISRAPGLK
ENSTTRP00000005250  ....................V...SPTL..........................FRVIRLARIGRILR.LIKGAKGIR
ENSTTRP00000004176  .................lleR...AGLV..........................LRLLRALRVLYVMR.LARHSLGLR
ENSTTRP00000000364  ....................A...D-GG..........................LSVLRTFRLLRVLK.LVRFMPALR
ENSTTRP00000010790  ....................V...SPTL..........................FRVIRLARIGRILR.LIKGAKGIR
ENSTTRP00000000629  ....................A...D-GG..........................LSVLRTFRLLRVLK.LVRFMPALR
ENSTTRP00000003584  ....................V...SPTL..........................FRVIRLARIGRILR.LIKGAKGIR
ENSTTRP00000000204  ....................-...QGGG..........................LSVLRTFRLMRVLK.LVRFLPALQ
ENSTTRP00000006619  ....................V...SPTL..........................FRVIRLARIGRVLR.LIRGAKGIR
ENSTTRP00000014856  ....................K...---Taralrivrf.................TKILSLLRLLRLSR.LIRYIHQWE
ENSTTRP00000008933  ....................F...SPTL..........................FRVIRLARIGRILR.LIRGAKGIR
ENSTTRP00000005715  ....................-...LGMN..........................YPELRFNRLLKLAR.LFEFFDRTE
ENSTTRP00000016088  ................tggkP...GGFD..........................VKALRAFRVLRPLR.LVSGVPSLH
ENSTTRP00000011516  ....................E...KGMDsevyktaralrivrf...........TKILSLLRLLRLSR.LIRYIHQWE
ENSTTRP00000008973  ....................K...---Taralrivrf.................TKILSLLRLLRLSR.LIRYIHQWE
ENSTTRP00000001468  ....................V...SPTL..........................FRVIRLARIGRILR.LIKGAKGIR
ENSTTRP00000013323  ....................-...DLKV..........................LKSFRILRALRPLR.ALSQFEGMK
ENSTTRP00000002836  .............pfmnaeeN...SRIS..........................ITFFRLFRVMRLVK.LLSRGEGIR
ENSTTRP00000003584  ....................S...DLGP..........................IKSLRTLRALRPLR.ALSRFEGMR
ENSTTRP00000001468  ....................S...ELGA..........................IKSLRTLRALRPLR.ALSRFEGMR
ENSTTRP00000000204  ....................L...QNVS..........................FSAVRTVRVLRPLR.AINRVPSMR
ENSTTRP00000000364  ....................G...HNVS..........................LSAIRTVLVLRPLR.AINRVPSMR
ENSTTRP00000013136  ....................G...TSFG..........................ISVLRALRLLRIFK.VTKYWSSLR
ENSTTRP00000011356  ....................N...NFIN..........................LSFLRLFRAARLIK.LLRQGYTIR
ENSTTRP00000008021  ....................T...VVSL..........................VHLLKTVRLLRLLR.LLQKLDRYS
ENSTTRP00000013018  ....................E...SGAMtplg......................ISVLRCIRLLRIFK.ITKYWTSLS
ENSTTRP00000011356  ....................E...FD--..........................LRTLRAVRVLRPLK.LVSGIPSLQ
ENSTTRP00000003295  ....................T...SGFN..........................MSFLKLFRAARLIK.LLRQGYTIR
ENSTTRP00000005250  ....................N...VEG-..........................LSVLRSFRLLRVFK.LAKSWPTLN
ENSTTRP00000001723  ....................-...----..........................---LRFLQILRMIR.MDRRGGTWK
ENSTTRP00000013323  ....................F...PPTF..........................FRIVRLARIGRILR.LVQAARGIR
ENSTTRP00000013138  ....................D...VEG-..........................LSVLRSFRLLRVFK.LAKSWPTLN
ENSTTRP00000000629  ....................E...IEINaalpinpti.................IRIMRVLRIARVLK.LLKMATGMR
ENSTTRP00000013018  ....................E...IDTFlassgglyclggscgnvdpdesarisSAFFRLFRVLRLIK.LLSRAEGVR
ENSTTRP00000000204  ....................S...---Lpinpti....................IRIMRVLRIARVLK.LLKMAVGMR
ENSTTRP00000003584  ....................-...DLGN..........................VSALRTFRVLRALK.TISVIPGLK
ENSTTRP00000001827  ....................S...NWLG..........................LRFLRALRLLELPQ.ILQILRAIR
ENSTTRP00000003295  ....................N...THVD..........................LRTLRAVRVLRPLK.LVSGIPSLQ
ENSTTRP00000011644  ....................E...LEIMsplg......................ISVFRCVRLLRIFK.VTRHWTSLS
ENSTTRP00000015837  ....................-...VGIH..........................RPELRFNRLLHFAR.MFEFFDRTE
ENSTTRP00000010790  ....................N...VEG-..........................LSVLRSFRLLRVFK.LAKSWPTLN
ENSTTRP00000000781  ....................-...----..........................----KTARLLRLVR.VARKLDRYS
ENSTTRP00000001468  ....................N...VEG-..........................LSVLRSFRLLRVFK.LAKSWPTLN
ENSTTRP00000013136  ....................-...TDFD..........................LRTLRAVRVLRPLK.LVSGIPSLQ
ENSTTRP00000011644  ..................vpT...---Atpgnseesnris..............ITFFRLFRVMRLVK.LLSRGEGIR
ENSTTRP00000012570  ....................-...----..........................---IRFLQILRMLH.VDRQGGTWR
ENSTTRP00000006619  ....................N...VQG-..........................LSVLRSFRLLRVFK.LAKSWPTLN
ENSTTRP00000001468  ....................-...DLGN..........................VSALRTFRVLRALK.TISVIPGLK
ENSTTRP00000002836  .................ggkG...AGFD..........................VKALRAFRVLRPLR.LVSGVPSLQ
ENSTTRP00000012822  ....................-...----..........................----KVVRLLRLGR.VARKLDHYI
ENSTTRP00000002689  ....................-...----..........................-----------LLK.RIKRCCGMR
ENSTTRP00000013138  ....................-...NLGN..........................VSALRTFRVLRALK.TISVIPGLK
ENSTTRP00000010790  ....................-...DLGN..........................VSALRTFRVLRALK.TISVIPGLK
ENSTTRP00000006356  ....................G...--PH..........................TPTLRLNRFLRVPR.LSEAFDRME
ENSTTRP00000005250  ....................-...DLGN..........................VSALRTFRVLRALK.TISVIPGLK
ENSTTRP00000011644  ....................S...SAISv.........................VKILRVLRVLRPLR.AINRAKGLK
ENSTTRP00000013138  ....................S...ELGA..........................IKSLRTLRALRPLR.ALSRFEGMR
ENSTTRP00000013305  ....................-...DLRG..........................ISGLRTFRVLRALK.TVSVIPGLK
ENSTTRP00000016088  ....................S...SAISv.........................VKILRVLRVLRPLR.AINRAKGLK
ENSTTRP00000006619  ....................-...DLGN..........................ISALRTFRVLRALK.TITVIPGLK
ENSTTRP00000002836  ....................E...TKIMsplg......................ISVLRCVRLLRIFK.ITRYWNSLS
ENSTTRP00000013323  ....................D...SSIS..........................LSSLRTFRVFRALK.AISVISXXX
ENSTTRP00000003295  ....................G...TSFG..........................ISVLRALRLLRIFK.ITKYWASLR
ENSTTRP00000013305  ....................R...KGS-..........................LTVLRTFRLLRVFK.LAKSWPTLN
ENSTTRP00000010733  ....................E...KGIDsevyktara.................LRIVRFTKILSLLR.LLRLSRLIR
ENSTTRP00000003584  ....................D...VEG-..........................LSVLRSFRLLRVFK.LAKSWPTLN
ENSTTRP00000013136  ....................N...NFIN..........................LSFLRLFRAARLIK.LLRQGYTIR
ENSTTRP00000006224  ....................-...----..........................------LRLYLIAR.VMLLHSKLF
ENSTTRP00000002836  ....................S...SAINv.........................VKILRVLRVLRPLR.AINRAKGLK
ENSTTRP00000009920  ....................-...----..........................------LRLYLIAR.VMLLHSKLF
ENSTTRP00000013018  ................msskG...AGLD..........................VKALRAFRVLRPLR.LVSGVPSLQ
ENSTTRP00000002368  ....................-...----..........................-------FIPVFLN.CWLAKHALE
ENSTTRP00000011644  ................ssgkS...GGFD..........................VKALRAFRVLRPLR.LVSGVPSLQ
ENSTTRP00000000825  ....................-...----..........................-------FVPVFLN.CWLAKHALE
ENSTTRP00000011711  ....................-...----..........................------LRLYLLGR.VMLLHSRIF
ENSTTRP00000005250  ....................S...ELGA..........................IKSLRTLRALRPLR.ALSRFEGMR
ENSTTRP00000013305  ....................F...SPTL..........................FRVIRLARIGRILR.LIRGAKGIR
ENSTTRP00000003295  ....................N...ALGSnkgrdikt..................IKSLRVLRVLRPLK.TIKRLPKLK
ENSTTRP00000002153  ....................-...----..........................FGFNPIFRTNRMLK.YTSFFE-FN
ENSTTRP00000000364  ....................AlpiNPTI..........................IRIMRVLRIARVLK.LLKMATGMR
ENSTTRP00000016088  ....................G...---Hlgessedssris..............ITFFRLFRVMRLVK.LLSKGEGIR
ENSTTRP00000006664  ....................-...----..........................--------------.---------
ENSTTRP00000002958  ....................-...----..........................--------------.------YLA
ENSTTRP00000008624  ....................-...----..........................--------------.---------
ENSTTRP00000009742  ....................-...----..........................--------------.---------
ENSTTRP00000000400  ....................-...----..........................--------------.---------
ENSTTRP00000000399  ....................-...----..........................--------------.---------
ENSTTRP00000011701  ....................-...----..........................--------------.---------
ENSTTRP00000012365  ....................-...----..........................---------RRPVL.YFHVRWGFS
ENSTTRP00000001716  ....................-...----..........................--------------.-----RYLT
ENSTTRP00000003616  ....................S...REE-..........................LKPLISIKFLRALR.VLSQFERMK
ENSTTRP00000005061  ....................-...----..........................--------------.------YLA
ENSTTRP00000009742  ....................-...----..........................--------------.---------
ENSTTRP00000008624  ....................-...----..........................--------------.---------
ENSTTRP00000003072  ....................N...LGWN..........................YPEIRLNRLLRISR.MFEFFQRTE
ENSTTRP00000009040  ....................-...----..........................--------------.-----RYLS
ENSTTRP00000005008  ....................-...----..........................--------------.-----RYLT
ENSTTRP00000013018  ....................S...AISV..........................VKILRVLRVLRPLR.AINRAKGLK
ENSTTRP00000014295  ....................-...----..........................--------------.----GRFLQ
ENSTTRP00000007445  ....................-...----..........................--------------.-----RYLS
ENSTTRP00000000398  ....................-...----..........................--------------.---------
ENSTTRP00000000398  ....................-...----..........................--------------.AKRLGQFLT
ENSTTRP00000003616  ....................H...CHG-..........................LAVLRSFRVLRIFK.LGRYWPTFK
ENSTTRP00000009762  ....................-...----..........................--------------.---------
ENSTTRP00000000629  ....................-...QNIN..........................LSAIRTVRVLRPLK.AINRVPSMR
ENSTTRP00000003616  ....................G...YYLVppsl......................VQLILLSRIIHILR.PEKGPKVFH
ENSTTRP00000003528  ....................-...----..........................--------------.-----RYLS
ENSTTRP00000002957  ....................-...----..........................--------------.---------
ENSTTRP00000012888  ....................-...----..........................--------------.---------
ENSTTRP00000009192  ....................-...----..........................--------------.---------
ENSTTRP00000004010  ....................-...----..........................--------------.---------
ENSTTRP00000009192  ....................-...----..........................--------------.--------R
ENSTTRP00000001715  ....................-...----..........................--------------.----FLYLK
ENSTTRP00000014553  ....................-...----..........................--------------.-------LQ
ENSTTRP00000006420  ....................-...-DLY..........................HSQFTYFQVLRVVR.LIKISPALE
ENSTTRP00000000399  ....................-...----..........................--------------.---------
ENSTTRP00000000400  ....................-...----..........................--------------.---------
ENSTTRP00000004010  ....................-...----..........................--------------.---------
ENSTTRP00000011356  ....................K...---Dint.......................IKSLRVLRVLRPLK.TIKRLPKLK
ENSTTRP00000011356  ....................X...XXXX..........................XXXXXXXXXXXXXX.XXXYWASLR
ENSTTRP00000006319  ....................T...VTSL..........................VHLLKTVRLLRLLR.LLQKLERYS
ENSTTRP00000003616  ....................-...PPNF..........................ISIFRITRNLRILK.IIPLNQGLK
ENSTTRP00000010014  ....................-...----..........................--------------.---------
ENSTTRP00000004968  ....................-...----..........................--------------.---------
ENSTTRP00000008933  ....................-...-LGN..........................VSALRTFRVLRALK.TISVISGLK
ENSTTRP00000002091  ....................R...SWLG..........................LRFLRALRLIQFSE.ILQFLNILK
ENSTTRP00000004968  ....................-...----..........................--------------.---------
ENSTTRP00000007963  ....................-...----..........................FGVNPLLRLPRCLK.YMAFFEFNN
ENSTTRP00000012888  ....................-...----..........................--------------.---------
ENSTTRP00000010014  ....................T...QGNIfatsa.....................LRSMRFLQILRMVR.MDRRGGTWK
ENSTTRP00000006420  ....................S...PWGM..........................LRIPRPLIMIRAFR.IYFRFELPR
ENSTTRP00000013323  ....................S...MCPG..........................KQSCMSLRSLRV--.---------
ENSTTRP00000000582  ....................E...LSA-..........................ISITYTLRALRLVH.VCMAVEPLA
ENSTTRP00000006420  ....................P...QNVPaesg......................AQLLLVLRCLRPLR.IFKLVPQMR
ENSTTRP00000002134  ....................-...----..........................VAALRHCLLPLLSR.PGAWVAIHW
ENSTTRP00000013136  ....................X...----..........................--------------.---------
ENSTTRP00000016088  ....................E...VGAMqplg......................ISVLRCVRLLRIFK.VT-------
ENSTTRP00000000047  ....................-...----..........................--------------.---------
ENSTTRP00000009762  ....................-...----..........................--------------.---------
ENSTTRP00000010378  ....................-...----..........................--------------.---------
ENSTTRP00000004338  ....................F...NMEP..........................FYFIVVLRPLQLLR.LFKLKKRYR
ENSTTRP00000007759  ....................N...---Yhtfdliqtvaf...............IKVVRFLRVLRILK.LV-------
ENSTTRP00000006420  ....................L...NAYT..........................YMMGACVIVFRFFS.ICGKHVTLK
ENSTTRP00000011228  ...............kpealG...---Llslwdv....................TRLVNMLVAFRFLR.IIRSVELMA
ENSTTRP00000016320  ....................-...----..........................--------------.----GRFLQ
ENSTTRP00000014317  ....................H...EFEA..........................LGLLILLRLWRVAR.II-------
ENSTTRP00000011228  ....................L...SLIC..........................QEPVRVRRLLRPFF.LMQNSSMMK
ENSTTRP00000004338  ....................R...QTSH..........................VRVTRALRCIFLVD.CR-YCGGVR
ENSTTRP00000014427  ........qfledqsafpnfE...---Nlaywqiqfnni...............AAVIVFFVWIKLFK.FINFNRTMS
ENSTTRP00000005277  ....................-...----..........................--------------.---------
ENSTTRP00000001972  ....................-...----..........................--------------.---------
ENSTTRP00000008933  ....................-...----..........................----XXXXXLRVFK.LAKSWPTLN
ENSTTRP00000002589  ....................-...----..........................--------------.---------
ENSTTRP00000011285  gkllqqpntyadfeflafwqT...QYNM..........................NAVNLFFAWIKIFK.YISFSKTMT
ENSTTRP00000011701  ....................-...----..........................--------------.---------
ENSTTRP00000005251  ....................-...----..........................--------------.---------
ENSTTRP00000006684  ....................-...----..........................--------------.---------


                                                                                    120       130   
                                                                                      |         |   
d1orqc_               .K..............................................................FLSAIADAADKI..
ENSTTRP00000010419  .I..............................................................LGQTLKASMRE-..
ENSTTRP00000004039  .S..............................................................LGFTLRRSYNE-..
ENSTTRP00000006570  .I..............................................................LGHTLRASMRE-..
ENSTTRP00000006832  .I..............................................................LGKTLQASMRE-..
ENSTTRP00000012947  .I..............................................................LGYTLKSCASE-..
ENSTTRP00000009306  .I..............................................................LGQTLKASMRE-..
ENSTTRP00000015380  .I..............................................................LGYTLKSCASE-..
ENSTTRP00000012489  .T..............................................................LTYALKRSFKE-..
ENSTTRP00000004829  .I..............................................................LGYTLKSCASE-..
ENSTTRP00000015083  .S..............................................................LGATLRHSYHE-..
ENSTTRP00000001235  .V..............................................................LGHTLRASTNE-..
ENSTTRP00000012542  .V..............................................................LGHTLRASTNE-..
ENSTTRP00000006964  .A..............................................................FGFTLRQCYQQ-..
ENSTTRP00000002262  .V..............................................................LGHTLRASTNE-..
ENSTTRP00000004325  .S..............................................................LGFTLRRSYNE-..
ENSTTRP00000007208  .S..............................................................LGATLKHSYRE-..
ENSTTRP00000010081  .T..............................................................LGLTARRCTRE-..
ENSTTRP00000013879  .I..............................................................LGQTLKASMRE-..
ENSTTRP00000012173  .T..............................................................LGLTVRRCTRE-..
ENSTTRP00000012038  .T..............................................................LGLTLKRCYRE-..
ENSTTRP00000013799  .S..............................................................LGMTITQCYEE-..
ENSTTRP00000013153  .X..............................................................XXXXXXXXXNE-..
ENSTTRP00000014995  .L..............................................................LGSVVYAHSKE-..
ENSTTRP00000001573  .E..............................................................YGAAV-------..
ENSTTRP00000005694  .E..............................................................YGAAV-------..
ENSTTRP00000014511  .E..............................................................YGAAV-------..
ENSTTRP00000008933  .V..............................................................VVNALVGAIPS-..
ENSTTRP00000006619  .V..............................................................VVNALLGAIPS-..
ENSTTRP00000012773  .L..............................................................LGSAICAHSKE-..
ENSTTRP00000000204  .L..............................................................VVETLMSSLKP-..
ENSTTRP00000013305  .V..............................................................VVDALVGAIPS-..
ENSTTRP00000000629  .L..............................................................VVETLISSLKP-..
ENSTTRP00000013138  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000010790  .V..............................................................VVNALLGAIPS-..
ENSTTRP00000000364  .L..............................................................VVETLISSLRP-..
ENSTTRP00000005250  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000004176  .S..............................................................LGLTVRRCARE-..
ENSTTRP00000000364  .R..............................................................QLVVLMKTMDN-..
ENSTTRP00000010790  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000000629  .R..............................................................QLVVLMKTMDN-..
ENSTTRP00000003584  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000000204  .R..............................................................QLVVLMKTMDN-..
ENSTTRP00000006619  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000014856  .E..............................................................IFHMTYDLASAVv.
ENSTTRP00000008933  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000005715  .T..............................................................RTNYP--NMFR-..
ENSTTRP00000016088  .I..............................................................VLNSIMKALVP-..
ENSTTRP00000011516  .E..............................................................IFHMTYDLASAVv.
ENSTTRP00000008973  .E..............................................................IFHMTYDLASAVv.
ENSTTRP00000001468  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000013323  .V..............................................................VVNALIGAIPA-..
ENSTTRP00000002836  .T..............................................................LLWTFIKSFQA-..
ENSTTRP00000003584  .V..............................................................VVNALIGAIPS-..
ENSTTRP00000001468  .V..............................................................VVNALVGAIPS-..
ENSTTRP00000000204  .I..............................................................LVTLLLDTLPM-..
ENSTTRP00000000364  .I..............................................................LVTLLLDTLPM-..
ENSTTRP00000013136  .N..............................................................LVVSLLNSMKS-..
ENSTTRP00000011356  .I..............................................................LLWTFVQSFKA-..
ENSTTRP00000008021  .Q..............................................................HSTIV-------..
ENSTTRP00000013018  .N..............................................................LVASLLNSIHC-..
ENSTTRP00000011356  .V..............................................................VLKSIMKAMIP-..
ENSTTRP00000003295  .I..............................................................LLWTFVQSFKA-..
ENSTTRP00000005250  .M..............................................................LIKIIGNSVGA-..
ENSTTRP00000001723  .L..............................................................LGSVVYAHSKE-..
ENSTTRP00000013323  .T..............................................................LLFALMMSLPS-..
ENSTTRP00000013138  .M..............................................................LIKIIGNSVGA-..
ENSTTRP00000000629  .A..............................................................LLDTVVQALPQ-..
ENSTTRP00000013018  .T..............................................................LLWTFIKSFQA-..
ENSTTRP00000000204  .A..............................................................LLDTVMQALPQ-..
ENSTTRP00000003584  .T..............................................................IVGALIQSVKK-..
ENSTTRP00000001827  .T..............................................................SNSVK-------..
ENSTTRP00000003295  .I..............................................................VLKSIMKAMVP-..
ENSTTRP00000011644  .N..............................................................LVASLLNSMKS-..
ENSTTRP00000015837  .T..............................................................RTSHH--NIFH-..
ENSTTRP00000010790  .M..............................................................LIKIIGNSVGA-..
ENSTTRP00000000781  .E..............................................................YGAAV-------..
ENSTTRP00000001468  .M..............................................................LIKIIGNSVGA-..
ENSTTRP00000013136  .V..............................................................VLKSIMKAMVP-..
ENSTTRP00000011644  .T..............................................................LLWTFIKSFQA-..
ENSTTRP00000012570  .L..............................................................LGSVVFIHRQE-..
ENSTTRP00000006619  .M..............................................................LIKIIGNSVGA-..
ENSTTRP00000001468  .T..............................................................IVGALIQSVKK-..
ENSTTRP00000002836  .V..............................................................VLNSIIKAMVP-..
ENSTTRP00000012822  .E..............................................................YGAAV-------..
ENSTTRP00000002689  .N..............................................................TEVSMENM----..
ENSTTRP00000013138  .T..............................................................IVGALIQSVKK-..
ENSTTRP00000010790  .T..............................................................IVGALIQSVKK-..
ENSTTRP00000006356  .T..............................................................CTVHP--NAFR-..
ENSTTRP00000005250  .T..............................................................IVGALIQSVKK-..
ENSTTRP00000011644  .H..............................................................VVQCVFVAIRT-..
ENSTTRP00000013138  .V..............................................................VVNALVGAIPS-..
ENSTTRP00000013305  .V..............................................................IVGALIHSVRK-..
ENSTTRP00000016088  .H..............................................................VVQCVFVAIRT-..
ENSTTRP00000006619  .T..............................................................IVGALIQSVKK-..
ENSTTRP00000002836  .N..............................................................LVASLLNSVRS-..
ENSTTRP00000013323  .X..............................................................XVGALLRSVKR-..
ENSTTRP00000003295  .N..............................................................LVVSLMSSMKS-..
ENSTTRP00000013305  .T..............................................................LIKIIGNSVGA-..
ENSTTRP00000010733  .Y..............................................................IHQ---------..
ENSTTRP00000003584  .M..............................................................LIKIIGNSVGA-..
ENSTTRP00000013136  .I..............................................................LLWTFVQSFKA-..
ENSTTRP00000006224  .Tdassrsigalnkinfn..............................................TRFVMKTLMTIC..
ENSTTRP00000002836  .H..............................................................VVQCVFVAIRT-..
ENSTTRP00000009920  .Tdassrsigalnkinfn..............................................TRFVMKTLMTIC..
ENSTTRP00000013018  .V..............................................................VLNSVFKAMQP-..
ENSTTRP00000002368  .N..............................................................MINDFHRAILRTqs
ENSTTRP00000011644  .V..............................................................VLNSIIKAMVP-..
ENSTTRP00000000825  .N..............................................................MINDLHRAIQRTqs
ENSTTRP00000011711  .Tdassrsigalnkitfn..............................................TRFVMKTLMTIC..
ENSTTRP00000005250  .V..............................................................VVNALLGAIPS-..
ENSTTRP00000013305  .T..............................................................LLFALMMSLPA-..
ENSTTRP00000003295  .A..............................................................VFDCVVTSLKN-..
ENSTTRP00000002153  .H..............................................................HLESIMNKAYIY..
ENSTTRP00000000364  .A..............................................................LLDTVVQALPQ-..
ENSTTRP00000016088  .T..............................................................LLWTFIKSFQA-..
ENSTTRP00000006664  .-..............................................................------MNTH--..
ENSTTRP00000002958  .D..............................................................IFTTCVDIRWRW..
ENSTTRP00000008624  .-..............................................................-----IRIIST-..
ENSTTRP00000009742  .-..............................................................---------MAN..
ENSTTRP00000000400  .-..............................................................------------..
ENSTTRP00000000399  .-..............................................................------------..
ENSTTRP00000011701  .-..............................................................------------..
ENSTTRP00000012365  .K..............................................................QAVAIVH-----..
ENSTTRP00000001716  .D..............................................................LFTTLVDLQWRL..
ENSTTRP00000003616  .V..............................................................VVRALVKTTLP-..
ENSTTRP00000005061  .D..............................................................MFTTCVDIRWRY..
ENSTTRP00000009742  .-..............................................................------------..
ENSTTRP00000008624  .-..............................................................---------KWK..
ENSTTRP00000003072  .T..............................................................RTNYP--NIFR-..
ENSTTRP00000009040  .D..............................................................LFTTLVDLKWRF..
ENSTTRP00000005008  .D..............................................................IFTTLVDLKWRF..
ENSTTRP00000013018  .H..............................................................VVQCVFVAIRT-..
ENSTTRP00000014295  .D..............................................................VFTTLVDLKWPY..
ENSTTRP00000007445  .D..............................................................LFTTCVDVRWRW..
ENSTTRP00000000398  .-..............................................................------------..
ENSTTRP00000000398  .K..............................................................RGVSLRKAQITC..
ENSTTRP00000003616  .I..............................................................LLLTLGNSVMA-..
ENSTTRP00000009762  .-..............................................................------RILSA-..
ENSTTRP00000000629  .I..............................................................LVNLLLDTLPM-..
ENSTTRP00000003616  .D..............................................................LLLPLVLSLPA-..
ENSTTRP00000003528  .D..............................................................LFTTLVDLKWRW..
ENSTTRP00000002957  .D..............................................................IFTTLVDTKWRH..
ENSTTRP00000012888  .-..............................................................------------..
ENSTTRP00000009192  .-..............................................................------------..
ENSTTRP00000004010  .-..............................................................------------..
ENSTTRP00000009192  .R..............................................................WGCHPPQAARWH..
ENSTTRP00000001715  .D..............................................................LWTTFIDMQWRY..
ENSTTRP00000014553  .D..............................................................LWTTVIDMKWRY..
ENSTTRP00000006420  .D..............................................................FVYKIFGPGKK-..
ENSTTRP00000000399  .-..............................................................--KDPAKARWLV..
ENSTTRP00000000400  .-..............................................................--QTLG------..
ENSTTRP00000004010  .-..............................................................--------YHV-..
ENSTTRP00000011356  .XxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgkyllyeknE-----------..
ENSTTRP00000011356  .N..............................................................LVVSLLNSMKS-..
ENSTTRP00000006319  .Q..............................................................CSAVV-------..
ENSTTRP00000003616  .S..............................................................FVGILIHCLKK-..
ENSTTRP00000010014  .-..............................................................------------..
ENSTTRP00000004968  .-..............................................................------------..
ENSTTRP00000008933  .T..............................................................IVGALIQSVKK-..
ENSTTRP00000002091  .T..............................................................SNSIK-------..
ENSTTRP00000004968  .-..............................................................----------IF..
ENSTTRP00000007963  .R..............................................................LESIL-SKAYIY..
ENSTTRP00000012888  .-..............................................................------------..
ENSTTRP00000010014  .L..............................................................LGSVVLA-----..
ENSTTRP00000006420  tR..............................................................ITNILKRSGEQ-..
ENSTTRP00000013323  .-..............................................................------------..
ENSTTRP00000000582  .R..............................................................IIRVILQSVPD-..
ENSTTRP00000006420  .K..............................................................VVRELFSGFKE-..
ENSTTRP00000002134  .Q..............................................................LTPARAALLQA-..
ENSTTRP00000013136  .Xxxxxxxxxxxxxxxxxxxxxxxxxxxxxa.................................VFDCVVNSLKN-..
ENSTTRP00000016088  .-..............................................................------------..
ENSTTRP00000000047  .-..............................................................------------..
ENSTTRP00000009762  .-..............................................................------------..
ENSTTRP00000010378  .-..............................................................------------..
ENSTTRP00000004338  .N..............................................................VLDTMFELLPR-..
ENSTTRP00000007759  .-..............................................................------------..
ENSTTRP00000006420  .M..............................................................LLLTVVVSMYK-..
ENSTTRP00000011228  .V..............................................................VASTILDLIRN-..
ENSTTRP00000016320  .D..............................................................IFTTLVDLKWRH..
ENSTTRP00000014317  .-..............................................................------------..
ENSTTRP00000011228  .K..............................................................TLKCIRWSLPEM..
ENSTTRP00000004338  .R..............................................................NLRQIFQSLPP-..
ENSTTRP00000014427  .Q..............................................................LSTTMSRCAKD-..
ENSTTRP00000005277  .D..............................................................IWTTVLDLKWRY..
ENSTTRP00000001972  .-..............................................................------------..
ENSTTRP00000008933  .T..............................................................LIKIIGNSVGA-..
ENSTTRP00000002589  .-..............................................................------------..
ENSTTRP00000011285  .Q..............................................................LSSTLARCAKD-..
ENSTTRP00000011701  .-..............................................................------------..
ENSTTRP00000005251  .-..............................................................------------..
ENSTTRP00000006684  .-..............................................................------------..


                                140       150                                                       
                                  |         |                                                       
d1orqc_               ....RFYHLFGAVMLTVLYGAFAI............................................YIVE......
ENSTTRP00000010419  ....-LGLLIFFLFIGVILFSSAV............................................YFAE......
ENSTTRP00000004039  ....-LGLLILFLAMGIMIFSSLV............................................FFAE......
ENSTTRP00000006570  ....-LGLLIFFLFIGVILFSSAV............................................YFAE......
ENSTTRP00000006832  ....-LGLLIFFLFIGVILFSSAV............................................YFAE......
ENSTTRP00000012947  ....-LGFLLFSLTMAIIIFATVM............................................FYAE......
ENSTTRP00000009306  ....-LGLLIFFLFIGVILFSSAV............................................YFAE......
ENSTTRP00000015380  ....-LGFLLFSLTMAIIIFATVM............................................FYAE......
ENSTTRP00000012489  ....-LGLLLMYLAVGIFVFSALG............................................YTME......
ENSTTRP00000004829  ....-LGFLLFSLTMAIIIFATVM............................................FYAE......
ENSTTRP00000015083  ....-VGLLLLFLSVGISIFSVLI............................................YSVE......
ENSTTRP00000001235  ....-FLLLIIFLALGVLIFATMI............................................YYAE......
ENSTTRP00000012542  ....-FLLLIIFLALGVLIFATMI............................................YYAE......
ENSTTRP00000006964  ....-VGCLLLFITMGIFTFSAAV............................................YSVE......
ENSTTRP00000002262  ....-FLLLIIFLALGVLIFATMI............................................YYAE......
ENSTTRP00000004325  ....-LGLLILFLAMGIMIFSSLV............................................FFAE......
ENSTTRP00000007208  ....-VGILLLYLAVGVSVFSCVA............................................YTAE......
ENSTTRP00000010081  ....-FGLLLLFLCVAIALFAPLL............................................YVIE......
ENSTTRP00000013879  ....-LGLLIFFLFIGVILFSSAV............................................YFAE......
ENSTTRP00000012173  ....-FALLLLFLCVAITLFSPLV............................................YVAE......
ENSTTRP00000012038  ....-MVMLLVFICVAMAIFSALS............................................QLLE......
ENSTTRP00000013799  ....-VGLLLLFLSVGISIFSTVE............................................YFAE......
ENSTTRP00000013153  ....-FLLLIIFLALGVLIFATMI............................................YYAE......
ENSTTRP00000014995  ....-LITAWYIGFLVLIFSSFLV............................................YLVE......
ENSTTRP00000001573  ....-LFLLMCTFALIAHWLACIW............................................YAIG......
ENSTTRP00000005694  ....-LMLLMCIFALIAHWLACIW............................................YAIG......
ENSTTRP00000014511  ....-LVLLVCVFGLVAHWLACIW............................................YSIG......
ENSTTRP00000008933  ....-IMNVLLVCLIFWLIFSIMG............................................VNLF......
ENSTTRP00000006619  ....-IMNVLLVCLIFWLIFSIMG............................................VNLF......
ENSTTRP00000012773  ....-LITAWYIGFLTLILSSFLV............................................YLVE......
ENSTTRP00000000204  ....-IGNIVVICCAFFIIFGILG............................................VQLF......
ENSTTRP00000013305  ....-IMNVLLVCLIFWLIFSIMG............................................VNLF......
ENSTTRP00000000629  ....-IGNIVLICCAFFIIFGILG............................................VQLF......
ENSTTRP00000013138  ....-LFNIGLLLFLVMFIFSIFG............................................MSNF......
ENSTTRP00000010790  ....-IMNVLLVCLIFWLIFSIMG............................................VNLF......
ENSTTRP00000000364  ....-IGNIVLICCAFFIIFGILG............................................VQLF......
ENSTTRP00000005250  ....-LFNIGLLLFLVMFIYAIFG............................................MSNF......
ENSTTRP00000004176  ....-FGLLLLFLCVAMALFAPLV............................................HLAE......
ENSTTRP00000000364  ....-VATFCMLLMLFIFIFSILG............................................MHLF......
ENSTTRP00000010790  ....-LFNIGLLLFLVMFIYAIFG............................................MSNF......
ENSTTRP00000000629  ....-VATFCMLLMLFIFIFSILG............................................MHIF......
ENSTTRP00000003584  ....-LFNIGLLLFLVMFIYAIFG............................................MSNF......
ENSTTRP00000000204  ....-VATFCMLLMLFIFIFSILG............................................MHLF......
ENSTTRP00000006619  ....-LFNIGLLLFLVMFIYSIFG............................................MSNF......
ENSTTRP00000014856  ....RIVNLIGMMLLLCHWDGCLQ............................................FLVP......
ENSTTRP00000008933  ....-LFNIGLLLFLVMFIYSIFG............................................MANF......
ENSTTRP00000005715  ....-IGNLVLYILIIIHWNACLY............................................FAIS......
ENSTTRP00000016088  ....-LLHIALLVLFVIIIYAIIG............................................LELF......
ENSTTRP00000011516  ....RIFNLIGMMLLLCHWDGCLQ............................................FLVP......
ENSTTRP00000008973  ....RIFNLIGMMLLLCHWDGCLQ............................................FLVP......
ENSTTRP00000001468  ....-LFNIGLLLFLVMFIYAIFG............................................MSNF......
ENSTTRP00000013323  ....-ILNVLLVCLIFWLIFCILG............................................VNLF......
ENSTTRP00000002836  ....-LPYVALLIVMLFFIYAVIG............................................MQVF......
ENSTTRP00000003584  ....-IMNVLLVCLIFWLIFSIMG............................................VNLF......
ENSTTRP00000001468  ....-IMNVLLVCLIFWLIFSIMG............................................VNLF......
ENSTTRP00000000204  ....-LGNVLLLCFFVFFIFGIVG............................................VQLW......
ENSTTRP00000000364  ....-LGNVLLLCFFVFFIFGIVG............................................VQLW......
ENSTTRP00000013136  ....-IISLLFLLFLFIVVFALLG............................................MQLF......
ENSTTRP00000011356  ....-LPYVCLLIAMLFFIYAIIG............................................MQVF......
ENSTTRP00000008021  ....-LTLLMSMFALLAHWMACIW............................................YVIG......
ENSTTRP00000013018  ....-IASLLLLLSLFVVIFALLG............................................MQLF......
ENSTTRP00000011356  ....-LLQIGLLLFFAILIFAIIGlefymgkfhttcfeegtddiqgespapcgteepartcpngtkcqPYWE......
ENSTTRP00000003295  ....-LPYVCLLIAMLFFIYAIIG............................................MQVF......
ENSTTRP00000005250  ....-LGNLTLVLAIIVFIFAVVG............................................MQLF......
ENSTTRP00000001723  ....-LVTAWYIGFLCLILASFLV............................................YLAE......
ENSTTRP00000013323  ....-LFNIGLLLFLVMFIYAIFG............................................MNCFckvkee
ENSTTRP00000013138  ....-LGNLTLVLAIIVFIFAVVG............................................MQLF......
ENSTTRP00000000629  ....-VGNLGLLFMLLFFIYAALG............................................VELF......
ENSTTRP00000013018  ....-LPYVALLIVMLFFIYAVIG............................................MQML......
ENSTTRP00000000204  ....-VGNLGLLFMLLFFIFAALG............................................VELF......
ENSTTRP00000003584  ....-LSDVMILTVFCLSVFALIG............................................LQLF......
ENSTTRP00000001827  ....-FSKLLSIVLSTLFTAAGFI............................................HLVE......
ENSTTRP00000003295  ....-LLQIGLLLFFAILMFAIIG............................................LEFY......
ENSTTRP00000011644  ....-IASLLLLLFLFIIIFSLLG............................................MQLF......
ENSTTRP00000015837  ....-ISNLVLYILVIICWNACIY............................................YAIS......
ENSTTRP00000010790  ....-LGNLTLVLAIIVFIFAVVG............................................MQLF......
ENSTTRP00000000781  ....-LFLLMCTFALIAHWLACIW............................................YAIG......
ENSTTRP00000001468  ....-LGNLTLVLAIIVFIFAVVG............................................MQLF......
ENSTTRP00000013136  ....-LLQIGLLLFFAILMFAIIG............................................LEFY......
ENSTTRP00000011644  ....-LPYVALLIAMLFFIYAVIG............................................MQMF......
ENSTTRP00000012570  ....-LITTLYIGFLGLIFSSYFV............................................YLAE......
ENSTTRP00000006619  ....-LGNLTLVLAIIVFIFAVVG............................................MQLF......
ENSTTRP00000001468  ....-LSDVMILTVFCLSVFALIG............................................LQLF......
ENSTTRP00000002836  ....-LLHIALLVLFVIIIYAIIG............................................LELF......
ENSTTRP00000012822  ....-LVLLVCVFGLAAHWMACIW............................................YSIG......
ENSTTRP00000002689  ....-VTVGFFSCMGTLCIGAAAF............................................SQCE......
ENSTTRP00000013138  ....-LSDVMILTVFCLSVFALIG............................................LQLF......
ENSTTRP00000010790  ....-LSDVMILTVFCLSVFALIG............................................LQLF......
ENSTTRP00000006356  ....-IAKLMLYVFAVIHWNSCLY............................................FALS......
ENSTTRP00000005250  ....-LSDVMILTVFCLSVFALIG............................................LQLF......
ENSTTRP00000011644  ....-IGNIMIVTTLLQFMFACIG............................................VQLF......
ENSTTRP00000013138  ....-IMNVLLVCLIFWLIFSIMG............................................VNLF......
ENSTTRP00000013305  ....-LADVTILTIFCLSVFALVG............................................LQLF......
ENSTTRP00000016088  ....-IGNIMIVTTLLQFMFACIG............................................VQLF......
ENSTTRP00000006619  ....-LSDVMILTVFCLSVFALVG............................................LQLF......
ENSTTRP00000002836  ....-IASLLLLLFLFIIIFSLLG............................................MQLF......
ENSTTRP00000013323  ....-LIDVMILTLFCLSIFALVG............................................QQLF......
ENSTTRP00000003295  ....-IISLLFLLFLFIVVFALLG............................................MQLF......
ENSTTRP00000013305  ....-LGNLTIILAIIVFVFALVG............................................KQLL......
ENSTTRP00000010733  ....--------------------............................................--WE......
ENSTTRP00000003584  ....-LGNLTLVLAIIVFIFAVVG............................................MQLF......
ENSTTRP00000013136  ....-LPYVCLLIAMLFFIYAIVG............................................MQVF......
ENSTTRP00000006224  ....PGTVLLVFSISLWIIAAWTV............................................RVCE......
ENSTTRP00000002836  ....-IGNIVIVTTLLQFMFACIG............................................VQLF......
ENSTTRP00000009920  ....PGTVLLVFSISLWIIAAWTV............................................RACE......
ENSTTRP00000013018  ....-LFHIALLVLFMAIIYAIIG............................................LELF......
ENSTTRP00000002368  amfnQVLILFCTLLCLVFTGTCGI............................................QHLE......
ENSTTRP00000011644  ....-LLHIALLVLFVIIIYAIIG............................................LELF......
ENSTTRP00000000825  amfnQVLILISTLLCLIFTCICGI............................................QHLE......
ENSTTRP00000011711  ....PGTVLLVFSISSWIIAAWTV............................................RVCE......
ENSTTRP00000005250  ....-IMNVLLVCLIFW-------............................................----......
ENSTTRP00000013305  ....-LFNIGLLLFLVMFIYSIFG............................................MANF......
ENSTTRP00000003295  ....-VFNILIVYKLFMFIFAVIA............................................VQLF......
ENSTTRP00000002153  ....RGIRTTGYLLFTLHINACMY............................................YWAS......
ENSTTRP00000000364  ....-VGNLGLLFMLLFFIYAALG............................................VELF......
ENSTTRP00000016088  ....-LPYVALLIAMIFFIYAVIG............................................MQXX......
ENSTTRP00000006664  ....PGRLLLCLTLGLWLTTAWVL............................................SVAE......
ENSTTRP00000002958  ....MLVIFCLAFVLSWLFFGCVF............................................WLIA......
ENSTTRP00000008624  ....-IIFILFGCVLFVALPAIIF............................................KHIE......
ENSTTRP00000009742  ....MVLIGFFSCISTLCIGAAAF............................................SYYE......
ENSTTRP00000000400  ....--LPLLLAYVCYLLLGATIF............................................QLLE......
ENSTTRP00000000399  ....---LLLLAYLTYLALGTGVF............................................WLLE......
ENSTTRP00000011701  ....-VVAIFVVVVVYLVTGGLVF............................................RALE......
ENSTTRP00000012365  ....AVLLGVITVSCFFFIPAAVF............................................SLLE......
ENSTTRP00000001716  ....SLLFFVLAYALTWLFFGAIW............................................WLIA......
ENSTTRP00000003616  ....-TWNVLLVCLMIWLAFSIIG............................................VHLF......
ENSTTRP00000005061  ....MLLIFSLAFLASWLLFGVIF............................................WVIA......
ENSTTRP00000009742  ....--LALIVCTFTYLLVGAAVF............................................DALE......
ENSTTRP00000008624  ....TVSTIFLVVVLYLIIGATVF............................................KALE......
ENSTTRP00000003072  ....-ISNLVMYIVIIIHWNACVY............................................FSIS......
ENSTTRP00000009040  ....NLLVFTMVYTVTWLFFGFIW............................................WLIA......
ENSTTRP00000005008  ....NLLIFVMVYTVTWLFFGMIW............................................WLIA......
ENSTTRP00000013018  ....-IGNIVLVTTLLQFMFACIG............................................VQLF......
ENSTTRP00000014295  ....TLLIFTMSFLCSWLLFAMVW............................................WLIA......
ENSTTRP00000007445  ....MCLLFSCSFLASWLLFGLAF............................................WLIA......
ENSTTRP00000000398  ....----LTSAIIFYLAIGAAIF............................................EVLE......
ENSTTRP00000000398  ....TAIFILWGVLVHLVIPPFVF............................................MVTE......
ENSTTRP00000003616  ....-LKDLVLLLFTFIFFSAVLG............................................LKLF......
ENSTTRP00000009762  ....-VLFLLIGCLLFVLTPTFVF............................................CYVE......
ENSTTRP00000000629  ....-LGNVLLLCFFVFFIFGIIG............................................VQLW......
ENSTTRP00000003616  ....-LLNISLLIFLIMFVYAIFG............................................MYNF......
ENSTTRP00000003528  ....NLFIFILTYTVAWLFMASMW............................................WVIA......
ENSTTRP00000002957  ....MFVIFSLSYILSWLIFGSIF............................................WLIA......
ENSTTRP00000012888  ....-MVILCMASLLISCCASAMY............................................TSVE......
ENSTTRP00000009192  ....---GALAAYIAYLVLGALLV............................................ARLE......
ENSTTRP00000004010  ....RFVLLAALIGLYLVAGATVF............................................SALE......
ENSTTRP00000009192  ....LAVLLGVVVTICFLVPAAVF............................................AHLE......
ENSTTRP00000001715  ....KLLLFSATFAGTWFLFGVVW............................................YLVA......
ENSTTRP00000014553  ....KLTLFAATFVMTWFLFGVIY............................................YAIA......
ENSTTRP00000006420  ....-LGSLVVFTASLLIVMSAIS............................................LQMF......
ENSTTRP00000000399  ....GSSALLSGLLLFLLLPPLLF............................................SHVE......
ENSTTRP00000000400  ....LALFLALGTLLVLIFPPMVF............................................SHVE......
ENSTTRP00000004010  ....-LLILGLFAVLLSCCASAMY............................................TSVE......
ENSTTRP00000011356  ....--------------------............................................----......
ENSTTRP00000011356  ....-IISLLFLLFLFIVVFALLG............................................MQLF......
ENSTTRP00000006319  ....-LTLLMSIFALLAHWMACVW............................................YVVG......
ENSTTRP00000003616  ....-LTGVIILTLFFLSIFSLIG............................................MELF......
ENSTTRP00000010014  ....--------------------............................................----......
ENSTTRP00000004968  ....-LPIIALVVVAYVSCAAAIL............................................PIEK......
ENSTTRP00000008933  ....-LADVMVLTVFCLSVFALIG............................................LQLF......
ENSTTRP00000002091  ....-LVNLLSIFISTWLTAAGFI............................................HL--......
ENSTTRP00000004968  ....PRLCFHCSLVTYALVGAALF............................................SAIE......
ENSTTRP00000007963  ....RVIRTTAYLLYSLHLNSCLY............................................YWAS......
ENSTTRP00000012888  ....-FLLLAALIVLYLLGGAAVF............................................SALE......
ENSTTRP00000010014  ....--------------------............................................----......
ENSTTRP00000006420  ....-IWSVSIFLLFFLLLYGILG............................................VQMF......
ENSTTRP00000013323  ....--------------------............................................----......
ENSTTRP00000000582  ....-MAYIMALILFFMLVFSVFG............................................VTLF......
ENSTTRP00000006420  ....-IFLVSILLLTLMLVFASFG............................................VQLF......
ENSTTRP00000002134  ....-SGLGLLVAGIFVLLPALVL............................................WGLQ......
ENSTTRP00000013136  ....-VLNILIVYMLFMFIFAVIA............................................VQLF......
ENSTTRP00000016088  ....--------------------............................................----......
ENSTTRP00000000047  ....--------------------............................................----......
ENSTTRP00000009762  ....-LLALLAVVLLYLVSGALVF............................................QALE......
ENSTTRP00000010378  ....--------------------............................................----......
ENSTTRP00000004338  ....-MASLGLTLLTFYYSFAIVG............................................MEFF......
ENSTTRP00000007759  ....--------------------............................................----......
ENSTTRP00000006420  ....-SFFIIVGMFLLLLCYAFAG............................................VVLF......
ENSTTRP00000011228  ....-MRAFGGILAVVYYVFAIIG............................................IILF......
ENSTTRP00000016320  ....TLVIFTMSFLCSWLLFAIMW............................................WLVA......
ENSTTRP00000014317  ....--------------------............................................----......
ENSTTRP00000011228  ....AXX-----------------............................................----......
ENSTTRP00000004338  ....-FMDILSLLLFFMIIFAILG............................................FYLF......
ENSTTRP00000014427  ....-LFGFAIMFFIIFLAYAQLA............................................YLVF......
ENSTTRP00000005277  ....KMTIFITAFLGSWFFFGLLW............................................YAVA......
ENSTTRP00000001972  ....--------------------............................................----......
ENSTTRP00000008933  ....-LGNLTLVLAIIVFIFAVVG............................................MQLF......
ENSTTRP00000002589  ....-----VSVVLFLVSRFSPYE............................................WHLE......
ENSTTRP00000011285  ....-ILGFAVMFFIVFFAYAQLG............................................YLLF......
ENSTTRP00000011701  ....--------------------............................................----......
ENSTTRP00000005251  ....-------MCIVFAYIGVSVV............................................LFLV......
ENSTTRP00000006684  ....-AYIGVSVVLFLVSRFSPYE............................................WHTE......


                                                                                                    
                                                                                                    
d1orqc_               YPD...........................................................................
ENSTTRP00000010419  AEE...........................................................................
ENSTTRP00000004039  KDE...........................................................................
ENSTTRP00000006570  ADE...........................................................................
ENSTTRP00000006832  ADD...........................................................................
ENSTTRP00000012947  KGT...........................................................................
ENSTTRP00000009306  VDE...........................................................................
ENSTTRP00000015380  KGS...........................................................................
ENSTTRP00000012489  QSH...........................................................................
ENSTTRP00000004829  KGS...........................................................................
ENSTTRP00000015083  KDD...........................................................................
ENSTTRP00000001235  RIGarpsdprgn..................................................................
ENSTTRP00000012542  RVGaqpndpsas..................................................................
ENSTTRP00000006964  HDV...........................................................................
ENSTTRP00000002262  RIGadpddilgs..................................................................
ENSTTRP00000004325  KDE...........................................................................
ENSTTRP00000007208  KE-...........................................................................
ENSTTRP00000010081  NEM...........................................................................
ENSTTRP00000013879  ADE...........................................................................
ENSTTRP00000012173  NES...........................................................................
ENSTTRP00000012038  HGLdlet.......................................................................
ENSTTRP00000013799  QSI...........................................................................
ENSTTRP00000013153  RIGaqpndpsas..................................................................
ENSTTRP00000014995  KDA...........................................................................
ENSTTRP00000001573  NVErpylepkigwldslgaqlgkryngsdpas..............................................
ENSTTRP00000005694  NVErpyltdkigwldslgqqigkryndsdsss..............................................
ENSTTRP00000014511  DYEvidevtntiqidswlyqlalsigtpyryntsagiweg......................................
ENSTTRP00000008933  AGKfgrcinqtegdlplnytivnnksdcmsfnvtgelywtk.....................................
ENSTTRP00000006619  AGKfyycmntttserfdisevnnkseceslmhtgqvrwln......................................
ENSTTRP00000012773  KDV...........................................................................
ENSTTRP00000000204  KGKffvcqgedtrnitnksdcaeasyrwvr................................................
ENSTTRP00000013305  AGKfqkcinktsegfllvpwttvnnmsdcerqnhtgnffwvn....................................
ENSTTRP00000000629  KGKfyhclgidtrnitnrsdcvaanyrwvh................................................
ENSTTRP00000013138  AYV...........................................................................
ENSTTRP00000010790  AGKfyhcvntttgdmfdisevnnhsdcliliernetarwkn.....................................
ENSTTRP00000000364  KGKfyycegadtrnistkaecwaahyrwvr................................................
ENSTTRP00000005250  AYV...........................................................................
ENSTTRP00000004176  REL...........................................................................
ENSTTRP00000000364  GCKfslktdtgdtvp...............................................................
ENSTTRP00000010790  AYV...........................................................................
ENSTTRP00000000629  GCKfslrtdtgdtvp...............................................................
ENSTTRP00000003584  AYV...........................................................................
ENSTTRP00000000204  GCKfaserdgdtlp................................................................
ENSTTRP00000006619  AYV...........................................................................
ENSTTRP00000014856  MLQdpddxxxxxxxxx..............................................................
ENSTTRP00000008933  AYVkweagi.....................................................................
ENSTTRP00000005715  KFIgfgtdswvypnisnpe...........................................................
ENSTTRP00000016088  LGRmhktcyflgsdveaeedpspcassgsgractlnqtecrgrwagpng.............................
ENSTTRP00000011516  LLQdfppdcwvslnemv.............................................................
ENSTTRP00000008973  MLQdfppdcwvsinhmv.............................................................
ENSTTRP00000001468  AYV...........................................................................
ENSTTRP00000013323  SGKfgrcvnvtdgnsvinyniva.......................................................
ENSTTRP00000002836  GKIalndttein..................................................................
ENSTTRP00000003584  AQVlqcvntt....................................................................
ENSTTRP00000001468  AGKfyhcvntttgnmfevsevnnlsdcqalgkkarwkn........................................
ENSTTRP00000000204  AGLlrnrcflpenfslplsvdleryyqtenedenpficsqprengmrscrsvptlrgdggggppcvldyeaynsssnt
ENSTTRP00000000364  AGLlrnrcfldstfarnsnlsflrpyyqpeegeenpficssrrdngmqkcshipsrrelrvectlgweaygqpqaega
ENSTTRP00000013136  GGQfnfqdet....................................................................
ENSTTRP00000011356  GNIgidvededsdedefqit..........................................................
ENSTTRP00000008021  KMEmednsllkwevgwlpelgkrlespyygnntlg...........................................
ENSTTRP00000013018  GGR...........................................................................
ENSTTRP00000011356  GPN...........................................................................
ENSTTRP00000003295  GNIkldeeshin..................................................................
ENSTTRP00000005250  GKSykecvckisndcelprwhmhdffhsflivfrvl..........................................
ENSTTRP00000001723  KG-...........................................................................
ENSTTRP00000013323  SGI...........................................................................
ENSTTRP00000013138  GKSykecvckinqdcelprwhmhdffhsflivfrvl..........................................
ENSTTRP00000000629  GKLvcndenpcegms...............................................................
ENSTTRP00000013018  GKIalvdgtqin..................................................................
ENSTTRP00000000204  GDLecdethpceglg...............................................................
ENSTTRP00000003584  MGNlkqkcvrtllennetiesilntledygkyfyylegskdallcgfstdsgqcpegytcvkvgknpdy.........
ENSTTRP00000001827  NSG...........................................................................
ENSTTRP00000003295  SGKlhracfmnnsrilegfdpphpcgvqgcpagyecrdwigpnd..................................
ENSTTRP00000011644  GGK...........................................................................
ENSTTRP00000015837  KSIgfgvdtwvysniidpe...........................................................
ENSTTRP00000010790  GKSykdcvckissdcqlprwhmndffhsflivfrvl..........................................
ENSTTRP00000000781  NMEqphmdsrigwlhnlgdqigkpynssglg...............................................
ENSTTRP00000001468  GKSykecvckissncqlprwhmndffhsflivfrvl..........................................
ENSTTRP00000013136  MGKfhkacfpnstdaepvgdfpcgkeaparlcegdtecreywpgpnf...............................
ENSTTRP00000011644  GKVamrdnnqi...................................................................
ENSTTRP00000012570  KDA...........................................................................
ENSTTRP00000006619  GKSykecvckiaadcnlprwhmhdffhsflivfril..........................................
ENSTTRP00000001468  MGNlrnkclqwppsnsafetnttsffngtrnsngtfvnvtmstfnwkdyieeeghfyvldgqkdpllcgngsdagqcp
ENSTTRP00000002836  MGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvckpgwdgpkh...........................
ENSTTRP00000012822  DYEifdedtktirnnswlyqlamdigtpyqfngsgsgkweg.....................................
ENSTTRP00000002689  E--...........................................................................
ENSTTRP00000013138  MGNlrnkcvvwpinfnesylengtkgfdwdeyinnrtnfytvpgmlepllcgnssdagqcpegyqcmkagrnpny...
ENSTTRP00000010790  MGNlrnkcvwpptnasleehsveknitvnyngtlvnetlvefdwksyvqdsryhyflegfsdallcgnssdagqcpeg
ENSTTRP00000006356  RYLgfgsdawvypdpaqpg...........................................................
ENSTTRP00000005250  MGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsmfnwdeyiedkshfyflegqndallcgnssdagqcp
ENSTTRP00000011644  KGKfyrctdeaksnpeecrglfilykdgdvdnpvvreriwqn....................................
ENSTTRP00000013138  AGKyhycfesseirfeidvnnkteceklmxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxpd
ENSTTRP00000013305  KGNlknkcvknctvvnetanysshekpdfytnkpgtsdpllcgngsdsghcpegyfclktsdnpdf............
ENSTTRP00000016088  KGKfysctdeakhtpqeckgsflvypdgdvsrplvrerlwvn....................................
ENSTTRP00000006619  MGNlrqkcvrwpppfndtnttwygndtwdgqeswasnstfdwdayindegnfyflegsndallcgnssdagrcpegye
ENSTTRP00000002836  GGK...........................................................................
ENSTTRP00000013323  MGNlnqkcvrkdcdsdykdycfekkdstefricgtwmesgacseqfeckhtnknpdy.....................
ENSTTRP00000003295  GGRfnfndgt....................................................................
ENSTTRP00000013305  GDNyrdnrrkisapneew............................................................
ENSTTRP00000010733  EXXxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.......................
ENSTTRP00000003584  GKSykecvckinedctlprwhmndffhsflivfrvl..........................................
ENSTTRP00000013136  GNIaldddtsin..................................................................
ENSTTRP00000006224  RYH...........................................................................
ENSTTRP00000002836  KGKlytcsdsskqteaeckgnyvtykdgevdhpiiqprswen....................................
ENSTTRP00000009920  RYH...........................................................................
ENSTTRP00000013018  KGKmhktcyfigtdivatvenekpspcartgsgrrctingsecrggwpgpnh..........................
ENSTTRP00000002368  RAG...........................................................................
ENSTTRP00000011644  IGKmhktcffadsxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSTTRP00000000825  RIG...........................................................................
ENSTTRP00000011711  RYH...........................................................................
ENSTTRP00000005250  ---...........................................................................
ENSTTRP00000013305  AYVkweagi.....................................................................
ENSTTRP00000003295  KGKffyctdsskdtekecignyvdheknkmevkgrewkr.......................................
ENSTTRP00000002153  NYEgigttrwvy..................................................................
ENSTTRP00000000364  GRLecsednpcegls...............................................................
ENSTTRP00000016088  XXXxxxxxxxxxxxxxxxxxxxxxxxxxxcatgeawqeimlaslpgsrcdpesdfgpgeefs................
ENSTTRP00000006664  RQT...........................................................................
ENSTTRP00000002958  LLH...........................................................................
ENSTTRP00000008624  G--...........................................................................
ENSTTRP00000009742  H--...........................................................................
ENSTTRP00000000400  KQAeaqsrdqfqfeklrflenytcldqqaveqfvqvimeawvkgvnpkgnst..........................
ENSTTRP00000000399  SPAahdsserfqrdkwallrnftcldgpaldslirgviqayqngdivldnt...........................
ENSTTRP00000011701  QPFessqkntiamekaeflrdhvcvspqeletliqhaldadnagvspignss..........................
ENSTTRP00000012365  DD-...........................................................................
ENSTTRP00000001716  YGR...........................................................................
ENSTTRP00000003616  AGTfyecieptsgerfpisevmnrsqceslvfnesmpwen......................................
ENSTTRP00000005061  VAH...........................................................................
ENSTTRP00000009742  SEPemierqrlelrqqelrarynlsqggyeelervvlrlkph....................................
ENSTTRP00000008624  QPHeisqrttiviqkqtfisqhacvnsteldeliqqivaainagiiplgnts..........................
ENSTTRP00000003072  KAVgfgndtwvypdvndpe...........................................................
ENSTTRP00000009040  YIR...........................................................................
ENSTTRP00000005008  YIR...........................................................................
ENSTTRP00000013018  KGKffscndlskmteeecrgyyyvykdgdptqvelrprqwth....................................
ENSTTRP00000014295  FAH...........................................................................
ENSTTRP00000007445  SLH...........................................................................
ENSTTRP00000000398  EPHwkeakknyytqklhllkefpclgqegldkilqivsdaagqgvaitgn............................
ENSTTRP00000000398  E--...........................................................................
ENSTTRP00000003616  GSNykiyvcnigedcqlprwhmrdflhsflnvfril..........................................
ENSTTRP00000009762  G--...........................................................................
ENSTTRP00000000629  AGLlrnrcfleenftiqgdvalppyyqpeeddempficslsgdngimgcheipplkeqgrecclskddvydfgagrqd
ENSTTRP00000003616  AYVkkeagi.....................................................................
ENSTTRP00000003528  YTR...........................................................................
ENSTTRP00000002957  FHH...........................................................................
ENSTTRP00000012888  G--...........................................................................
ENSTTRP00000009192  RPHedrlraelqtlrqqllqrspcvaapaldafvermlaagrlgraalanasgsan......................
ENSTTRP00000004010  SPGeaeararwgatlrnfsaahgvaepelraflrhyeaalaagvra................................
ENSTTRP00000009192  EA-...........................................................................
ENSTTRP00000001715  VAH...........................................................................
ENSTTRP00000014553  FIH...........................................................................
ENSTTRP00000006420  CFV...........................................................................
ENSTTRP00000000399  G--...........................................................................
ENSTTRP00000000400  G--...........................................................................
ENSTTRP00000004010  G--...........................................................................
ENSTTRP00000011356  --Vkardrewkk..................................................................
ENSTTRP00000011356  GGQfnfdegt....................................................................
ENSTTRP00000006319  R--...........................................................................
ENSTTRP00000003616  MGNlkhkclrwpqenetetlhnrtgnpyyiretenfyylegeryallcgnrtdagqcpegyvcvkagvnpdy......
ENSTTRP00000010014  ---...........................................................................
ENSTTRP00000004968  Q--...........................................................................
ENSTTRP00000008933  MGNlrhkcvrnftvlsgtngsveagglwesldlyldpenyllkngtsdvllcgnssdagtcpegyrclkagenpdh..
ENSTTRP00000002091  ---...........................................................................
ENSTTRP00000004968  GSQdlgaddpefeefleklcdilkcnrtveegrkrglgkllqkvkpqwf.............................
ENSTTRP00000007963  AYEglgsthwv...................................................................
ENSTTRP00000012888  LAHerqakqrweerlanfsrrhnlsrdelrgflrhyeeateagirvd...............................
ENSTTRP00000010014  ---...........................................................................
ENSTTRP00000006420  GTFtyhcvvndtkpgnvtwnslaipdthcspeleegyqcppgfkcmdledlglsrqel....................
ENSTTRP00000013323  ---...........................................................................
ENSTTRP00000000582  GAF...........................................................................
ENSTTRP00000006420  AGKlakcndpniirredcngifrinvsvsknlnlklrpgekkpgfwvprvwanp........................
ENSTTRP00000002134  GD-...........................................................................
ENSTTRP00000013136  K--...........................................................................
ENSTTRP00000016088  ---...........................................................................
ENSTTRP00000000047  ---...........................................................................
ENSTTRP00000009762  QPHeqqaqrelgevrekflrahpcvsdqdlglfikevadalggganpdtnstrn........................
ENSTTRP00000010378  ---...........................................................................
ENSTTRP00000004338  CGIlypnccntstvadayrwlnhtvdnrtvveegyy..........................................
ENSTTRP00000007759  ---...........................................................................
ENSTTRP00000006420  GTVkygenin....................................................................
ENSTTRP00000011228  RGVivapgnsslapdngsapcgsfeqley.................................................
ENSTTRP00000016320  ---...........................................................................
ENSTTRP00000014317  ---...........................................................................
ENSTTRP00000011228  --Xxxxxxxxxxxxxxxxxxxxxxxqdrr.................................................
ENSTTRP00000004338  SPN...........................................................................
ENSTTRP00000014427  G--...........................................................................
ENSTTRP00000005277  YIH...........................................................................
ENSTTRP00000001972  ---...........................................................................
ENSTTRP00000008933  GKNyselrhrisdpgvlprwhmmdffhafliifril..........................................
ENSTTRP00000002589  DNNeeprdpqspp.................................................................
ENSTTRP00000011285  GT-...........................................................................
ENSTTRP00000011701  ---...........................................................................
ENSTTRP00000005251  SRFspyewhseefeegrdqtts........................................................
ENSTTRP00000006684  EPEdgkegpsd...................................................................


                                               160                                 170       180    
                                                 |                                   |         |    
d1orqc_               ..........................PN...........S...............SIKSVFDALWWAVVTATTVGY.G
ENSTTRP00000010419  ..........................AE...........S...............HFSSIPDAFWWAVVSMTTVGY.G
ENSTTRP00000004039  ..........................DD...........T...............KFKSIPASFWWATITMTTVGY.G
ENSTTRP00000006570  ..........................PT...........T...............HFQSIPDAFWWAVVTMTTVGY.G
ENSTTRP00000006832  ..........................DD...........S...............LFPSIPDAFWWAVVTMTTVGY.G
ENSTTRP00000012947  ..........................NK...........T...............NFTSIPAAFWYTIVTMTTLGY.G
ENSTTRP00000009306  ..........................PE...........S...............HFSSIPDGFWWAVVTMTTVGY.G
ENSTTRP00000015380  ..........................SA...........S...............KFTSIPAAFWYTIVTMTTLGY.G
ENSTTRP00000012489  ..........................PE...........T...............LFKSIPQSFWWAIITMTTVGY.G
ENSTTRP00000004829  ..........................SA...........S...............KFTSIPASFWYTIVTMTTLGY.G
ENSTTRP00000015083  ..........................HT...........S...............SLTSIPVCWWWATISMTTVGY.G
ENSTTRP00000001235  ..........................DH...........T...............DFKNIPIGFWWAVVTMTTLGY.G
ENSTTRP00000012542  ..........................EH...........T...............QFKNIPIGFWWAVVTMTTLGY.G
ENSTTRP00000006964  ..........................RG...........T...............NFTSIPHAWWWAAVSISTVGY.G
ENSTTRP00000002262  ..........................NH...........T...............YFKNIPIGFWWAVVTMTTLGY.G
ENSTTRP00000004325  ..........................DA...........T...............KFTSIPASFWWATITMTTVGY.G
ENSTTRP00000007208  ..........................ED...........V...............GFDTIPACWWWGTVSMTTVGY.G
ENSTTRP00000010081  ..........................ADs..........P...............EFTSIPACYWWAVITMTTVGY.G
ENSTTRP00000013879  ..........................RE...........S...............QFPSIPDAXXXXXXXXXXVGY.G
ENSTTRP00000012173  ..........................GRv..........L...............EFTSIPASYWWAVISMTTVGY.G
ENSTTRP00000012038  ..........................SN...........K...............DFASIPAACWWVIISMTTVGY.G
ENSTTRP00000013799  ..........................PD...........T...............TFTSVPCAWWWATTSMTTVGY.G
ENSTTRP00000013153  ..........................EH...........T...............HFKNIPIGFWWAVVTMTTLGY.G
ENSTTRP00000014995  ..........................NK...........E...............F-STYADALWWGTITLTTIGY.G
ENSTTRP00000001573  ..........................GP...........S...............VQDKYVTALYFTFSSLTSVGF.G
ENSTTRP00000005694  ..........................GP...........S...............IKDKYVTALYFTFSSLTSVGF.G
ENSTTRP00000014511  ..........................GP...........S...............KDSLYVSSLYFTMTSLTTIGF.G
ENSTTRP00000008933  ..........................VK...........V...............NFDNVGAGYLALLQVATFKGW.M
ENSTTRP00000006619  ..........................VK...........V...............NYDNVGLGYLSLLQVATFKGW.M
ENSTTRP00000012773  ..........................PEvdaqgeemk..E...............EFETYADALWWGLITLATIGY.G
ENSTTRP00000000204  ..........................HK...........Y...............NFDNLGQALMSLFVLASKDGW.V
ENSTTRP00000013305  ..........................VK...........V...............NFDNVAMGYLALLQVATFKGW.M
ENSTTRP00000000629  ..........................HK...........Y...............NFDNLGQALMSLFVLASKDGW.V
ENSTTRP00000013138  ..........................KHeagiddm....F...............NFETFGNSMICLFQITTSAGW.D
ENSTTRP00000010790  ..........................VK...........V...............NFDNVGFGYLSLLQVATFKGW.M
ENSTTRP00000000364  ..........................RK...........Y...............NFDNLGQALMSLFVLSSKDGW.V
ENSTTRP00000005250  ..........................KRevgiddm....F...............NFETFGNSMICLFQITTSAGW.D
ENSTTRP00000004176  ..........................GAr..........R...............DFSSVPASYWWAVISMTTVGY.G
ENSTTRP00000000364  ..........................DR...........K...............NFDSLLWAIVTVFQILTQEDW.N
ENSTTRP00000010790  ..........................KRevgiddm....F...............NFETFGNSMICLFQITTSAGW.D
ENSTTRP00000000629  ..........................DR...........K...............NFDSLLWAIVTVFQILTQEDW.N
ENSTTRP00000003584  ..........................KKeagindm....F...............NFETFGNSMICLFQITTSAGW.D
ENSTTRP00000000204  ..........................DR...........K...............NFDSLLWAIVTVFQILTQEDW.N
ENSTTRP00000006619  ..........................KKesgiddm....F...............NFETFGNSIICLFEITTSAGW.D
ENSTTRP00000014856  ..........................NN...........S...............WGRQYSYALFKAMSHMLCIGY.G
ENSTTRP00000008933  ..........................DDm..........F...............NFQTFANSMLCLFQITTSAGW.D
ENSTTRP00000005715  ..........................YG...........R...............LSRKYIYSLYWSTLTLTTIG-.E
ENSTTRP00000016088  ..........................GI...........T...............NFDNFFFAMLTVFQCITMEGW.T
ENSTTRP00000011516  ..........................ND...........S...............WGKQYSYALFKAMSHMLCIGY.G
ENSTTRP00000008973  ..........................NY...........S...............WGRQYSHALFKAMSHMLCIGY.G
ENSTTRP00000001468  ..........................KKeagiddm....F...............NFETFGNSMICLFQITTSGGW.D
ENSTTRP00000013323  ..........................N-...........RsqcesgnfswftlkvNFDNVGMAYLALLQVATFKGW.M
ENSTTRP00000002836  ..........................RN...........N...............NFQTFPQAVLLLFRCATGEAW.Q
ENSTTRP00000003584  ..........................DG...........H...............RFLQVVE------NVATFKGW.M
ENSTTRP00000001468  ..........................VK...........V...............NFDNVGAGYLALLQVATFKGW.M
ENSTTRP00000000204  .....tcvnwnqyytncsagehnpfkGA...........I...............NFDNIGYAWIAIFQVITLEGW.V
ENSTTRP00000000364  .garhtcinwnqyynvcrsgdsnphnGA...........I...............SFDNIGYAWIAIFQVITLEGW.V
ENSTTRP00000013136  ..........................PT...........T...............NFDTFPAAILTVFQXXTGEDW.N
ENSTTRP00000011356  ..........................EH...........N...............NFRTFFQALMLLFRSATGEAW.H
ENSTTRP00000008021  ..........................GP...........S...............IRSAYIAALYFTLSSLTSVGF.G
ENSTTRP00000013018  ..........................YDfedtevrr...S...............NFDNFPQALITVFQVLTAEDW.N
ENSTTRP00000011356  ..........................NGi..........T...............QFDNILFAVLTVFQCITMEGW.T
ENSTTRP00000003295  ..........................RH...........N...............NFRSFFGSLMLLFRSATGEAW.Q
ENSTTRP00000005250  ..........................CG...........E...............WIETMWDCMEVAGQTMCL---.-
ENSTTRP00000001723  ..........................EN...........D...............HFDTYADALWWGLITLTTIGY.G
ENSTTRP00000013323  ..........................DDi..........F...............NFKTFKGSMLCLFQITTSAGW.D
ENSTTRP00000013138  ..........................CG...........E...............WIETMWDCMEVAGQAMCL---.-
ENSTTRP00000000629  ..........................RH...........A...............TFENFGMAFLTLFQVSTGDNW.N
ENSTTRP00000013018  ..........................RN...........N...............NFQTFPQAVLLLFRCATGEAW.Q
ENSTTRP00000000204  ..........................RH...........A...............TFRNFGMAFLTLFRVSTGDNW.N
ENSTTRP00000003584  ..........................GY...........T...............SFDTFSWAFLALFRLMTQDYW.E
ENSTTRP00000001827  ..........................DPwlkgrn.....S...............QNISYFESIYLVMATTSTVGF.G
ENSTTRP00000003295  ..........................GI...........T...............QFDNILFAVLTVFQCITMEGW.T
ENSTTRP00000011644  ..........................FNfdetqtkr...S...............TFDNFPQALLTVFQILTGEDW.N
ENSTTRP00000015837  ..........................YG...........Y...............LSRECIYCLYWSTLTLTTIG-.V
ENSTTRP00000010790  ..........................CG...........E...............WIETMWDCMEVAGQAMCL---.-
ENSTTRP00000000781  ..........................GP...........S...............IKDKYVTALYFTFSSLTSVGF.G
ENSTTRP00000001468  ..........................CG...........E...............WIETMWDCMEVAGQTMCL---.-
ENSTTRP00000013136  ..........................GI...........T...............NFDNILFAVLTVFQCITMEGW.T
ENSTTRP00000011644  ..........................NR...........N...............NNFQTFPAVLLLFRCATGEAW.Q
ENSTTRP00000012570  ..........................VNesgq.......V...............EFGSYADALWWGVVTVTTIGY.G
ENSTTRP00000006619  ..........................CG...........E...............WIETMWDCMEVAGQAMCL---.-
ENSTTRP00000001468  ............egyicvkagrnpnyGY...........T...............SFDTFSWAFLSLFRLMTQDYW.E
ENSTTRP00000002836  ..........................GI...........T...............NFDNFAFAMLTVFQCITMEGW.T
ENSTTRP00000012822  ..........................GP...........S...............KNSVYISSLYFTMTSLTSVGF.G
ENSTTRP00000002689  ..........................--...........-...............--WSFFHAYYYCFITLTTIGF.G
ENSTTRP00000013138  ..........................GY...........T...............SFDTFSWAFLALFRLMTQDYW.E
ENSTTRP00000010790  ..............ymcvkagrnpnyGY...........T...............SFDTFSWAFLSLFRLMTQDFW.E
ENSTTRP00000006356  ..........................FE...........Q...............LWRQYLYSFHFSTLILTTVG-.D
ENSTTRP00000005250  ............egyicvkagrnpnyGY...........T...............SFDTFSWAFLSLFRLMTQDFW.E
ENSTTRP00000011644  ..........................SD...........F...............NFDNVLSAMMALFTVSTFEGW.P
ENSTTRP00000013138  .........................eQP...........K...............YEDNI----------------.-
ENSTTRP00000013305  ..........................NY...........T...............SFDSFAWAFLSLFRLMTQDSW.E
ENSTTRP00000016088  ..........................SD...........F...............NFDNVLSAMMALFTVSTFEGW.P
ENSTTRP00000006619  ................cikagrnpnyGY...........T...............SYDTFSWAFLALFRLMTQDYW.E
ENSTTRP00000002836  ..........................FNfdemqtrr...S...............TFDNFPQSLLTVFQILTGEDW.N
ENSTTRP00000013323  ..........................NY...........T...............NFDSFGWSFLAVFRLMTQDSW.E
ENSTTRP00000003295  ..........................PS...........A...............NFDTFPAAIMTVFQ-------.-
ENSTTRP00000013305  ..........................PR...........W...............HMHDFFHSFLIVFRILCGEWI.E
ENSTTRP00000010733  ..........................NH...........S...............WSELYSFALFKAMSHMLCIGY.G
ENSTTRP00000003584  ..........................CG...........E...............WIETMWDCMEVAGQAMCL---.-
ENSTTRP00000013136  ..........................RH...........N...............NFRTFLQALMLLFRSATGEAW.H
ENSTTRP00000006224  ..........................DQq..........D...............VTSNFLGAMWLISITFLSIGY.G
ENSTTRP00000002836  ..........................SK...........F...............DFDNVLAAMMALFTVSTFEGW.P
ENSTTRP00000009920  ..........................DQq..........D...............VTSNFLGAMWLISITFLSIGY.G
ENSTTRP00000013018  ..........................GI...........T...............HFDNFGFSMLTVYQCITMEGW.T
ENSTTRP00000002368  ..........................GN...........-...............--LSLLTSFYFCIVTFSTVGY.G
ENSTTRP00000011644  ........................xvND...........A...............IGWEW----------------.-
ENSTTRP00000000825  ..........................KK...........-...............--LNLFDSLYFCIVTFSTVGF.G
ENSTTRP00000011711  ..........................DKq..........E...............VTSNFLGAMWLISITFLSIGY.G
ENSTTRP00000005250  ..........................--...........-...............---------------------.-
ENSTTRP00000013305  ..........................DDm..........F...............NFQTFANSMLCLFQITTSAGWdG
ENSTTRP00000003295  ..........................HE...........F...............HYDNIIWALLTLFTVSTGEGW.P
ENSTTRP00000002153  ..........................DG...........E...............G-NKYLRCYYWAVRTLITIG-.G
ENSTTRP00000000364  ..........................RH...........A...............TFSNFGMAFLTLFRVSTGDNW.N
ENSTTRP00000016088  ..........................C-...........-...............---------------------.-
ENSTTRP00000006664  ..........................VN...........A...............T-GHLSDTLWLIPITFLTIGY.G
ENSTTRP00000002958  ..........................GDldaskegkacvS...............EVNSFTAAFLFSIETQTTIGY.G
ENSTTRP00000008624  ..........................--...........-...............--WSALDAIYFVVITLTTIGF.G
ENSTTRP00000009742  ..........................--...........-...............--WTFFQAYYYCFITLTTIGF.G
ENSTTRP00000000400  ..........................NP...........S...............N-WDFGSSFFFAGTVVTTIGY.G
ENSTTRP00000000399  ..........................TS...........M...............GRWEFVGSFFFSVSTITTIGY.G
ENSTTRP00000011701  ..........................NN...........S...............SHWDLGSAFFFAGTVITTIGY.G
ENSTTRP00000012365  ..........................--...........-...............--WNFLESFYFCFISLSTIGL.G
ENSTTRP00000001716  ..........................GD...........Lehledtawtpcvn..NLNGFVAAFLFSIETETTIGY.G
ENSTTRP00000003616  ..........................AK...........L...............NFDNVGISFLSLLQVATFNGW.I
ENSTTRP00000005061  ..........................GD...........Lepaegrgrtpcvl..QVHGFMAAFLFSIETQTTIGY.G
ENSTTRP00000009742  ..........................KA...........G...............VQWRFAGSFYFAITVITTIGY.G
ENSTTRP00000008624  ..........................NQ...........I...............SHWDLGSSFFFAGTVITTIGF.G
ENSTTRP00000003072  ..........................FG...........R...............LARKYVYSLYWSTLTLTTIG-.E
ENSTTRP00000009040  ..........................GD...........Ldhigdrewipcve..NLSGFVSAFLFSIETETTIGY.G
ENSTTRP00000005008  ..........................GD...........Mdhiedpswtpcvt..NLNGFVSAFLFSIETETTIGY.G
ENSTTRP00000013018  ..........................SN...........F...............HFDNVLSAMMSLFTVSTFEGW.P
ENSTTRP00000014295  ..........................GD...........Lapgegaavpcvt...SIHSFSSAFLFSIEVQVTIGF.G
ENSTTRP00000007445  ..........................GDlaappptapcfS...............QVASFLAAFLFALETQTSIGY.G
ENSTTRP00000000398  ..........................QT...........F...............NNWNWPNAMIFAATVITTIGY.G
ENSTTRP00000000398  ..........................--...........-...............--WDYIEGLYYSFITISTIGF.G
ENSTTRP00000003616  ..........................CG...........E...............WIETLWDCF------------.-
ENSTTRP00000009762  ..........................--...........-...............--WSKLEAIYFVVVTLTTVGF.G
ENSTTRP00000000629  lnasglcvnwnryynvcrtgsanphkGA...........I...............NFDNIGYAWIVIFQVITLEGW.V
ENSTTRP00000003616  ..........................NDv..........S...............NFETFGSSMLCLFQVTIFAGW.D
ENSTTRP00000003528  ..........................GD...........Lnkahvgnytpcva..NVYNFPSAFLFFIETEATIGY.G
ENSTTRP00000002957  ..........................GD...........Llndpditpcvd....NVHSFTGAFLFSLETQTTIGY.G
ENSTTRP00000012888  ..........................--...........-...............--WSYFDALYFCFVAFSTIGF.G
ENSTTRP00000009192  ..........................AS...........D...............PAWDFASALFFASTLVTTVGY.G
ENSTTRP00000004010  ..........................D-...........Alr.............PRWDFPGAFYFVGTVVSTIGF.G
ENSTTRP00000009192  ..........................--...........-...............--WSFLDAFYFCFISLSTIGL.G
ENSTTRP00000001715  ..........................GD...........Llelgppanhtpcvv.QVHTLTGAFLFSLESQTTIGY.G
ENSTTRP00000014553  ..........................GD...........Leprehtsnhtpcim.KVDSLTGAFLFSLESQTTIGY.G
ENSTTRP00000006420  ..........................EEl..........D...............RFTTFPRAFMSMFQILTQEGW.V
ENSTTRP00000000399  ..........................--...........-...............--WSYVEGFYFSFITLSTVGF.G
ENSTTRP00000000400  ..........................--...........-...............--WSFSEGFYFAFITLSTIGF.G
ENSTTRP00000004010  ..........................--...........-...............--WDYVDSLYFCFVTFSTIGF.G
ENSTTRP00000011356  ..........................YE...........F...............HYDNVLWALLTLFTVSTGEGW.P
ENSTTRP00000011356  ..........................PP...........T...............NFDTFPAAIMTVFQILTGEDW.N
ENSTTRP00000006319  ..........................--...........-...............---------------------.-
ENSTTRP00000003616  ..........................GY...........T...............NFDSFGWTLLALFRLMMQD-Y.P
ENSTTRP00000010014  ..........................--...........-...............--------------TLTTIGY.G
ENSTTRP00000004968  ..........................--...........-...............--LNFENAFCFCFVTLTTVGF.G
ENSTTRP00000008933  ..........................GY...........T...............SFDSFAWAFLALFRLMTQDCW.E
ENSTTRP00000002091  ..........................--...........-...............---------------------.-
ENSTTRP00000004968  ..........................SG...........S...............ADRSFLSSLFFCCTVGKSRGY.G
ENSTTRP00000007963  ..........................YD...........G...............VGNSYIRCYYWAVKTLITIG-.G
ENSTTRP00000012888  ..........................NV...........R...............LRWDFTGAFYFVGTVVSTIGF.G
ENSTTRP00000010014  ..........................--...........-...............---------------------.-
ENSTTRP00000006420  ..........................GY...........S...............GFNEIGTSIFTVYEAASQEGW.V
ENSTTRP00000013323  ..........................--...........-...............---------------------.-
ENSTTRP00000000582  ..........................VP...........M...............HFQNMQVALYTLFICITQDGW.V
ENSTTRP00000006420  ..........................RN...........F...............NFDNVGNAMLALFEVLSLKGW.V
ENSTTRP00000002134  ..........................--...........-...............--CGMLQAIYFCFSSLSTIGL.G
ENSTTRP00000013136  ..........................--...........-...............---------------------.G
ENSTTRP00000016088  ..........................--...........-...............---------------------.-
ENSTTRP00000000047  ..........................GP...........S...............LRSAYITSLYFALSSLTSVGF.G
ENSTTRP00000009762  ..........................SN...........H...............SAWDLGSAFFFSGTIITTIXX.X
ENSTTRP00000010378  ..........................--...........-...............-ITSFTAAFSFSLETQLTFGY.G
ENSTTRP00000004338  ..........................YL...........N...............NFDNILNSFVTLFELTVVNNW.Y
ENSTTRP00000007759  ..........................--...........-...............---------------------.-
ENSTTRP00000006420  ..........................RH...........A...............NFSSAGKAITVLFRIVTGEDW.N
ENSTTRP00000011228  ..........................WT...........N...............NFDDF----------------.-
ENSTTRP00000016320  ..........................--...........-...............---------------------.-
ENSTTRP00000014317  ..........................--...........-...............---------------------.-
ENSTTRP00000011228  ..........................DRqrl........T...............YFRNLPEALTSLLVLLTTANN.S
ENSTTRP00000004338  ..........................PSd..........P...............YFSTLENSIVSLFVLLTTANF.P
ENSTTRP00000014427  ..........................--...........-...............---------------------.-
ENSTTRP00000005277  ..........................--...........-...............---------------------.-
ENSTTRP00000001972  ..........................--...........-...............---TLSSAMWFSWGVLLNSGI.G
ENSTTRP00000008933  ..........................CG...........E...............WIETMWDCMEVSGQSLCL---.-
ENSTTRP00000002589  ..........................DP...........P...............NEFGIFNSLWFSLGAFMQQG-.C
ENSTTRP00000011285  ..........................QV...........E...............SFNTFIKCIFTQFRIIL----.G
ENSTTRP00000011701  ..........................--...........-...............---------------------.-
ENSTTRP00000005251  ..........................DQ...........S...............NEFGIFNSLWFSLGAFMQQG-.C
ENSTTRP00000006684  ..........................QP...........P...............NEFGIFNSLWFSLGAFMQQG-.C


                                             190                                                    
                                               |                                                    
d1orqc_               D..VV.P................ATPIGK.................................................
ENSTTRP00000010419  D..MY.P................VTIGGK.................................................
ENSTTRP00000004039  D..IY.P................KTLLGK.................................................
ENSTTRP00000006570  D..MK.P................ITVGGK.................................................
ENSTTRP00000006832  D..MY.P................MTVGGK.................................................
ENSTTRP00000012947  D..MV.P................STIAGK.................................................
ENSTTRP00000009306  D..MC.P................TTPGGK.................................................
ENSTTRP00000015380  D..MV.P................KTIAGK.................................................
ENSTTRP00000012489  D..IY.P................KTTLGK.................................................
ENSTTRP00000004829  D..MV.P................KTIAGK.................................................
ENSTTRP00000015083  D..TH.P................VTLAGK.................................................
ENSTTRP00000001235  D..MY.P................KTWSGM.................................................
ENSTTRP00000012542  D..MY.P................QTWSGM.................................................
ENSTTRP00000006964  D..MY.P................ETHLGR.................................................
ENSTTRP00000002262  D..MY.P................KTWSGM.................................................
ENSTTRP00000004325  D..IY.P................KTLLGK.................................................
ENSTTRP00000007208  D..VV.P................VTVAGK.................................................
ENSTTRP00000010081  D..MV.P................RSTPGQ.................................................
ENSTTRP00000013879  D..MV.P................TTIGGK.................................................
ENSTTRP00000012173  D..MV.P................SSVPGQ.................................................
ENSTTRP00000012038  D..MY.P................ITMPGR.................................................
ENSTTRP00000013799  D..IR.P................DTTTGK.................................................
ENSTTRP00000013153  D..MY.P................QTWSGM.................................................
ENSTTRP00000014995  D..KT.P................LTWLGR.................................................
ENSTTRP00000001573  N..VS.P................NTNSEK.................................................
ENSTTRP00000005694  N..VS.P................NTNSEK.................................................
ENSTTRP00000014511  N..IA.P................TTDVEK.................................................
ENSTTRP00000008933  D..IM.Y................AAVDSRgyeeqpqweynlymyi.................................
ENSTTRP00000006619  D..IM.Y................AAVDSRekeeqpqyevniymyl.................................
ENSTTRP00000012773  D..KT.P................KTWEGR.................................................
ENSTTRP00000000204  D..IM.Y................DGLDAVgvdqqpimnhnpwmll.................................
ENSTTRP00000013305  D..IM.Y................AAVDSRevnmqpkwednvymyl.................................
ENSTTRP00000000629  N..IM.Y................NGLDAVavdqqpvpnhnpwmll.................................
ENSTTRP00000013138  G..LLlPilnrpp..........DCSLDKehpgsgfkgdcgnpsvgif..............................
ENSTTRP00000010790  D..IM.Y................AAVDSRnvelqpkyeeslymyl.................................
ENSTTRP00000000364  N..IM.Y................DGLDAVgidqqpvpnhnpwmll.................................
ENSTTRP00000005250  G..LL.Apilnsgpp........DCDPEKdhpgssvkgdcgnpsvgif..............................
ENSTTRP00000004176  D..MV.P................RSLPGQ.................................................
ENSTTRP00000000364  V..VL.Yngmast..........SSWAAL.................................................
ENSTTRP00000010790  G..LL.A................PILNSKppdcdpnkvnpgssvkgdcgnpsvgif......................
ENSTTRP00000000629  V..VL.Yngmast..........SPWASL.................................................
ENSTTRP00000003584  G..LL.Apilnsapp........D----Cdprkvhpgssvegdcgnpsvgif..........................
ENSTTRP00000000204  K..VL.Yngmast..........SSWAAL.................................................
ENSTTRP00000006619  G..LLnPiln.............S---GPpdcdpalenpgtsvrgdcgnpsigic.......................
ENSTTRP00000014856  R..QA.P................VGMSDV.................................................
ENSTTRP00000008933  G..LL.Spiln............TGPPYCdptlpnsngsrgncgspavgil...........................
ENSTTRP00000005715  T..PP.P................VKDEEY.................................................
ENSTTRP00000016088  D..VL.Ywmqdamg.........YELPWV.................................................
ENSTTRP00000011516  A..QA.P................VSMSDL.................................................
ENSTTRP00000008973  Q..QA.P................VGMPDV.................................................
ENSTTRP00000001468  V..LL.Apiln............S----Appdcdpdtihpgssvkgdcgnpsvgif......................
ENSTTRP00000013323  D..IM.YaavdsrgegqqprfeeNSLMYV.................................................
ENSTTRP00000002836  D..IM.L................ACMPGKkcapesepgssaegeapcgssfavf........................
ENSTTRP00000003584  V..IM.YaavdsvnvdrqpiyeySLYMYI.................................................
ENSTTRP00000001468  D..IM.Y................AAVDSRdvklqpvyeenlymyl.................................
ENSTTRP00000000204  D..IM.Yfvmdah..........SFYNFI.................................................
ENSTTRP00000000364  D..IM.Yyvmdah..........SFYNFI.................................................
ENSTTRP00000013136  A..VM.Y................HGIESQggvskgmssv.......................................
ENSTTRP00000011356  N..IM.L................SCLSGKpcdknsgilthecgnefayf.............................
ENSTTRP00000008021  N..VS.A................NTDAEK.................................................
ENSTTRP00000013018  S..VM.Y................DGIMAYggptypgvlvci.....................................
ENSTTRP00000011356  D..LL.Ynsndasg.........NTWNWL.................................................
ENSTTRP00000003295  E..IM.L................SCLGEKgcepdttapsgqsesercgtdlayv........................
ENSTTRP00000005250  -..--.-................-----T.................................................
ENSTTRP00000001723  D..KY.P................QTWNGR.................................................
ENSTTRP00000013323  A..LL.S................PMLQSKdscnpksencylsaiait...............................
ENSTTRP00000013138  -..--.-................-----I.................................................
ENSTTRP00000000629  G..IM.N................DTLRDCthdersclsslqfvspl................................
ENSTTRP00000013018  E..IL.L................ACSYGQlcdpesdyapgeertcgtdfayy..........................
ENSTTRP00000000204  G..IM.K................DTLRDCdqestcyntvispi...................................
ENSTTRP00000003584  N..LY.Q................QTLRAAgktymi...........................................
ENSTTRP00000001827  D..VV.A................KTSLGR.................................................
ENSTTRP00000003295  T..VL.Yntndalg.........ATWNWL.................................................
ENSTTRP00000011644  A..VM.Y................DGIMAYggpsssgmivci.....................................
ENSTTRP00000015837  T..PP.P................VKDEEY.................................................
ENSTTRP00000010790  -..--.-................-----T.................................................
ENSTTRP00000000781  N..VS.P................NTNSEK.................................................
ENSTTRP00000001468  -..--.-................-----I.................................................
ENSTTRP00000013136  D..IL.Yntndaag.........NTWNWL.................................................
ENSTTRP00000011644  E..IM.L................ACLPGKlcdpesdynpgeeytcgsnfaiv..........................
ENSTTRP00000012570  D..KV.P................QTWVGK.................................................
ENSTTRP00000006619  -..--.-................-----T.................................................
ENSTTRP00000001468  N..LY.Q................LTLRAAgktymi...........................................
ENSTTRP00000002836  D..VL.Ywmqdamg.........YELPWV.................................................
ENSTTRP00000012822  N..IA.P................STDIEK.................................................
ENSTTRP00000002689  D..YV.Alqtkgalq........RKPLYV.................................................
ENSTTRP00000013138  N..LY.Q................LTLRAAgktymi...........................................
ENSTTRP00000010790  N..LY.Q................LTLRAAgktymi...........................................
ENSTTRP00000006356  T..PL.P................DREEEY.................................................
ENSTTRP00000005250  N..LY.Q................LTLRAAgktymi...........................................
ENSTTRP00000011644  A..LL.Y................KAIDSNgenvgpiynyrveisi.................................
ENSTTRP00000013138  -..--.-................--YMYI.................................................
ENSTTRP00000013305  R..LY.Q................QTLRASgkiymf...........................................
ENSTTRP00000016088  A..LL.Y................KAIDANaenkgpiynyhveisv.................................
ENSTTRP00000006619  N..LF.Q................LTLRAAgktymi...........................................
ENSTTRP00000002836  S..VM.Ydgimaygg........PSFPGM.................................................
ENSTTRP00000013323  K..LY.Q................QTLRTSglysvf...........................................
ENSTTRP00000003295  -..--.-................------.................................................
ENSTTRP00000013305  N..MW.Acmevgq..........KSICLI.................................................
ENSTTRP00000010733  R..QA.P................ESMTDI.................................................
ENSTTRP00000003584  -..--.-................------.................................................
ENSTTRP00000013136  E..IM.L................SCLGSRacdalanaaecesdfayf...............................
ENSTTRP00000006224  D..MV.P................HTYCGK.................................................
ENSTTRP00000002836  E..LL.Y................RSIDSHtedkgpiynyrveisv.................................
ENSTTRP00000009920  D..MV.P................NTYCGK.................................................
ENSTTRP00000013018  D..VL.Ywvndaig.........NEWPWI.................................................
ENSTTRP00000002368  D..VT.P................KIWPSQ.................................................
ENSTTRP00000011644  -..--.-................---PWV.................................................
ENSTTRP00000000825  D..VT.P................ETWSSK.................................................
ENSTTRP00000011711  D..MV.P................HTYCGK.................................................
ENSTTRP00000005250  -..--.-................------.................................................
ENSTTRP00000013305  L..LS.Piln.............TGPPYCdpnlpnsngtrgdcgnpivgil...........................
ENSTTRP00000003295  Q..VL.Q................HSVDVTeedrgpsrsnrmemsi.................................
ENSTTRP00000002153  L..PE.P................QTSFEI.................................................
ENSTTRP00000000364  G..IM.K................DT----.................................................
ENSTTRP00000016088  -..--.-................-----Gsnfaia...........................................
ENSTTRP00000006664  D..VV.P................GTTWGK.................................................
ENSTTRP00000002958  F..RC.Vtd..............ECPVAV.................................................
ENSTTRP00000008624  D..YV.Aggsdie..........YLDFYK.................................................
ENSTTRP00000009742  D..YV.Alqkdqalq........TQPQYV.................................................
ENSTTRP00000000400  N..LA.P................STEAGQ.................................................
ENSTTRP00000000399  N..LS.P................RTMGAR.................................................
ENSTTRP00000011701  N..IA.P................STEGGK.................................................
ENSTTRP00000012365  D..YV.Pgegynqk.........FRELYK.................................................
ENSTTRP00000001716  H..RV.Itd..............QCPEGI.................................................
ENSTTRP00000003616  T..IM.N................SAVDSIgvdmqpnfedniymcc.................................
ENSTTRP00000005061  L..RC.Vte..............ECPVAV.................................................
ENSTTRP00000009742  H..AA.P................STDGGK.................................................
ENSTTRP00000008624  N..IS.P................RTEGGK.................................................
ENSTTRP00000003072  T..PP.P................VRDSEY.................................................
ENSTTRP00000009040  F..RV.Ite..............KCPEGI.................................................
ENSTTRP00000005008  Y..RV.Itd..............KCPEGI.................................................
ENSTTRP00000013018  E..LL.Y................RAIDSHeedkgpvynerpemav.................................
ENSTTRP00000014295  G..RM.Vte..............ECPLAI.................................................
ENSTTRP00000007445  V..RS.Vte..............ECPAAV.................................................
ENSTTRP00000000398  N..VA.P................KTPAGR.................................................
ENSTTRP00000000398  D..FV.Agvnpsan.........YHALYR.................................................
ENSTTRP00000003616  -..KV.A................GQFSCI.................................................
ENSTTRP00000009762  D..YV.Agaspnq..........NSAAYQ.................................................
ENSTTRP00000000629  E..IM.Yyvmdah..........SFYNFI.................................................
ENSTTRP00000003616  G..ML.N................AIFNSKwsdcdpdkinpgtqvrgdcgnpfvgiv......................
ENSTTRP00000003528  Y..RY.Itd..............KCPEGI.................................................
ENSTTRP00000002957  S..RC.Vte..............ECSAAV.................................................
ENSTTRP00000012888  D..LV.Ssqnarya.........SQGLYR.................................................
ENSTTRP00000009192  Y..TT.P................LTDGGK.................................................
ENSTTRP00000004010  M..TT.P................ATVGGK.................................................
ENSTTRP00000009192  D..YV.Pgeapgqp.........YRALYK.................................................
ENSTTRP00000001715  F..RY.Ise..............ECPLAI.................................................
ENSTTRP00000014553  VrsIT.E................ECPHAI.................................................
ENSTTRP00000006420  D..VM.D................QTLNAVghmwapvvai.......................................
ENSTTRP00000000399  D..YV.Iemnpsrn.........YPLWYK.................................................
ENSTTRP00000000400  D..YV.V................GTDPSKhyisvyr..........................................
ENSTTRP00000004010  D..LV.Ssqhaayr.........NQGLYR.................................................
ENSTTRP00000011356  Q..VL.K................HSVDATfenqgpspgyrmemsi.................................
ENSTTRP00000011356  E..VM.Y................DGIKSQggvqggmvfsi......................................
ENSTTRP00000006319  -..--.-................------.................................................
ENSTTRP00000003616  E..AL.Yhqi.............LY---Asgkvymi..........................................
ENSTTRP00000010014  D..KT.P................HTWLGR.................................................
ENSTTRP00000004968  D..IA.F................EQPH-F.................................................
ENSTTRP00000008933  R..LY.Q................QTLRSAgkiymi...........................................
ENSTTRP00000002091  -..--.-................------.................................................
ENSTTRP00000004968  N..AC.P................VTRLGK.................................................
ENSTTRP00000007963  L..PD.P................RTLFEI.................................................
ENSTTRP00000012888  M..TT.P................ATVEGK.................................................
ENSTTRP00000010014  -..--.-................------.................................................
ENSTTRP00000006420  F..LM.Yraidsfp.........RWRSYF.................................................
ENSTTRP00000013323  -..--.-................------.................................................
ENSTTRP00000000582  D..IY.S................NFQMETreyaveiggai......................................
ENSTTRP00000006420  E..VR.Dviihrv..........GPMHGI.................................................
ENSTTRP00000002134  D..LL.Pghdnglhpv.......FYYLGQ.................................................
ENSTTRP00000013136  K..FF.Y................CTDESKelerdcxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSTTRP00000016088  -..--.-................------.................................................
ENSTTRP00000000047  N..VS.A................NTDTEK.................................................
ENSTTRP00000009762  X..XX.X................XTDAAR.................................................
ENSTTRP00000010378  T..MF.Psg..............DCPSAI.................................................
ENSTTRP00000004338  I..IM.Egitsq...........TSHWSR.................................................
ENSTTRP00000007759  -..--.-................------.................................................
ENSTTRP00000006420  K..IM.Hdcmv............Q----Ppfctpdeftywatdcgnyagalm..........................
ENSTTRP00000011228  -..--.-................------.................................................
ENSTTRP00000016320  -..--.-................------.................................................
ENSTTRP00000014317  -..--.-................------.................................................
ENSTTRP00000011228  D..VM.Ipaysk...........NRLYAI.................................................
ENSTTRP00000004338  D..VM.Mpsys............RNPWSCv................................................
ENSTTRP00000014427  -..--.-................------.................................................
ENSTTRP00000005277  -..--.-................------.................................................
ENSTTRP00000001972  E..GA.P................RSFSAR.................................................
ENSTTRP00000008933  -..--.-................-----L.................................................
ENSTTRP00000002589  D..IS.P................RSLSGR.................................................
ENSTTRP00000011285  D..FD.Yna..............INNANRilgpa............................................
ENSTTRP00000011701  -..--.-................---WYK.................................................
ENSTTRP00000005251  D..IS.P................RSLSGR.................................................
ENSTTRP00000006684  D..IS.P................RSLSGR.................................................


                                                       200       210           220                  
                                                         |         |             |                  
d1orqc_               .............................VIGIAVMLTGISALTLLIGTVSNMFQ....K---ilv............
ENSTTRP00000010419  .............................IVGSLCAIAGVLTIALPVPVIVSNF-....----n..............
ENSTTRP00000004039  .............................IVGGLCCIAGVLVIALPIPIIVNNFS....E---...............
ENSTTRP00000006570  .............................IVGSLCAIAGVLTIALPVPVIVSNF-....----n..............
ENSTTRP00000006832  .............................IVGSLCAIAGVLTIALPVPVIVSNF-....----n..............
ENSTTRP00000012947  .............................IFGSICSLSGVLVIALPVPVIVSNFS....R---...............
ENSTTRP00000009306  .............................IVGTLCAIAGVLTVALPVPVIVSNF-....----n..............
ENSTTRP00000015380  .............................IFGSICSLSGVLVIALPVPVIVSNFS....R---...............
ENSTTRP00000012489  .............................LNAAISFLCGVIAIALPIHPIINNFV....----r..............
ENSTTRP00000004829  .............................IFGSICSLSGVLVIALPVPVIVSNFS....R---...............
ENSTTRP00000015083  .............................LIASTCIICGILVVALPITIIFNKFS....----k..............
ENSTTRP00000001235  .............................LVGALCALAGVLTIAMPVPVIVNNF-....----...............
ENSTTRP00000012542  .............................LVGALCALAGVLTIAMPVPVIVNNF-....----...............
ENSTTRP00000006964  .............................LFAFLCIAFGIILNGMPISILYNKF-....----s..............
ENSTTRP00000002262  .............................LVGALCALAGVLTIAMPVPVIVNNF-....----...............
ENSTTRP00000004325  .............................IVGGLCCIAGVLVIALPIPIIVNNFS....E---...............
ENSTTRP00000007208  .............................LAASGCILGGILVVALPITIIFNKFS....----hfyr...........
ENSTTRP00000010081  .............................VVALSSILSGILLMAFPVTSIFHTFS....R---...............
ENSTTRP00000013879  .............................IVGSLCAIAGVLTIALPVPVIVSNF-....----n..............
ENSTTRP00000012173  .............................MVALSGILSGILIMAFPATSIFHIF-....----s..............
ENSTTRP00000012038  .............................ILGGVCVVSGIVLLALPITFIYHSF-....----v..............
ENSTTRP00000013799  .............................IVAFMCILSGILVLALPIAIINDRF-....----s..............
ENSTTRP00000013153  .............................LVGALCALAGVLTIAMPVPVIVNNF-....----...............
ENSTTRP00000014995  .............................LLSAGFALLGISFFALPAGILGSGF-....----a..............
ENSTTRP00000001573  .............................VFSICVMLIGSLMYASIFGNVSAIIQ....R---...............
ENSTTRP00000005694  .............................IFSICVMLIGSLMYASIFGNVSAIIQ....R---...............
ENSTTRP00000014511  .............................MFSVAMMMVGSLLYATIFGNVTTIFQ....Q---m..............
ENSTTRP00000008933  .............................YFVIFIIFGSFFTLNLFIGVIIDNFN....Q---qk.............
ENSTTRP00000006619  .............................YFVIFIIFGSFFTLNLFIGVIIDNFQ....QKKK...............
ENSTTRP00000012773  .............................LIAATFSLIGVSFFALPAGILGSG--....----la.............
ENSTTRP00000000204  .............................YFISFLLIVAFFVLNMFVGVVVENFH....K---cr.............
ENSTTRP00000013305  .............................YFIIFIIFGSFFTLNLFVGVIIDNFN....Q---qk.............
ENSTTRP00000000629  .............................YFISFLLIVSFFVLNMFVGVVVENFH....K---cr.............
ENSTTRP00000013138  .............................FFVSYIIISFLIVVNMYIAIILENF-....----s..............
ENSTTRP00000010790  .............................YFVIFIIFGSFFTLNLFIGVIIDNFN....Q---qk.............
ENSTTRP00000000364  .............................YFISFLLIVSFFVLNMFVGVVVENFH....K---cr.............
ENSTTRP00000005250  .............................FFVSYIIISFLVVVNMYIAVILENF-....----s..............
ENSTTRP00000004176  .............................VVALSSILSGILLMAFPVTSIFHTFS....R---...............
ENSTTRP00000000364  .............................YFVALMTFGNYVLFNLLVAILVEGFQ....----...............
ENSTTRP00000010790  .............................FFVSYIIISFLVVVNMYIAVILENF-....----s..............
ENSTTRP00000000629  .............................YFVALMTFGNYVLFNLLVAILVEGFQ....----...............
ENSTTRP00000003584  .............................YFVSYIIISFLVVVNMYIAVILENF-....----s..............
ENSTTRP00000000204  .............................YFIALMTFGNYVLFNLLVAILVEGFQ....----...............
ENSTTRP00000006619  .............................FFCSYIIISFLIVVNMYIAIILENF-....----n..............
ENSTTRP00000014856  .............................WLTMLSMIVGATCYAMFIGHATALIQ....----...............
ENSTTRP00000008933  .............................FFTTYIIISFLIVVNMYIAIILENF-....----s..............
ENSTTRP00000005715  .............................LFVVLDFLVGVLIFATIVGNVGSMIS....----hm.............
ENSTTRP00000016088  .............................YFVSLVIFGSFFVLNLVLGVLSGEFS....KERE...............
ENSTTRP00000011516  .............................WITMLSMIVGATCYAMFVGHATALIQ....----sldssr.........
ENSTTRP00000008973  .............................WLTMLSMIVGATCYAMFIGHATALIQ....----sldssr.........
ENSTTRP00000001468  .............................FFVSYIIISFLVVVNMYIAVILENF-....----s..............
ENSTTRP00000013323  .............................YFVVFIIFGSFFTLNLFIGVIIDNFN....QQQK...............
ENSTTRP00000002836  .............................YFISFYMLCAFLIINLFVAVIMDNF-....----...............
ENSTTRP00000003584  .............................YFVIFIIFGSFFTLNLFIGVIIDNFN....Q---qk.............
ENSTTRP00000001468  .............................YFVIFIIFGSFFTLNLFIGVIIDNFN....Q---qk.............
ENSTTRP00000000204  .............................YFILLIIVGSFFMINLCLVVIATQFS....E---...............
ENSTTRP00000000364  .............................YFILLIIVGSFFMINLCLVVIATQFS....E---...............
ENSTTRP00000013136  .............................YFIVLTLFGNYTLLNVFLAIAVDNL-....----a..............
ENSTTRP00000011356  .............................YFVSFIFLCSFLMLNLFVAVIMDNF-....----e..............
ENSTTRP00000008021  .............................IFSICTMLIG----------------....----x..............
ENSTTRP00000013018  .............................YFIILFVCGNXILLNVFLAIAVDN--....----la.............
ENSTTRP00000011356  .............................YFIPLIIIGSFFMLNLVLGVLSGEFA....KE--r..............
ENSTTRP00000003295  .............................YFVSFIFFCSFLMLNLFVAVIMDNF-....----e..............
ENSTTRP00000005250  .............................VFMMVMVIGNLVVLNLFLALLLSSF-....----s..............
ENSTTRP00000001723  .............................LLAATFTLIGVSFFALPAGILGSGFAlkvqE---qhrqkhfekrrn...
ENSTTRP00000013323  .............................YFVSYIIISFLIVVNMYIAVILENF-....----...............
ENSTTRP00000013138  .............................VFMMVMVIGNLVVLNLFLALLLSSF-....----s..............
ENSTTRP00000000629  .............................YFVSFVLTAQFVLINVVVAVLM----....----kh.............
ENSTTRP00000013018  .............................YFISFYMLCAFLIINLFVAVIMDNF-....----...............
ENSTTRP00000000204  .............................YFVSFVLTAQFVLVNVVIAVLMKHLE....E---sn.............
ENSTTRP00000003584  .............................FFVVVIFLGSFYLINLILAVVAMAYE....EQ--n..............
ENSTTRP00000001827  .............................TFIMFFTLGSLVLFANCIPEMVELFG....----nkr............
ENSTTRP00000003295  .............................YFIPLIIIGSFFVLNLVLGVLSGEFA....KE--r..............
ENSTTRP00000011644  .............................YFIILFICGNYILLNVFLAIAVDNL-....----a..............
ENSTTRP00000015837  .............................LFVIFDFPIGVLIFATIVGNVGSMIS....NM--n..............
ENSTTRP00000010790  .............................VFMMVMVIGNLVVLNLFLALLLSSF-....----s..............
ENSTTRP00000000781  .............................IFSICVMLIGSLMYASIFGNVSAIIQ....R---lysgtaryhtqmlrv
ENSTTRP00000001468  .............................VFMLVMVIGNLVVLNLFLALLLSSF-....----s..............
ENSTTRP00000013136  .............................YFLPLIIIGSFFMLNLVLGVLSGEFA....KE--r..............
ENSTTRP00000011644  .............................YFISFYMLCAFLIINLFVAVIMDNF-....----...............
ENSTTRP00000012570  .............................TIASCFSVFAISFFALPAGILGSGFA....----lkvqqkqrqkhfnr.
ENSTTRP00000006619  .............................VFLMVMVIGNLVVLNLFLALLLSSF-....----s..............
ENSTTRP00000001468  .............................FFVLVIFLGSFYLVNLILAVVAMAYE....EQ--n..............
ENSTTRP00000002836  .............................YFVSLVIFGSFFVLNLVLGVLSGEFS....KERE...............
ENSTTRP00000012822  .............................IFAVAIMMIGSLLYATIFGNVTTIFQ....QM--yantnryhemlnsvr
ENSTTRP00000002689  .............................AFSFMYILVGLTVIGAFLNLVVLR--....----f..............
ENSTTRP00000013138  .............................FFVLVIFVGSFYLVNLILAVVAMAYE....EQ--n..............
ENSTTRP00000010790  .............................FFVLVIFLGSFYLINLILAVVAMAYE....EQ--n..............
ENSTTRP00000006356  .............................LFVVGDFLLAVMGFATIMGSMSS---....----vi.............
ENSTTRP00000005250  .............................FFVLVIFLGSFYLINLILAVVAMAYE....EQ--n..............
ENSTTRP00000011644  .............................FFIIYIIIVAFFMMNIFVGFVIVTFQ....E---q..............
ENSTTRP00000013138  .............................YFVIFIIFGSFFTLNLFIGVIIDNFN....Q---qk.............
ENSTTRP00000013305  .............................FFVLVIFLGSFYLVNLILAVVTMAYE....EQ--n..............
ENSTTRP00000016088  .............................FFIVYIIIIAFFMMNIFVGFVIITF-....----r..............
ENSTTRP00000006619  .............................FFVVIIFLGSFYLINLILAVVAMAYA....E---qn.............
ENSTTRP00000002836  .............................LVCIYFIIL-----------------....----fi.............
ENSTTRP00000013323  .............................FFVVVIFLGSFYLINLTLAVVTMAYE....EQNK...............
ENSTTRP00000003295  .............................--------------------------....----...............
ENSTTRP00000013305  .............................LFLTVMVLGNLVVLNLFIALLLNSF-....----s..............
ENSTTRP00000010733  .............................WLTMLSMIVGATCYAMFIGHATALIQ....----sldssr.........
ENSTTRP00000003584  .............................IVYMMVMVINLVVLNLFLALLLSSF-....----s..............
ENSTTRP00000013136  .............................YFVSFIFLCSF---------------....----l..............
ENSTTRP00000006224  .............................GVCLLTGIMGAGCTALVVAVVARKLE....----ltkaekhvhnfmmdt
ENSTTRP00000002836  .............................FFIIYIIIIAFFMMNIFVGFVIVTFQ....E---q..............
ENSTTRP00000009920  .............................GVCLLTGIMGAGCTALVVAVVARKLE....----ltkaekhvhnfmmdt
ENSTTRP00000013018  .............................YFVTLILLGSFFILNLVLGVLSGEFT....KE--r..............
ENSTTRP00000002368  .............................LLVAIMICVALVVLPLQFEELVYLWM....ERQKsggnysrhraqtekh
ENSTTRP00000011644  .............................YFVSLIILGSFFVLNLVLGVLSGEFS....KERE...............
ENSTTRP00000000825  .............................LFVVAMICVALVVLPIQFEQLAYLWM....ERQKsggnysrhraqtekh
ENSTTRP00000011711  .............................GVCLLTGIMGAGCTALVVAVVARKLE....----ltkaekhvhnfmmdt
ENSTTRP00000005250  .............................--------------------------....----x..............
ENSTTRP00000013305  .............................FFTTYIIISFLIVVNMYIAVILENF-....----n..............
ENSTTRP00000003295  .............................FYVVYFVVFPFFFVNIFVALIIITFQ....E---...............
ENSTTRP00000002153  .............................VFQLLNFFSGVFVFSSLIGQMQDV--....----i..............
ENSTTRP00000000364  .............................--------------------------....----lr.............
ENSTTRP00000016088  .............................YFISFFMLCAFLIINLFVAVIMDNF-....----...............
ENSTTRP00000006664  .............................IVCLCTGVMGVCCTALLVAVVARKLE....----fnkaekhvhnfmmdi
ENSTTRP00000002958  .............................FMVVFQSIVGCIIDAFIIGAVMAKM-....----a..............
ENSTTRP00000008624  .............................PVVWFWILVGLAYFAAVLSMIGDWLR....----viskktkeevgefra
ENSTTRP00000009742  .............................AFSFVYILTGLTVIGAFLNLVVLRFM....----tmnaedekrdaehra
ENSTTRP00000000400  .............................VFCVFYALVGIPLNVLFLNHLGTGL-....----hahlttlerwedqpr
ENSTTRP00000000399  .............................LFCIFFALVGIPLNLVVLNRLGHLMQ....Q---gvhscar........
ENSTTRP00000011701  .............................IFCILYAIFGIPLFGFLLAGIGDQ--....----lgt............
ENSTTRP00000012365  .............................IGITCYLLLGLIAMLVVL--------....----etfc...........
ENSTTRP00000001716  .............................VLLLLQAILGSMVNAFMVGCMFVKI-....----s..............
ENSTTRP00000003616  .............................YFIDFIIIGLFLPLSMLIGAIIANFN....----k..............
ENSTTRP00000005061  .............................FMVVAQSIVGCIIDSFMIGAIMAKM-....----a..............
ENSTTRP00000009742  .............................VFCMFYALLGIPLTLVMFQSLGER--....----intfvkyll......
ENSTTRP00000008624  .............................IFCIIYALLGIPLFGFLLAGVGD---....----ql.............
ENSTTRP00000003072  .............................IFVVADFLIGVLIFATIVGNIGSMIS....NM--n..............
ENSTTRP00000009040  .............................ILLLVQAILGSIVNAFMVGCMFVKI-....----s..............
ENSTTRP00000005008  .............................ILLLIQSVLGSIVNAFMVGCMFVKI-....----s..............
ENSTTRP00000013018  .............................FFIVYIILIAFFMMNIFVGFVIVTFQ....E---q..............
ENSTTRP00000014295  .............................LILIVQNIVGLMINAIMLGCIFM---....----kt.............
ENSTTRP00000007445  .............................AAVVLQCIAGCVLDAFVVGAVMAKM-....----a..............
ENSTTRP00000000398  .............................LFCVFYGLFGVPLCLTWISALGKFF-....----ggrakrlgqf.....
ENSTTRP00000000398  .............................YFVELWIYLGLAWLSLFVNWKVSMFV....EVH-kaikkrrrrrke...
ENSTTRP00000003616  .............................PFYMMVILVGNLLILYVLALVSS---....----f..............
ENSTTRP00000009762  .............................PLVWFWILLGLAYFASVLTTIGNWL-....----rvvsrrtraem....
ENSTTRP00000000629  .............................YFILLIIVGSFFMINLCLVVIATQFS....E---...............
ENSTTRP00000003616  .............................YFVSYILISWLIIVNMYIVVVMEF--....----l..............
ENSTTRP00000003528  .............................ILFLFQSILGSIVDAFLIGCMFIKM-....----s..............
ENSTTRP00000002957  .............................LMVILQSILSSIINTFIIGAALA---....----km.............
ENSTTRP00000012888  .............................FANFVFILMGVCCIYSLFNVISILI-....----kqsvnwilrkm....
ENSTTRP00000009192  .............................AFSIAFALLGVPATMLLLT-------....----asaqrlslll.....
ENSTTRP00000004010  .............................AFLIAYGLFGCAGTILFFNLFLER--....----iisllafimr.....
ENSTTRP00000009192  .............................VLVTVYLFLGLVAMVLVL--------....----qtf............
ENSTTRP00000001715  .............................VLLIAQLVLTTILEIFITGTFLA---....----kia............
ENSTTRP00000014553  .............................FLLVAQLVITTLIEIFITGTFL----....----akia...........
ENSTTRP00000006420  .............................YFILYHLFATLILLSLFVAVILDNL-....----e..............
ENSTTRP00000000399  .............................NTVSLWILFGMAWLALI---------....----n..............
ENSTTRP00000000400  .............................SLAAIWILLGLAWLALV---------....----l..............
ENSTTRP00000004010  .............................LGNFLFILLGVCCIYSL---------....----f..............
ENSTTRP00000011356  .............................FYVVYFVVFPFFFVNIFVALIIITFQ....E---...............
ENSTTRP00000011356  .............................YFIVLTLFGNYTLLNVFLAIAVDNL-....----a..............
ENSTTRP00000006319  .............................--------------------------....----re.............
ENSTTRP00000003616  .............................FFVVISFWFAFYMASLFLGIL-----....----ai.............
ENSTTRP00000010014  .............................VLAAGFALLGVSFFALPAGILGSGFA....----lkvqeqhrqkhf...
ENSTTRP00000004968  .............................LFFSIYIIVGMEIVCMAFKLVQNR--....----li.............
ENSTTRP00000008933  .............................FFMLVIFLGSFYLVNLILAVVAMAYE....EQ--n..............
ENSTTRP00000002091  .............................--------------------------....----xx.............
ENSTTRP00000004968  .............................HLCVLCALFGVPLMFLVLS-------....----dtgdilatilsms..
ENSTTRP00000007963  .............................VFQGLNYFTGVFAFSVMIGQM-----....----r..............
ENSTTRP00000012888  .............................LFLIYDLVGWSST-------------....----ilffnlflerviavi
ENSTTRP00000010014  .............................--------------------------....----hsk............
ENSTTRP00000006420  .............................YFITLIFFLAWLVKNVFIAVIIETFA....----ei.............
ENSTTRP00000013323  .............................--------------------------....----x..............
ENSTTRP00000000582  .............................YFAIFITISAFIGINLLVVVVTTNLE....Q---m..............
ENSTTRP00000006420  .............................YIHVFVFLGCMIGLTLFVGVVIANFN....----e..............
ENSTTRP00000002134  .............................FALLGYLLLGLLAMLLT---------....----vetf...........
ENSTTRP00000013136  xxxxvlkhsvdatyeeqgpspgyrmelsiFYVVYFVVFPFFFVNIFVALIIITFQ....E---...............
ENSTTRP00000016088  .............................--------------------------....----x..............
ENSTTRP00000000047  .............................IFSICTMLIG----------------....----x..............
ENSTTRP00000009762  .............................LFCIFYAMKRIPVFGILT--------....----e..............
ENSTTRP00000010378  .............................ALLAIQMLLGLMLEAFITGAFVAKI-....----a..............
ENSTTRP00000004338  .............................LYFMTFYIVTMVVMTIIVAFILEAF-....----v..............
ENSTTRP00000007759  .............................--------------------------....----t..............
ENSTTRP00000006420  .............................YFCSFYVIIAYIMLNLLVAIIVENF-....----s..............
ENSTTRP00000011228  .............................--------------------------....----aaal...........
ENSTTRP00000016320  .............................--------------------------....----fahgd..........
ENSTTRP00000014317  .............................--------------------------....----n..............
ENSTTRP00000011228  .............................FFIAFTLIGSLFLMNLLTAIIYNQF-....----r..............
ENSTTRP00000004338  .............................FFIVYLSIELYFIMNLLLAVVFDTF-....----n..............
ENSTTRP00000014427  .............................--------------------------....----tq.............
ENSTTRP00000005277  .............................--------------------------....----kdlpefhpsanhtpc
ENSTTRP00000001972  .............................ILGMVWAGFAMIIVASYTANLAAFLV....----ldrpeeritgindpr
ENSTTRP00000008933  .............................VFLLVMVIGNLVVLNLFLALLLSSF-....----s..............
ENSTTRP00000002589  .............................IVGGVWWFFTLIIISSYTANLAAF--....----l..............
ENSTTRP00000011285  .............................YFFTYVFFVFFVLLNMFLAIINDTYS....----e..............
ENSTTRP00000011701  .............................PLVWFWILVGLAYFAAVLSMIGDWLR....----vlskktkeevgeika
ENSTTRP00000005251  .............................IVGGVWWFFTLIIISSYTANLAAFL-....----tv.............
ENSTTRP00000006684  .............................IVGGVWWFFTLIIISSYTANLAAFL-....----tv.............


                                                                     
                                                                     
d1orqc_               ...............................................
ENSTTRP00000010419  ...............................................
ENSTTRP00000004039  ...............................................
ENSTTRP00000006570  ...............................................
ENSTTRP00000006832  ...............................................
ENSTTRP00000012947  ...............................................
ENSTTRP00000009306  ...............................................
ENSTTRP00000015380  ...............................................
ENSTTRP00000012489  ...............................................
ENSTTRP00000004829  ...............................................
ENSTTRP00000015083  ...............................................
ENSTTRP00000001235  ...............................................
ENSTTRP00000012542  ...............................................
ENSTTRP00000006964  ...............................................
ENSTTRP00000002262  ...............................................
ENSTTRP00000004325  ...............................................
ENSTTRP00000007208  ...............................................
ENSTTRP00000010081  ...............................................
ENSTTRP00000013879  ...............................................
ENSTTRP00000012173  ...............................................
ENSTTRP00000012038  ...............................................
ENSTTRP00000013799  ...............................................
ENSTTRP00000013153  ...............................................
ENSTTRP00000014995  ...............................................
ENSTTRP00000001573  ...............................................
ENSTTRP00000005694  ...............................................
ENSTTRP00000014511  ...............................................
ENSTTRP00000008933  ...............................................
ENSTTRP00000006619  ...............................................
ENSTTRP00000012773  ...............................................
ENSTTRP00000000204  ...............................................
ENSTTRP00000013305  ...............................................
ENSTTRP00000000629  ...............................................
ENSTTRP00000013138  ...............................................
ENSTTRP00000010790  ...............................................
ENSTTRP00000000364  ...............................................
ENSTTRP00000005250  ...............................................
ENSTTRP00000004176  ...............................................
ENSTTRP00000000364  ...............................................
ENSTTRP00000010790  ...............................................
ENSTTRP00000000629  ...............................................
ENSTTRP00000003584  ...............................................
ENSTTRP00000000204  ...............................................
ENSTTRP00000006619  ...............................................
ENSTTRP00000014856  ...............................................
ENSTTRP00000008933  ...............................................
ENSTTRP00000005715  ...............................................
ENSTTRP00000016088  ...............................................
ENSTTRP00000011516  ...............................................
ENSTTRP00000008973  ...............................................
ENSTTRP00000001468  ...............................................
ENSTTRP00000013323  ...............................................
ENSTTRP00000002836  ...............................................
ENSTTRP00000003584  ...............................................
ENSTTRP00000001468  ...............................................
ENSTTRP00000000204  ...............................................
ENSTTRP00000000364  ...............................................
ENSTTRP00000013136  ...............................................
ENSTTRP00000011356  ...............................................
ENSTTRP00000008021  ...............................................
ENSTTRP00000013018  ...............................................
ENSTTRP00000011356  ...............................................
ENSTTRP00000003295  ...............................................
ENSTTRP00000005250  ...............................................
ENSTTRP00000001723  ...............................................
ENSTTRP00000013323  ...............................................
ENSTTRP00000013138  ...............................................
ENSTTRP00000000629  ...............................................
ENSTTRP00000013018  ...............................................
ENSTTRP00000000204  ...............................................
ENSTTRP00000003584  ...............................................
ENSTTRP00000001827  ...............................................
ENSTTRP00000003295  ...............................................
ENSTTRP00000011644  ...............................................
ENSTTRP00000015837  ...............................................
ENSTTRP00000010790  ...............................................
ENSTTRP00000000781  refirfhqipnplrqrleeyfqhaw......................
ENSTTRP00000001468  ...............................................
ENSTTRP00000013136  ...............................................
ENSTTRP00000011644  ...............................................
ENSTTRP00000012570  ...............................................
ENSTTRP00000006619  ...............................................
ENSTTRP00000001468  ...............................................
ENSTTRP00000002836  ...............................................
ENSTTRP00000012822  dflklyqvpkglservmdyi...........................
ENSTTRP00000002689  ...............................................
ENSTTRP00000013138  ...............................................
ENSTTRP00000010790  ...............................................
ENSTTRP00000006356  ...............................................
ENSTTRP00000005250  ...............................................
ENSTTRP00000011644  ...............................................
ENSTTRP00000013138  ...............................................
ENSTTRP00000013305  ...............................................
ENSTTRP00000016088  ...............................................
ENSTTRP00000006619  ...............................................
ENSTTRP00000002836  ...............................................
ENSTTRP00000013323  ...............................................
ENSTTRP00000003295  ...............................................
ENSTTRP00000013305  ...............................................
ENSTTRP00000010733  ...............................................
ENSTTRP00000003584  ...............................................
ENSTTRP00000013136  ...............................................
ENSTTRP00000006224  qltkriknaaanvlretwliykh........................
ENSTTRP00000002836  ...............................................
ENSTTRP00000009920  qltkrvknaaanvlretwliyk.........................
ENSTTRP00000013018  ...............................................
ENSTTRP00000002368  vilcvsslkidllmdflnefyah........................
ENSTTRP00000011644  ...............................................
ENSTTRP00000000825  vvlcvsslkidllmdflnefyah........................
ENSTTRP00000011711  qltkrvknaaanvlretwliykht.......................
ENSTTRP00000005250  ...............................................
ENSTTRP00000013305  ...............................................
ENSTTRP00000003295  ...............................................
ENSTTRP00000002153  ...............................................
ENSTTRP00000000364  ...............................................
ENSTTRP00000016088  ...............................................
ENSTTRP00000006664  qytkemkesaarvlqeswmfykhtrrkd...................
ENSTTRP00000002958  ...............................................
ENSTTRP00000008624  haaewtanvtaefketrrrlsveiydk....................
ENSTTRP00000009742  llt............................................
ENSTTRP00000000400  r..............................................
ENSTTRP00000000399  ...............................................
ENSTTRP00000011701  ...............................................
ENSTTRP00000012365  ...............................................
ENSTTRP00000001716  ...............................................
ENSTTRP00000003616  ...............................................
ENSTTRP00000005061  ...............................................
ENSTTRP00000009742  ...............................................
ENSTTRP00000008624  ...............................................
ENSTTRP00000003072  ...............................................
ENSTTRP00000009040  ...............................................
ENSTTRP00000005008  ...............................................
ENSTTRP00000013018  ...............................................
ENSTTRP00000014295  ...............................................
ENSTTRP00000007445  ...............................................
ENSTTRP00000000398  ...............................................
ENSTTRP00000000398  ...............................................
ENSTTRP00000003616  ...............................................
ENSTTRP00000009762  ...............................................
ENSTTRP00000000629  ...............................................
ENSTTRP00000003616  ...............................................
ENSTTRP00000003528  ...............................................
ENSTTRP00000002957  ...............................................
ENSTTRP00000012888  ...............................................
ENSTTRP00000009192  ...............................................
ENSTTRP00000004010  ...............................................
ENSTTRP00000009192  ...............................................
ENSTTRP00000001715  ...............................................
ENSTTRP00000014553  ...............................................
ENSTTRP00000006420  ...............................................
ENSTTRP00000000399  ...............................................
ENSTTRP00000000400  ...............................................
ENSTTRP00000004010  ...............................................
ENSTTRP00000011356  ...............................................
ENSTTRP00000011356  ...............................................
ENSTTRP00000006319  ...............................................
ENSTTRP00000003616  ...............................................
ENSTTRP00000010014  ...............................................
ENSTTRP00000004968  ...............................................
ENSTTRP00000008933  ...............................................
ENSTTRP00000002091  ...............................................
ENSTTRP00000004968  ...............................................
ENSTTRP00000007963  ...............................................
ENSTTRP00000012888  aci............................................
ENSTTRP00000010014  ...............................................
ENSTTRP00000006420  ...............................................
ENSTTRP00000013323  ...............................................
ENSTTRP00000000582  ...............................................
ENSTTRP00000006420  ...............................................
ENSTTRP00000002134  ...............................................
ENSTTRP00000013136  ...............................................
ENSTTRP00000016088  ...............................................
ENSTTRP00000000047  ...............................................
ENSTTRP00000009762  ...............................................
ENSTTRP00000010378  ...............................................
ENSTTRP00000004338  ...............................................
ENSTTRP00000007759  ...............................................
ENSTTRP00000006420  ...............................................
ENSTTRP00000011228  ...............................................
ENSTTRP00000016320  ...............................................
ENSTTRP00000014317  ...............................................
ENSTTRP00000011228  ...............................................
ENSTTRP00000004338  ...............................................
ENSTTRP00000014427  ...............................................
ENSTTRP00000005277  vehingltsaflfx.................................
ENSTTRP00000001972  lrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmekhnyesaaeai
ENSTTRP00000008933  ...............................................
ENSTTRP00000002589  ...............................................
ENSTTRP00000011285  ...............................................
ENSTTRP00000011701  haaewkanvtaefretrrrlsveihdk....................
ENSTTRP00000005251  ...............................................
ENSTTRP00000006684  ...............................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0041998 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Meiothermus ruber DSM 1279
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] torques
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Enterococcus faecalis 62
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc citreum KM20
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Prevotella intermedia 17
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Simkania negevensis Z
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema brennaborense DSM 12168
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Aquifex aeolicus VF5
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Collimonas fungivorans Ter331
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium radiobacter K84
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Hyphomicrobium sp. MC1
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Oceanimonas sp. GK1
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia proteamaculans 568
NoYes   Pectobacterium wasabiae WPP163
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Francisella noatunensis subsp. orientalis str. Toba 04
NoYes   Francisella sp. TX077308
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Acidilobus saccharovorans 345-15
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Aeropyrum pernix K1
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Staphylothermus marinus F1
NoYes   Metallosphaera cuprina Ar-4
NoYes   Metallosphaera sedula DSM 5348
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta thermophila PT
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Methanopyrus kandleri AV19
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus onnurineus NA1
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus sibiricus MM 739
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Pyrococcus furiosus COM1
NoYes   Thermoplasma volcanium GSS1
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Methanobacterium sp. AL-21
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halalkalicoccus jeotgali B3
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus fervens AG86
NoYes   Methanocaldococcus vulcanius M7
NoYes   methanocaldococcus infernus ME
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Methanothermococcus okinawensis IH1
NoYes   Methanococcus aeolicus Nankai-3
NoYes   Methanococcus maripaludis C5
NoYes   Methanococcus voltae A3
NoYes   Methanothermus fervidus DSM 2088
NoYes   Methanothermobacter marburgensis str. Marburg
NoYes   Methanothermobacter thermautotrophicus str. Delta H
NoYes   Methanosphaera stadtmanae DSM 3091
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter ruminantium M1
NoYes   Complete genome sequence of Methanobacterium sp. Mb1
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. CC9902
NoYes   Synechococcus sp. RCC307
NoYes   Synechococcus sp. CC9605
NoYes   Synechococcus sp. WH 8102
NoYes   Synechococcus sp. WH 7803
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Prochlorococcus marinus str. NATL1A
NoYes   Prochlorococcus marinus str. MIT 9301
NoYes   Prochlorococcus marinus str. AS9601
NoYes   Prochlorococcus marinus subsp. marinus str. CCMP1375
NoYes   Prochlorococcus marinus subsp. pastoris str. CCMP1986
NoYes   Prochlorococcus marinus str. MIT 9215
NoYes   Prochlorococcus marinus str. MIT 9211
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9312
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Prochlorococcus marinus str. NATL2A
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Ureaplasma parvum serovar 3 str. ATCC 700970
NoYes   Mycoplasma cynos C142
NoYes   Mycoplasma fermentans JER
NoYes   Mycoplasma fermentans PG18
NoYes   Mycoplasma gallisepticum NC08_2008.031-4-3P
NoYes   Mycoplasma gallisepticum CA06_2006.052-5-2P
NoYes   Mycoplasma gallisepticum NC06_2006.080-5-2P
NoYes   Mycoplasma gallisepticum WI01_2001.043-13-2P
NoYes   Mycoplasma gallisepticum NY01_2001.047-5-1P
NoYes   Mycoplasma gallisepticum NC96_1596-4-2P
NoYes   Mycoplasma gallisepticum NC95_13295-2-2P
NoYes   Mycoplasma gallisepticum VA94_7994-1-7P
NoYes   Mycoplasma gallisepticum S6
NoYes   Mycoplasma gallisepticum str. R(high)
NoYes   Mycoplasma gallisepticum str. R(low)
NoYes   Adlercreutzia equolifaciens DSM 19450
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem/NITR202
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium terpenotabidum Y-11
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium urealyticum DSM 7111
NoYes   Corynebacterium argentoratense DSM 44202
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium pseudotuberculosis 258
NoYes   Corynebacterium pseudotuberculosis Cp162
NoYes   Corynebacterium pseudotuberculosis P54B96
NoYes   Corynebacterium pseudotuberculosis 267
NoYes   Corynebacterium pseudotuberculosis 1/06-A
NoYes   Corynebacterium pseudotuberculosis 42/02-A
NoYes   Corynebacterium pseudotuberculosis 3/99-5
NoYes   Corynebacterium pseudotuberculosis 31
NoYes   Corynebacterium pseudotuberculosis CIP 52.97
NoYes   Corynebacterium pseudotuberculosis PAT10
NoYes   Corynebacterium pseudotuberculosis I19
NoYes   Corynebacterium pseudotuberculosis FRC41
NoYes   Corynebacterium pseudotuberculosis C231
NoYes   Corynebacterium pseudotuberculosis 1002
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium diphtheriae BH8
NoYes   Corynebacterium diphtheriae INCA 402
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae HC02
NoYes   Corynebacterium diphtheriae HC01
NoYes   Corynebacterium diphtheriae 241
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Corynebacterium diphtheriae PW8
NoYes   Corynebacterium diphtheriae C7 (beta)
NoYes   Corynebacterium diphtheriae 31A
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Bifidobacterium longum NCC2705
NoYes   Bifidobacterium longum DJO10A
NoYes   Bifidobacterium longum subsp. infantis 157F
NoYes   Bifidobacterium longum subsp. longum KACC 91563
NoYes   Bifidobacterium longum subsp. longum BBMN68
NoYes   Bifidobacterium longum subsp. longum JCM 1217
NoYes   Bifidobacterium animalis subsp. animalis ATCC 25527
NoYes   Bifidobacterium animalis subsp. lactis Bl12
NoYes   Bifidobacterium animalis subsp. lactis B420
NoYes   Bifidobacterium animalis subsp. lactis ATCC 27673
NoYes   Bifidobacterium animalis subsp. lactis BLC1
NoYes   Bifidobacterium animalis subsp. lactis CNCM I-2494
NoYes   Bifidobacterium animalis subsp. lactis Bi-07
NoYes   Bifidobacterium animalis subsp. lactis V9
NoYes   Bifidobacterium animalis subsp. lactis DSM 10140
NoYes   Bifidobacterium animalis subsp. lactis BB-12
NoYes   Bifidobacterium animalis subsp. lactis AD011
NoYes   Bifidobacterium breve UCC2003
NoYes   Actinomyces odontolyticus ATCC 17982
NoYes   Actinomyces viscosus C505
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi DCMB5
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. VS
NoYes   Dehalococcoides sp. CBDB1
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Roseburia intestinalis XB6B4
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum BKT015925
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Halobacteroides halobius DSM 5150
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus johnsonii N6.2
NoYes   Lactobacillus johnsonii DPC 6026
NoYes   Lactobacillus johnsonii NCC 533
NoYes   Lactobacillus fermentum F-6
NoYes   Lactobacillus fermentum CECT 5716
NoYes   Lactobacillus amylovorus GRL 1112
NoYes   Lactobacillus reuteri TD1
NoYes   Lactobacillus reuteri I5007
NoYes   Lactobacillus reuteri JCM 1112
NoYes   Lactobacillus reuteri SD2112
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum ST-III
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
NoYes   Lactobacillus brevis KB290
NoYes   Lactobacillus acidophilus La-14
NoYes   Lactobacillus acidophilus NCFM
NoYes   Pediococcus pentosaceus SL4
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
NoYes   Streptococcus lutetiensis 033
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus pneumoniae A026
NoYes   Streptococcus pneumoniae ST556
NoYes   Streptococcus pneumoniae SPN994039
NoYes   Streptococcus pneumoniae SPN994038
NoYes   Streptococcus pneumoniae SPN034183
NoYes   Streptococcus pneumoniae SPN034156
NoYes   Streptococcus pneumoniae INV104
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae OXC141
NoYes   Streptococcus pneumoniae gamPNI0373
NoYes   Streptococcus pneumoniae AP200
NoYes   Streptococcus pneumoniae ATCC 700669