SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Neurotransmitter-gated ion-channel transmembrane pore alignments in Strongylocentrotus purpuratus v3.1

These alignments are sequences aligned to the 0041810 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                          10        20         30        40        50                60          70 
                           |         |          |         |         |                 |           | 
d1oeda_       ....PLYFVVNVIIPCLLFSFLTGLVFYLPTDS.GEKMTLSISVLLSLTVFLLVIVEL..IPST..S..S..AVPL.IGK.YMLFT
SPU_001774  ....PLFYTVNLILPCVLISFLTVLVFYLPSDS.GEKITLCISVLLALTVFLLLIAEI..IPPT..S..L..LIPL.IGR.YLLFT
SPU_018204  ....PLFYIITLVIPCVLISLMTALVFYLPSDA.QEKITLSISVLLALIVFLLLIPNL..IPPT..S..K..TIPL.IGR.YMLFT
SPU_023216  ....PLFYVVTLVVPCLLISFLTILVFFLPSDA.QEKITLSISILLALIVFLLLIPDI..IPPT..S..T..TLPL.IGR.YMLFT
SPU_013095  ....-MYYVFNLLVPCILIASITLLGFLLPVDS.GEKVSLGITVLLSLTVFLLLIAQS..MPPS..S..-..VVPI.IGQ.YYVST
SPU_021159  ....-LFYFINLLGPCVLISLITVLDFFMPADA.GEKVTLGITILLALTVFLLLVAET..MPPT..S..E..VVPL.IAQ.YYACT
SPU_021158  ....PLFYVINMLVPCILVSALTLLTFYLPADT.GEKFTLCITILLSLTVFLLLAAET..MPPT..S..E..VVPL.IAQ.YYITT
SPU_002737  ....-LFYVVTFVLPCCMIAFLTIFVFY-----.---VTLCISILLALIVFLLLIAEM..IPTT..A..G..SIPL.IGI.YLLFS
SPU_000767  ....PLYYVFNLILPCTFVSMVALLSFFLPPES.GEKISLGITVLLSLTVFLLLVAET..MPPT..S..-..AVPV.VGQ.YFMST
SPU_000765  ....PTYFVFNLIMPCTLISATTFLSFFLPPES.GEKVSLGITVLLSLTVFLLLVAEL..LPPS..G..-..AVPI.IAI.YYAVT
SPU_026087  ....-LFYVINMLVPCILVSALTLLTFYLPADT.GEKFTLCITILLSLTVFLLLAAET..MPPT..S..E..VVPL.IAQ.YYITT
SPU_014121  ....PLFYVINMLVPCILVSALTLLTFYLPADT.GEKFTLCITILLSLTVFLLLAAET..MPPT..S..E..VVPL.IAQ.YYITT
SPU_005670  ....PLFYVINMLVPCILVSALTLLTFYLPADT.GEKFTLCITILLSLTVFLLLAAET..MPPT..S..E..VVPL.IAQ.YYITT
SPU_011220  ....-LYYTLNILVPCLVISSLALVGFTLPVES.------GITILLSLTVFMLLVAEA..MPAT..S..V..SVPL.IAK.YFDCV
SPU_024908  ....PLFYVVNLIVPCVMISMMSVLEFILPCNS.GEKVSLGITVLLSLTVFMLVIAEN..MPAT..S..D..NIPV.LAR.YYIIT
SPU_019709  ....PLYYFAYILVPCGLISFNTVLVFYLPPDI.SEKMALCMSVLLSMTVFLLLITAQ..IPAN..A..N..HFPL.IVK.YLLFT
SPU_019711  ....PLFYFAYLLLPCGIISFNTVLVFYLPPDI.TGKMSLCTSVLLSMVWFLLLVTQC..IPSN..A..N..NFPL.IVK.YLLFT
SPU_019710  ....PLFYFAYLLLPCGIISFNTVLVFYLPPDI.TGKMSLCTSVLLSMVWFLLLVTQC..IPSN..A..N..NFPL.IVK.YLLFT
SPU_014649  ....-GFFFLQTYLPSILLVMLSWVSFWINHEAtSARVSLGITTVLTMTTISTAVRQS..LPRI..S..-..YVKS.IDI.YVITC
SPU_026876  ....PLFYIMNMINPCVLIYGLTLLSFCLPGES.GEKIALNVTILLSLTVFMLLTSEM..MPPS..S..D..TIPV.IAQ.FYAAT
SPU_025266  ...t--YYVVQTYIPSSMITCLSWLSFWINRNAvPARVALGITTVLTMTTLVGNAGNS..LPKL..S..-..YIKA.IDL.FLGMC
SPU_014650  ....-GFFLIQTYFPCVMIVALSWVSFWLNREAtPARVALGTMTTLTITTLGWSARAV..LPKV..G..-..YPKA.IDW.FIMLC
SPU_021157  ....-LFYVFNLIFPTVFMSFVSLLGFYLPPDS.GEKVGLNITSLLSIVFFLLLGAQL..LPPT..S..E..SISY.LGK.LFSTI
SPU_017211  ...t--FYVVQAYMPTALLVIISWVSFWIDISQaAARVSLGVTTILTMTTTTTGYAGSagLPKV..S..-..YTKA.IDI.WFDAC
SPU_023734  ....-GYYMLQAFIPSIALVMVSWVTFWIDVRAsPARVGLGVTIILSVISKTNGVRLD..IPPV..S..-..YLKA.IDV.WYTSC
SPU_024977  ....-----------------------------.-----MGITTVLTMTTISTAVRQS..LPRI..S..-..YVKS.IDI.YVITC
SPU_010605  ....--YYVITVIVPSTTLSLVSLLVFFMPPDS.EEKVTLASSNLLAMLLFQELVSTS..MPPI..G..N..QFPL.IGS.FFVAS
SPU_016127  ...y--YFVINLVLPSSLINAMSLVAFWVPLDS.GEKLSTAVSLLLGVVVFQIVVTDM..LPVS..D..G..DMPL.LAR.YIFVN
SPU_027433  ....--FYLFNMVVPCVMLSAINALVFLVPPES.GEKISFSVANLLASILFQQLIGEL..MPPL..G..D..EIPL.LGM.FFLYM
SPU_009498  ....--YYVITVIVPSTTLSLVSLLVFFMPPDS.EEKVTLASSNLLAMLLFQELVSTS..MPPI..G..N..QFPL.IGS.FFVAS
SPU_013945  ....--FYTRTVVVPCILLTALMALVCWLHPAS.GEKVTLAVSNLLALILFQQLVADR..LPPS..G..E..TTSI.IVI.FFTVM
SPU_028560  ...t--YYVVQTYIPSSMITCLSWLSFWINRNAvPARVALGITTVLTMTTLVGNAGNS..LPKL..S..-..YIKA.IDL.FLA--
SPU_011478  ...s--FYTRTVVVPCILLTALMALVCWLHPAS.GEKVTLAVSNLLALILFQQLVADR..LPPS..G..E..TTSI.IVI.FFIVM
SPU_027434  ...a--FYLFNMIIPSITLCLTNTLVYLIPPES.GEKVQFAVSNLLASILFQQLIATT..MPPL..G..D..ELPL.LGI.FFLFM
SPU_014877  ....--FFTTQIVMPSVFLSILMLISFWLHPDS.GEKISLTVTNLLALILFQQLVAQF..MPPT..G..E..PRSI.VVT.CFFIL
SPU_011871  ....--FYTKTVVVPAFLLTLLMAVVCWLHPAS.GEKVTLAVSNLLALILFQQLVADR..MPPS..G..E..TTSI.IVS.FFIVM
SPU_017389  ....--FYTRTVVVPCILLSALMVLVCWLHPAS.GEKVTLAVSNLLALILFQQLVADR..LPPS..V..-..----.--I.FFTVM
SPU_011606  ....-GFFLTNVVVPAIFLTALMLVGFWLHPDS.GEKVTFTVTNLLALTLFQQLVADK..MPPI..G..E..PRSI.LVT.CFFML
SPU_024212  ....PLYYIYNLIMPCILLSSLSMLGFFMPYDVgVVKVSLSVTLILSLTVFLLLVAEM..MPRT..S..E..QVPL.IGV.-----
SPU_005440  ....PRVYILGIVIPSVLLSISTMLIFLLPPES.GEKISFGVTNLLAMVLFQETVRSA..MPPT..G..-..-SPI.LAN.YICVM
SPU_011607  ...a--FFSTNIVIPAVFLTILMLIGFWLHPDS.GEKITFTVTNLLALILFQQLVAEF..MPPI..G..E..PRSI.IVT.CFFIL
SPU_009312  ....PHHYVFFIIVPVMLLNAVGIVSFFIPVKS.GERVSTCISVVLGVTIFQIVIGDV..IPQT..SrsD..SNPH.ALK.YLSTS
SPU_007776  ....YGFFLSNIIVPAIFLTSLMLVGFWLHPDS.GEKVAFTVTNLLALILFQQLVSDS..MPPI..G..E..PRSI.IVT.CFFML
SPU_011608  ....--FFRETIILPAVFLTVLMATVSWLHPAS.GEKMTLAVSNLLALILFQQLVADS..MPPI..G..D..NTSI.IVT.FFFIM
SPU_009313  ....PNHYIYTIILPVTLINAIGIWTFFIPLKS.GERVTTCISVVLGVTVFQIVIIDV..MPQTtrS..G..AIPP.TIK.YLTMT
SPU_015655  ....-LFYFFNLVVPCVIISSLVLLSFVLPSDA.CERITLTLTVLLSLTVFLLLVAET..MPPT..S..E..VVPL.IYY.Y----
SPU_016220  ....PRFYVQNVTLPITFLSWLSIVIFIIPAKS.GERLSAAVSLVLGLTVFQIVITDN..LPKS..S..R..GTTA.PVIsYVSEC
SPU_026088  ....-----------------------------.------------------------..----..-..-..----.---.-----
SPU_021097  ....-GFYVLNIVLPSGLLAFVNCLVFLLPPES.GERLQFAVSNLLAAILFQQLIGGI..MPPL..G..D..ELPL.LGM.FFVYM
SPU_018741  ....PRYYIDNVTSPIAILSWLSIIIFIIPAKS.GERLSAAISLVLGLTVFQIVVTDN..LPKN..S..Rg.DAAV.VTE.YVSDC
SPU_003661  ....PKFYVQNVTLPITFLSWLSIFIFIIPAKS.GERLSAAVSLVLGLTVFQIVITDN..LPKS..S..R..GKTApVIS.YVSEC
SPU_017132  ....PNFYLRNILCPLVLFIILAFSTFWIPIKS.GERVSASLSLVLGNTVFQIIITDI..MPRT..S..NpaDEPL.IVY.FCVSS
SPU_015801  ....--FYTKTVVVPAFLLTLLMAVVCWLHPAS.GEKVTLAVSNLLALILFQQLVADR..MPPS..G..E..TTSI.IVS.FFIVM
SPU_017912  ....--FYVFNLLVPASIITLMASMAFLLPPTS.QGKVTLGVTFLLSKTVFLMIVAES..MPPT..N..-..EVPI.LG-.-----
SPU_006469  ....PRFYVQNVILPITFLSWLSIFIFIIPAKS.GERLSAAVSLVLGLTVFQIVITDN..LPKN..S..R..GKTApVIS.YVSEC
SPU_024212  ...q-----------------------------.------------------------..----..-..-..----.---.YYAAT
SPU_017914  ....-----------------------------.------------------------..----..-..-..----.---.-----
SPU_006738  ....--FYTRTVVVPCILLSALMVLVCWLHPAS.GEKVTLAVSNLLALILFQQLVADR..LPPS..G..E..TTSI.IGK.Y----
SPU_011609  ....--FFTKVVVVPSVLLTMLMALTFWSHPDS.GEKVTLAISNLLAMILFQQLVADS..MPPI..G..-..----.---.-----
SPU_004550  ...q-----------------------------.------------------------..----..-..-..----.---.YFAAI
SPU_020202  ....--YYMWNVALIMFLITPLAFTSYAVSADApEDRLSVTLTLLLTAVAFKFVVSQS..LPNT..S..-..YQTL.LDY.YVLWC
SPU_006517  ....PNHYVYTIILPVTLINAIGIWTFFIPLKS.GERVTTCISVVLGVTVFQRRI---..----..-..-..----.---.-----
SPU_007767  ....PGFYIWNIALIMLLIVILTFTSFVVERGApADRLSVTVTLLLTAVAFKYVVSQS..LPLI..S..-..YLTM.LDK.YVLSC
SPU_011608  ....--FFRETIILPAVFLTVLMATVSWLHPAS.GEKMTLAVSNLLALILFQQLVADS..MPPI..G..D..NTSI.I--.-----
SPU_019886  ....PLFYIMNMINPCVLIYGLTLLSFCLPGES.GEKV--------------------..----..-..-..----.---.-----
SPU_026087  ....-----------------------------.------------------------..----..-..-..----.---.-----
SPU_011609  ...t-----------------------------.------------------------..----..-..-..----.---.FFFIM
SPU_021043  ...i---------GPAVVSVWLILAVFLMQPSKgGERIIFAGLVFVSLIVLNAALSAE..VPAY..S..-..-VTR.LGR.FLLAG
SPU_013639  ...i---------GPAVVSVWLILAVFLMQPSKgGERIIFAGLVFVSLIVLNAALSAE..VPAY..S..-..-VTR.LGR.FLLAG
SPU_020202  ....------------FLITPLAFTSYAVSADApEDRLSVTLTLLLTAVAFKFVVSQS..LPNT..S..-..Y---.---.-----
SPU_015638  iatw-----------------LILIVFLIGPSSaGERIILAGFVFVTLVVLSAALSAE..VPAY..S..-..-MTR.LGR.FLIGG
SPU_003090  ...s------------VVTAWLILIVFLISPSSaGVRIVFAGSVLIALVVLSAALSAE..VPAY..S..-..-TTR.LGR.FLIVG
SPU_003089  ...s------------VVTAWLILIVFLISPSSaGVRIVFAGSVLIALVVLSAALSAE..VPAY..S..-..-TTR.LGR.FLIVG
SPU_022698  iatw-----------------LILVVFLIGPSSaGERIIFAGFVFVALVVLSAALSAE..VPAY..S..-..-MTR.LGR.FLIGG
SPU_015638  .atw-----------------LILVVFLIGPSSaGERIIFAGFVFVALVVLSAALSAE..VPAY..S..-..-MTR.LGR.FLIGG
SPU_003089  ...s------------VVTAWLILIVFLISPSSaGVRIVFAGSVLIALVVLSAALSAE..VPAY..S..-..-TTK.LGR.FLIVG
SPU_015639  atwl------------------ILIVFLIGPSSaGERIIFAGFVFVALVVLSAALSAE..VPAY..S..-..-MTR.LGR.FLIGG


                     80        90                         100            110               120      
                      |         |                           |              |                 |      
d1oeda_       MIFVISSIIITVVVINTHHR.S.................PSTHTMPQ.....WVRKIFIDTIPNVMFFSTM........KRASKEK
SPU_001774  MVLVTLSIVITVIVLNIHYR.A.................PSTHTMRP.....WVRKVFLEVLPPLLYMKRP........KRYNHGE
SPU_018204  MAMVSLSILATVVTINVHFR.S.................ITTHEMPP.....WMKTWFLNYLPRAFCMERP........DGLKARK
SPU_023216  MVLVTLSITITVVIINFHFR.N.................ARTHEMSS.....SMHYIFLVLMPKVMCMPRP........TKPFEHE
SPU_013095  MVLVSISILLTVSVINLHHR.G.................PYCRKAPR.....WVRRIILGKIAWFLRLQPE........HFKHMKF
SPU_021159  IVLVSLSTVMTVYVLSLHYR.L.................PGTNRVPR.....GMKKFAFSFLARIMCMGSFlvnmgdddD------
SPU_021158  MVLVSASTVLTAIVLYIHHR.G.................TYVGRAPS.....WFRRFTLDYLAKFMCMGDC........HNPDVED
SPU_002737  MAMVSVSITVTVIIINLFHR.S.................ALTHTMPC.....WVKLVFIDWLPPYLHMKRP........ENYKSYY
SPU_000767  MVLISGSLAMSVMVLNMHHC.R.................PDCRPVPR.....WVRIVVIDCLGRLLAPTAV........KNSKTDR
SPU_000765  MVMVSLSLAMSVVVLNLHHR.G.................PETSPVPL.....WLRKIVLGRVGKVVLMRKT........SFNQEIY
SPU_026087  MVLVSASTVLTAIVLYIHHR.G.................TYVGRAPS.....WFRRFTLDYLAKFMCMGDC........HNPDVKD
SPU_014121  MVLVSASTVLTAIVLYIHHR.G.................TYVGRAPS.....WFRRFTLDYLAKFICMGDC........HNPDVKD
SPU_005670  MVLVSASTVLTAIVLYIHHR.G.................TYVGRAPS.....WFRRFTLDYLAKFMCMGDC........HNPDVKD
SPU_011220  LMMVAVSVVFTVITLNIHYR.H.................PNSHVMAS.....WQRSLLLEWLPWLLYMKRP........GREWSPC
SPU_024908  IFLVSFSTVMTVLVLSLHHR.R.................---SPVPR.....WVRHVFLRVLSSMLCMRVE........SSKNSTG
SPU_019709  MLIVSSSIILTVFVLNVRFR.S.................PETHTMPR.....WVRRLFIDIIPGFLGMSRP........VEYSKRF
SPU_019711  MTIVASSIVLTVFVLNIRHR.S.................PYTHIMPQ.....WVRTVFIDMLPRFVGLQRP........NQKRKRD
SPU_019710  MTIVASSIVLTVFVLNIRHR.S.................PYTHIMPQ.....WVRTVFIDMLPRFVGLQRP........NQKRKRD
SPU_014649  YSFVFAALVEYAIVNYNYWL.EqkkkvkeahgiknnptqNSNNKKPP.....EVRYDQLQQFNPQVALRLS........QVDSEDD
SPU_026876  IVLVSISILFAVISLNFFHR.P.................PNPHRAPL.....WLRKLFFIHLTPLLYPWRV........STCGKNG
SPU_025266  YFFVFAALLEYVIVIYYDQP.-.................-RY-----.....----------------RKA........RELMKEF
SPU_014650  FAFVLGAVIEFATVNYFTKRrT.................GMLPGMADdeeddIAQAEVEKV-EASLMRRKK........KRFSLIR
SPU_021157  IVIMSIETAMSVIILRLYHL.H.................-LPYPPPA.....WARWLILDKAAKLLRLKGW........HHEYSAN
SPU_017211  LAFAISSLFEYSVVHYLWTK.D.................RTERQRQK.....VLRKNNKKFHFPSTCLSGP........DNESPNR
SPU_023734  LFFVIGALLEYALVHHLSLG.Q.................KKT-----.....-------------------........KQKVLAF
SPU_024977  YSFVFAALVEYAIVNYNYWL.EqkkkvkeahgiknnptqNSNNKKPP.....EVRYDQLQQFNPQVALRLS........QVDSEDD
SPU_010605  IVINTFSIFTSILIMYLHNK.D.................--NRPVPT.....WLKKLAVLKTGS------Q........QSQPVQS
SPU_016127  FLVSCGCLLSCIINFNIYK-.-.................SARKIRGR.....FWRAFWFGFLAKIVCVRNDfgkke...KETVAN-
SPU_027433  VGMSCVALGASVLILRMFHR.L.................GE-EPVPR.....YLKRIFLRRASVSLSFKRA........SVAIKKT
SPU_009498  IVINTFSIFTSIMIMYLHNK.D.................--NRPVPT.....WLKKLAVLKTAS-------........-------
SPU_013945  IGLSCAEVVCSIIVLRLYHT.G.................G-RRQIPN.....WLRRTMLHPFIMRLYTNAE........CTAMLRA
SPU_028560  --------------------.-.................--------.....-------------------........-------
SPU_011478  IGLSCAEVVCSIVVLRLYHT.G.................GR-RQIPN.....WLRRTMLHPFIMRLYTN--........-AECTTM
SPU_027434  VMCSCFSIAFSILSLQLYNK.K.................GE-KPVPA.....CLRKLILLSHPVAHRRLLH........RVSTMRA
SPU_014877  IALSACSVILTVIVLRVYHT.N.................VDSLPPSW.....A-FMLL-RI-----FINRK........VEKTMSA
SPU_011871  IAMCCAEVLCAIFVLRIYHM.G.................GQTEVPWL.....LRRVMLCPFILPLYNSQES........KEVFRAQ
SPU_017389  IGLSSAEVVCSIIVLRLYHT.G.................-GRRPIPN.....WLRRTMLHPFIMRLY---T........NAECTAM
SPU_011606  IILSGCAVFLSVLVLRLYHH.D.................TNTRPP-R.....WVIKLIMPWF---SRSGAR........GYIRKIY
SPU_024212  --------------------.-.................--------.....-------------------........-------
SPU_005440  MIVACTSLIIEALVLRMYNL.G.................NA-SDIPR.....WMQRLFIKKHQTVSLCRRK........EPGLHAP
SPU_011607  ITLSVCSVILTVIVLHVYHK.D.................VVSRPPSWaf...WLLRIFIHSNAEGKMSDYY........KYLEAKQ
SPU_009312  FIALVGIMLSSVAALNISYR.N.................GSIKRK--.....ALRILFFRILATMVFKGEE........GRRKMA-
SPU_007776  VVVSGCSVFFSVLVLRMYHH.D.................ATSIPPRL.....AIKMLM-------------........-------
SPU_011608  IALGCASVISSVTVLRIFHH.G.................GD-KPLPR.....WVCYIIYRCAGCTMIFGRE........RLQTALK
SPU_009313  FITLAVIMMCSAMSLNITYQ.K.................--RRIKNR.....FLRMLFFRILATMVF-KRQ........EGLRKMT
SPU_015655  --------------------.-.................--------.....-------------------........-------
SPU_016220  FIITIVVAIMSAIVINISHR.K.................GNIQ--NK.....LIRSVLFEYVGPWFLVGDV........G--CGKK
SPU_026088  MVLVSASTVLTAIVLYIHHR.G.................TYVGRAPS.....WFRRFTLDYLAKFMCMGDC........HNPDVKD
SPU_021097  ILTNCFVLGLSICILRFYHQ.R.................GDKAVPMF.....LRRI---------------........-------
SPU_018741  FIITIVVTIMSAIVINLSHR.E.................GE--INNK.....FIRSVFFNHLGPWCFVGGG........RCGGKKA
SPU_003661  FIITIVVAIMSAIVINISHR.K.................GNIQ--NK.....FFRSLFFEYVGPWFFVGGV........GCGKKKA
SPU_017132  FALITAITVWSMLVSNLSFK.K.................WS--LKNS.....AARRFFFDVLPVLTL----........-------
SPU_015801  IAMCCAEVLCAIFVLRIYHM.G.................GQTEV-PW.....LLRR---------------........-------
SPU_017912  --------------------.-.................--------.....-------------------........-------
SPU_006469  FIITIVVAIMSAIVINISHR.K.................GFIQNK--.....FFRSLFFEY----------........-------
SPU_024212  MFLISLSTAMNVFVLNVNERgK.................IEGQDVPR.....WLRVFALDYIAKVLCVQPC........SSGSRRS
SPU_017914  MILVSLSLVLNVIVVSVYNC.G.................NCGDPLPH.....WVRVVALHVLAPIVRVKVE........SKRFPPS
SPU_006738  --------------------.-.................--------.....-------------------........-------
SPU_011609  --------------------.-.................--------.....-------------------........-------
SPU_004550  IVAVGLITVFTVVTCSIHHT.G.................-DSQRAPR.....LVRRAILGYLARFLCVQTI........PVDDADD
SPU_020202  MMFLCLVVVQNAV-------.-.................--------.....-------------------........-------
SPU_006517  --------------------.-.................-----KNR.....FLRILFFRILATMVF-KRQ........DGLRKMT
SPU_007767  LIFQCLVV------------.-.................--------.....-------------------........-------
SPU_011608  --------------------.-.................--------.....-------------------........-------
SPU_019886  --------------------.-.................--------.....-------------------........-------
SPU_026087  MVLVSASTVLTAIVLYIHHR.G.................TYVGRAPS.....WFRRFTLDYLAKFMCMGDC........-------
SPU_011609  IALGCGAVVCAVIVLRIYHS.G.................GE-RHMPT.....WLKFIIIKRLQRMRKRRHS........LPEVVTA
SPU_021043  MLINSIVVVINAIIYRFY--.-.................--------.....-------------------........-------
SPU_013639  MLINSIVVVINAIIYRFY--.-.................--------.....-------------------........-------
SPU_020202  --------------------.-.................--------.....-------------------........-------
SPU_015638  MLINAVVIIINGLIYRFYPK.D.................QPGHM---.....-------------------........-------
SPU_003090  MLILA---------------.-.................--------.....-------------------........-------
SPU_003089  MLILAF--------------.-.................--------.....-------------------........-------
SPU_022698  MLINAVVIIINGLIYRFYP-.-.................--------.....-------------------........-------
SPU_015638  MLINAVVIIINGLI------.-.................--------.....-------------------........-------
SPU_003089  MLILA---------------.-.................--------.....-------------------........-------
SPU_015639  MLINAVVIIIN---------.-.................--------.....-------------------........-------


                    130                                                                             
                      |                                                                             
d1oeda_       Q.....ENKIFAD.........................................................................
SPU_001774  N.....PNKEKDLnyfelkevvhkegenphsngrdifdnlhpsfkl........................................
SPU_018204  E.....KKMKKKLqkeairkynnpymyspssssgvweersgnysqngnyrmyngrpynklelrtitpslreeiegre.........
SPU_023216  K.....HKSAKKMkkklasaglcgrifgassdkrflrsgaqyvid.........................................
SPU_013095  A.....SNNSYYNangintsspsgnnfrkkresykrdkvkvtaph.........................................
SPU_021159  -.....-ENEISQnkshagvyentflshqn........................................................
SPU_021158  K.....IPKINFE.........................................................................
SPU_002737  P.....QADQQEVdhsnnvhltrmmygrnsdtdrqcfnrhpylrggcgtgsdglpnlhnlgmdn......................
SPU_000767  R.....RLSVRTEslqkhchnweledlmactdplalnakrdlngvamnqggna.................................
SPU_000765  Y.....RSRKSQQcqgtrllnhyemdsydgnyweehrdvaesnsnggstrldrnd...............................
SPU_026087  K.....IPKINFE.........................................................................
SPU_014121  R.....IPKINFE.........................................................................
SPU_005670  K.....IPKINFE.........................................................................
SPU_011220  Q.....PKPSRDDmgppvfshvgpsteiqlmdrspkrkvgtngmvpqgtylndaktigik..........................
SPU_024908  S.....LYDRPTGpagvhstgihfelisnneslsasatdyalkeetllgsgdicndldsgglhgrsggttgl..............
SPU_019709  RhvginL-----Trdamangaldssrlvmeskgnsysvrmrrevdvqmdhddseeev.............................
SPU_019711  M.....HSINMSGresiatcnhvdammtetsshsseadndlmqahlshqathnyavdknskpkennakmnagnknpavepllncml
SPU_019710  M.....HSINMSGresiatcnhvdammtetsshsseadndlmqahlshqathnyavdknskpkennakmnagnknpavepllncml
SPU_014649  Iled..DEMKNSM.........................................................................
SPU_026876  E.....GTDLRRImdcngdvvgpmkvatyqshqppsspklpaaatrrlashhescgiadtnfngssafasgcpld...........
SPU_025266  Q.....D-----Hehaankedsartndvaiaiddegtsksrseqngrtstsssrdhrrpptsqdin....................
SPU_014650  G.....FTRYQGK.........................................................................
SPU_021157  D.....DAAFEVNdygahdfkasdpfefdnrkssmesraigesllhkldmnpddvp..............................
SPU_017211  H.....HRHQFRSatsgrsteytvsidenkpdprfanynygptyrpvrneqyrntydnetxrmdsp....................
SPU_023734  I.....PKQGSSSqesamgvshgttesisapcrisrqhqvirrdett.......................................
SPU_024977  Iled..DEMKNSM.........................................................................
SPU_010605  S.....PTWV--Krrlsgficastvskavqvrhaqdsgqnaidtnqisskyltlstvpetkik.......................
SPU_016127  -.....------Sqpkpgeigsgqliwryrh.......................................................
SPU_027433  R.....TNRLSSNgddgyrrgsnlsstiiken......................................................
SPU_009498  -.....-------.........................................................................
SPU_013945  E.....DKANELL.........................................................................
SPU_028560  -.....-------.........................................................................
SPU_011478  L.....RAEDKAN.........................................................................
SPU_027434  M.....RLSHNGQ.........................................................................
SPU_014877  F.....YDENSRL.........................................................................
SPU_011871  Q.....TNYKKRR.........................................................................
SPU_017389  L.....RAEDKDN.........................................................................
SPU_011606  I.....IEKESKV.........................................................................
SPU_024212  -.....-------.........................................................................
SPU_005440  L.....QKG----.........................................................................
SPU_011607  C.....ERRYSTIqyicdtvqlatvldnkppss.....................................................
SPU_009312  -.....-VKITTS.........................................................................
SPU_007776  -.....-PWISKG.........................................................................
SPU_011608  AmfseaP-----Kvafisqislrnslgnnpttklshdp................................................
SPU_009313  E.....RNVQSAK.........................................................................
SPU_015655  -.....-------.........................................................................
SPU_016220  K.....ASGSNPN.........................................................................
SPU_026088  K.....IPKINFE.........................................................................
SPU_021097  -.....-------.........................................................................
SPU_018741  Q.....GSNPNES.........................................................................
SPU_003661  P.....GSNPNESckvgdlemkdinagkfglnvdtvfinlahvmdrqkal....................................
SPU_017132  -.....-------.........................................................................
SPU_015801  -.....-------.........................................................................
SPU_017912  -.....-------.........................................................................
SPU_006469  -.....-------.........................................................................
SPU_024212  G.....RDSSDYR.........................................................................
SPU_017914  R.....AARHASGrpsaghrvtaklrekayekvplkekslnnhsqqytvg....................................
SPU_006738  -.....-------.........................................................................
SPU_011609  -.....-------.........................................................................
SPU_004550  D.....LKKSSSSfttgsvkrrnevdgdgvlnp.....................................................
SPU_020202  -.....-------.........................................................................
SPU_006517  E.....RNVQSAK.........................................................................
SPU_007767  -.....-------.........................................................................
SPU_011608  -.....-------.........................................................................
SPU_019886  -.....-------.........................................................................
SPU_026087  -.....-------.........................................................................
SPU_011609  A.....EKQPRDTksaystinvegpngkgphmmrqtnshsnshsnsnshghnhgqgh.............................
SPU_021043  -.....-------.........................................................................
SPU_013639  -.....-------.........................................................................
SPU_020202  -.....-------.........................................................................
SPU_015638  -.....-------.........................................................................
SPU_003090  -.....-------.........................................................................
SPU_003089  -.....-------.........................................................................
SPU_022698  -.....-------.........................................................................
SPU_015638  -.....-------.........................................................................
SPU_003089  -.....-------.........................................................................
SPU_015639  -.....-------.........................................................................


                                                            140                            150      
                                                              |                              |      
d1oeda_       ...........................................DIDISDISGKQVTG.....................EVIFQTP.
SPU_001774  ...........................................RTLSDDVGNPNIDA.....................PSMSKGG.
SPU_018204  ...........................................VEHNTMRRFRADSD.....................DSDEGSS.
SPU_023216  ...........................................TITPSLLEEIESRN.....................RDINSSS.
SPU_013095  ...........................................ESPILGISRSGRGR.....................EGCCDNN.
SPU_021159  ...........................................GIAIMDDSEKK-SS.....................EESSVVS.
SPU_021158  ...........................................NASGSSGSSTEVVE.....................AGLHSNE.
SPU_002737  ...........................................E------------Wqthgheteeemlmdanid...LKGLRDN.
SPU_000767  ...........................................VSSKDGTVHLVECG.....................RRSDSFT.
SPU_000765  ...........................................RHTRPCSQPVTTHS.....................RSS----.
SPU_026087  ...........................................NASGSSGSSTGVVE.....................AGLHSNE.
SPU_014121  ...........................................NASGSSGSSTEVVE.....................AGLHSNE.
SPU_005670  ...........................................NASGSSGSSTEVVE.....................AGLHSNE.
SPU_011220  ...........................................YANYAHEESEPMML.....................DHKACKE.
SPU_024908  ...........................................GAGGGGRGNGRGDS.....................GGGHRQY.
SPU_019709  ...........................................PGTSNYRRGQYLPL.....................MTSA---.
SPU_019711  aqksmkaerfytpfneknnaiphyiipdelsghphaghmenniRSSSHTPTSKKRPR.....................PLLQEEP.
SPU_019710  aqksmkaerfytpfneknnaiphyiipdelsghphaghmenniRSSSHTPTSKKRPR.....................PLLQEEP.
SPU_014649  ...........................................GMDALNGNDRGHRR.....................TSLTYRP.
SPU_026876  ...........................................NLGGGASAANNSVT.....................TITCTSCn
SPU_025266  ...........................................R-------------.....................-------.
SPU_014650  ...........................................SVSRTPSDEERRFS.....................DH----N.
SPU_021157  ...........................................E-------------.....................-------.
SPU_017211  ...........................................DEDVENGMAYESRN.....................HRDCHVP.
SPU_023734  ...........................................G-------------.....................-------.
SPU_024977  ...........................................GMDALNGNDRGHRR.....................TSLTYRP.
SPU_010605  ...........................................K-------------.....................-------.
SPU_016127  ...........................................G--RQTPNGSIHSNrs...................SPPPSRP.
SPU_027433  ...........................................ANDTNSKMADESSY.....................PLHPKND.
SPU_009498  ...........................................--------------.....................-------.
SPU_013945  ...........................................IMNSLSNPTQQNNT.....................IISTQNQ.
SPU_028560  ...........................................--------------.....................-------.
SPU_011478  ...........................................ELLIMNSLSNPTPQ.....................NNTINST.
SPU_027434  ...........................................SEHKSDNTSSASKEdadveetqinksdv.......DNENN--.
SPU_014877  ...........................................KGTRDVELSTSKSP.....................SSCEAVT.
SPU_011871  ...........................................RSKRVDIPSDKTREppprnfngpsletareaegadPASNSLL.
SPU_017389  ...........................................ELLTMNSVSNPTPQ.....................NHTNIST.
SPU_011606  ...........................................TTNEEVLTNGNTAT.....................TILTTTD.
SPU_024212  ...........................................--------------.....................-------.
SPU_005440  ...........................................--------------.....................-------.
SPU_011607  ...........................................S-------------.....................-------.
SPU_009312  ...........................................AWSGDMGQDGASVC.....................PFPEGNH.
SPU_007776  ...........................................KNKNYMR--KFYSS.....................SL---PN.
SPU_011608  ...........................................TLNAPHLNGKATTE.....................TVA----.
SPU_009313  ...........................................SDGQDLNRSNNFSL.....................CDETRDN.
SPU_015655  ...........................................--------------.....................-------.
SPU_016220  ...........................................ESCKVGDLELKDKA.....................EKALSNE.
SPU_026088  ...........................................NASGSSGSSTGVVE.....................AGLHSNE.
SPU_021097  ...........................................--------------.....................-------.
SPU_018741  ...........................................RKAGGLEMKDSAAQ.....................TRSSDGH.
SPU_003661  ...........................................STESLGDLRVAWVK.....................-------.
SPU_017132  ...........................................--------------.....................-------.
SPU_015801  ...........................................--------------.....................-------.
SPU_017912  ...........................................--------------.....................-------.
SPU_006469  ...........................................--------------.....................-------.
SPU_024212  ...........................................QYGGHYTTNNFQNG.....................SHQRTET.
SPU_017914  ...........................................D---PYSMHNGGGM.....................EKENSHG.
SPU_006738  ...........................................--------------.....................-------.
SPU_011609  ...........................................--------------.....................-------.
SPU_004550  ...........................................VFEDDDGNGDPFQA.....................STSASNC.
SPU_020202  ...........................................--------------.....................-------.
SPU_006517  ...........................................SDGQDLNRPNNFSL.....................CEETRDN.
SPU_007767  ...........................................--------------.....................-------.
SPU_011608  ...........................................--------------.....................-------.
SPU_019886  ...........................................--------------.....................-------.
SPU_026087  ...........................................--------------.....................-------.
SPU_011609  ...........................................NHGHNHGSD-----.....................-------.
SPU_021043  ...........................................--------------.....................-------.
SPU_013639  ...........................................--------------.....................-------.
SPU_020202  ...........................................--------------.....................-------.
SPU_015638  ...........................................--------------.....................-------.
SPU_003090  ...........................................--------------.....................-------.
SPU_003089  ...........................................--------------.....................-------.
SPU_022698  ...........................................--------------.....................-------.
SPU_015638  ...........................................--------------.....................-------.
SPU_003089  ...........................................--------------.....................-------.
SPU_015639  ...........................................--------------.....................-------.


                160                                                                     170         
                  |                                                                       |         
d1oeda_       LIKNPD..........VKSAIEG....................................................VKYIAEHM..K
SPU_001774  GRYSKE..........FKQAVDG....................................................VKFIAQHL..K
SPU_018204  RTRERE..........WKALLAS....................................................LQYIKDNI..N
SPU_023216  ASLPKE..........CMDMLDS....................................................LEVIAMHM..K
SPU_013095  DDQLIL..........LRRMIDH....................................................MRYIRDHF..E
SPU_021159  KRFESM..........THDIMTN....................................................LKYIVKKK..K
SPU_021158  MLLELD..........VANLPTSqsstcvqldrrgrirfimsqiasc............................LQQVVEHS..E
SPU_002737  GKTPAR..........LKEGLEY....................................................LNYIVERT..K
SPU_000767  RDAIPI..........LRSMLTE....................................................LRKLTANN..R
SPU_000765  -----SnsmrmreinlLRKIHDD....................................................FRYLKETQ..K
SPU_026087  MPLELD..........VANLPTSqsstcvqldhrgrirfimsqiasc............................LQQVVEHS..E
SPU_014121  MPLELD..........VANLPTSqsgtcvqldrrgrirfimsqiasc............................LRLVVEHS..E
SPU_005670  MPLELD..........VANLPTSqsgtcvqldrrgrirfimsqiasc............................LRQVVEHS..E
SPU_011220  GNSREQ..........LDLIIRE....................................................VRFLTERY..K
SPU_024908  SWKDRS..........FRDIQNN....................................................VKFLASRY..A
SPU_019709  -----Ekeeneamv..IHKAVEE....................................................IMYLTWKC..A
SPU_019711  PLQYMV..........AQQTVED....................................................IMYLTSRS..I
SPU_019710  PLQYMV..........AQQTVED....................................................IMYLTSRS..I
SPU_014649  QHRNNA..........QNNARNNtaygprytnvnps.......................................ITRRRKKK..P
SPU_026876  GAIKRQ..........LGNISED....................................................LHTMIEDR..Q
SPU_025266  ------..........------Slqldamrkagdadcgflegkveteepdcmqet....................LCSFAQSI..R
SPU_014650  NSLCSD..........ILNCITG....................................................NAEYRESR..L
SPU_021157  ------..........------Skpkekqssqdsdygsetnddsmgssimrigny....................IRRLVNNS..R
SPU_017211  GEKEHPv.........FFGLFKS....................................................SFSSSSPS..P
SPU_023734  ------..........------Elrttasappldnkhpqplqttspsgrqasalgret.................SRMQGQEV..S
SPU_024977  QHRTNA..........QNNARNNtaygprytnvnps.......................................ITRRRKKK..P
SPU_010605  ------..........-------....................................................--------..-
SPU_016127  SSIDGD..........RHPSSNG....................................................ISSGAGKE..Q
SPU_027433  VNSTSK..........LSIHRQG....................................................FGDDYESE..S
SPU_009498  ------..........-------....................................................--------..-
SPU_013945  ENGMYE..........EKKTNGV....................................................VQTISQPP..E
SPU_028560  ------..........-------....................................................--------..-
SPU_011478  QNQENGmh........VEKKANG....................................................VVQTISQL..P
SPU_027434  ------..........------Aelesqtktkekrtl......................................QSNGRRRQ..S
SPU_014877  ESTSLK..........EGSIDGK....................................................TNKIAD--..-
SPU_011871  VSHANN..........VRHLHPN....................................................TS---HDY..H
SPU_017389  QKQEHG..........MHEETEKngvvqtms............................................QSPEFDTV..S
SPU_011606  VKKDEV..........RRLAFDS....................................................--------..-
SPU_024212  ------..........-------....................................................--------..-
SPU_005440  ------..........-------....................................................--------..-
SPU_011607  -----D..........SAGESSSlre.................................................GSIDFKAL..K
SPU_009312  GKTPPE..........ARSSEEP....................................................VS------..-
SPU_007776  ITDIVF..........MNGKTEV....................................................NKSSSKAD..D
SPU_011608  ------..........--KNHSP....................................................QD-FLARG..T
SPU_009313  TPQVIQ..........SRENVS-....................................................--------..-
SPU_015655  ------..........-------....................................................--------..-
SPU_016220  SHDNSH..........LAQSSKW....................................................TRFGQPT-..-
SPU_026088  MPLELD..........VANLPTSqsstcvqldrrgrirfimsqiasc............................LQQVVEHS..E
SPU_021097  ------..........-------....................................................--------..-
SPU_018741  TLSQLD..........VWVKRQS....................................................T----NRF..D
SPU_003661  -----T..........LTSNWTR....................................................I-----GQ..Q
SPU_017132  ------..........-------....................................................--------..-
SPU_015801  ------..........-------....................................................--------..-
SPU_017912  ------..........-------....................................................--------..-
SPU_006469  ------..........-------....................................................--------..-
SPU_024212  GHATLN..........QYNQTPSrnsmhvrfgtattpgnesdmlledrdvgggmgelesmqdrrlarlerscgdiFKHMKNLQ..K
SPU_017914  GMYAGH..........FQKIAGElrrmndilitit........................................T--EALSVdkK
SPU_006738  ------..........-------....................................................--------..-
SPU_011609  ------..........-------....................................................--------..-
SPU_004550  DPIEML..........MSKISRG....................................................VAHFAKLT..F
SPU_020202  ------..........-------....................................................--------..-
SPU_006517  TPQVIQ..........-------....................................................--------..-
SPU_007767  ------..........-------....................................................--------..-
SPU_011608  ------..........-------....................................................--------..-
SPU_019886  ------..........-------....................................................--------..-
SPU_026087  ------..........-------....................................................--------..-
SPU_011609  ------..........------Sggeevhdnensqlyepklidhk..............................LKMKSRFH..Q
SPU_021043  ------..........-------....................................................--------..-
SPU_013639  ------..........-------....................................................--------..-
SPU_020202  ------..........-------....................................................--------..-
SPU_015638  ------..........-------....................................................--------..-
SPU_003090  ------..........-------....................................................--------..-
SPU_003089  ------..........-------....................................................--------..-
SPU_022698  ------..........-------....................................................--------..-
SPU_015638  ------..........-------....................................................--------..-
SPU_003089  ------..........-------....................................................--------..-
SPU_015639  ------..........-------....................................................--------..-


              180                                  190       200       210       220                
                |                                    |         |         |         |                
d1oeda_       SDEESS.....................N......AAEEWKYVAMVIDHILLCVFMLICIIGTVSVFA----------grlielsqe
SPU_001774  SEDEFN.....................S......VTEDWKYVAMVIDRIFLWIFLICVICGTSGIILSAPLI-----fe.......
SPU_018204  YEDDVD.....................Q......SEEDWKFVALVIDRILLWVFLLVAVVGTIAVFIEAPIFW----e........
SPU_023216  REDDED.....................Q......ISEDWRFVALVMDRMFLFIFALMCLSGTVGIILRAPLLW----e........
SPU_013095  EIDDSE.....................D......IKNEWKQIALVVDRVFAIFYVFGS-------------------igtilm...
SPU_021159  DEDAED.....................D......IMTEWKYVAVVFDRLFMWVFLLATTICTLAIICQ---------p........
SPU_021158  DAIIDE.....................E......IKGEWMRIAFVVDRFFMWLFGLSTAVATCGVLL----------q........
SPU_002737  DADKDH.....................K......VQAEWHYVAMVIDRIFLWIYIVIVLTGSMGIFLYSPLL-----we.......
SPU_000767  SEREEK.....................L......RQNEWQRVALVMDRVFLLIFLSGTFAASAFMF-----------s........
SPU_000765  RKEHEQ.....................K......CHNEWKQVALVVDRIFMFIYLIG--------------------yi.......
SPU_026087  DAIVDE.....................E......IKGEWMRIAFVVDRFFMWLFGLSTAVATCGVLL----------q........
SPU_014121  DGIVDE.....................E......IKGEWMRIAFVFDRFFMWLFGLSTAVATCGVLL----------q........
SPU_005670  DGIVDE.....................E......IKGEWMRIAFVFDRFFMWLFGLSTAVATCGVLL----------q........
SPU_011220  LKDMED.....................D......EIHDWKFAAMVIDRFAMVFLTIFTVVATVVIL-----------s........
SPU_024908  DRDQDE.....................Q......ITSDWQNVARVVDRFFLIIYIVCVILMDVVMVL----------q........
SPU_019709  SDEDSN.....................R......EKEDWKFVAMVIDRIFLIIYICGICVGNIVIIFQAP-------l........
SPU_019711  NNEYAT.....................K......AREEWKLVAMVIDRIFLIIYLCAVFIGTLSIVLEA--------pl.......
SPU_019710  NNEYAT.....................K......AREEWKLVAMVIDRIFLIIYLCAVFIGTLSIVLEA--------pl.......
SPU_014649  KRIRVL.....................P......RIRNVNTVDRVSRILFPFLFLLFNVLYWVGYLYV---------lp.......
SPU_026876  MDEEKE.....................A......IVSEWKKMAHVFDRLGLLLFIMATVILAIV-------------l........
SPU_025266  EK--VC.....................V......FGFNPYSVDKVARVAFPLTFFSLNLVYWLVYL-----------v........
SPU_014650  RRSKDQ.....................K......PFNSVSKIDELARIGFPLGFFLMNVLYWCIFIL----------.........
SPU_021157  KKEALS.....................A......IQQQWIDMCLILDRVLLFLMMTALALGLFSIL-----------s........
SPU_017211  SQGSHR.....................S......SKLLALRIDQLARVLFPLTFLLLSVTYWSYYLS----------r........
SPU_023734  TCYHCN.....................S......MPGETHVIDLISRWLFSIGFAIFNICFWAYYL-----------.........
SPU_024977  KRIRVL.....................P......RIRNVNTVDRVSRILFPFLFLLFNVLYWVGYLYV---------lp.......
SPU_010605  -----QedkasgnpnadganpsletreE......IIAQWQELSMKVNRIMAFLLTSSVMLTALVIL-----------flyi.....
SPU_016127  EKDKVK.....................E......ERTEMEVIAEIVNRLIFIMFFILYLSFLIYWFV----------mq.......
SPU_027433  STLKRE.....................V......IRQEWMTVARKLDKTLGALVAGSTLLVI---------------tlifilf..
SPU_009498  ------.....................-......-------------------------------------------nqsqptdar
SPU_013945  VDTVSM.....................Rydlev.VNRTWQEVAIVCDKFLFILLLLVTFVAWLYLL-----------vs.......
SPU_028560  ------.....................-......-------------------------------------------pil......
SPU_011478  EFDTVS.....................MrydlevLSRTWQEVAIVCDKFLFILLLL---------------------cs.......
SPU_027434  ASFKRD.....................V......VIEEWRLLARVVDKMVFTLVLILTCAV----------------llsli....
SPU_014877  -SEEEL.....................D......YSFLWKHLALAIERVFGIILSACMLGCV---------------iy.......
SPU_011871  KEIDPE.....................M......IGQTWRDTAIVIDKLIFFILLLLTATSWVYMIV----------sf.......
SPU_017389  MRSDLE.....................L......VSRTWQEVAIVCDKVLFILLLLVTLFTWLYVL-----------v........
SPU_011606  --ESKD.....................V......NQFVWRQVALAFDSLCGTVLCC---------------------amlg.....
SPU_024212  ------.....................-......-------------------------------------------.........
SPU_005440  ------.....................-......-------------------------------------------aiivhhdgs
SPU_011607  MRSPME.....................Lt.....NGFMWKQLAHGIDRAFGTILS----------------------acmlgcgiy
SPU_009312  ------.....................-......EETDMELVAIIFDRIFLFLFLVVELWML---------------sli......
SPU_007776  DQEMDD.....................R......NVYLWKQTALAFDSFCGTILSLCMLGT----------------llyal....
SPU_011608  PETTYE.....................K......NAMMWRETALVLDKVFGLV------------------------qfliiigac
SPU_009313  ------.....................-......EENDMELVATIVDRIFLCTFLVIEICMIFM-------------f........
SPU_015655  ------.....................-......-------------------------------------------.........
SPU_016220  -QSEMS.....................D......MEQDFEVLAQLLDRIFFLGILVTLLVITLKFM-----------m........
SPU_026088  DAIVDE.....................E......IKGEWMRIAFVVDRFFMWLFGLSTAVATCGVLL----------q........
SPU_021097  ------.....................-......-------------------------------------------cflkrgkek
SPU_018741  EQDKTE.....................Sp.....KIHDFELLARIMDRLFLFATLVSLT------------------aitvkfl..
SPU_003661  PQSEMP.....................D......MEQDFEVLAQILDRIFFLGILVTLLVITLKFM-----------m........
SPU_017132  ------.....................-......-------------------------------------------skpl.....
SPU_015801  ------.....................-......-------------------------------------------vmlcpfi..
SPU_017912  ------.....................-......-------------------------------------------.........
SPU_006469  ------.....................-......-------------------------------------------vgpwflvgg
SPU_024212  KRERQN.....................Q......LKSDWGKVAQVLDRVLLVVFVICTTATALVLLL----------q........
SPU_017914  TSTKEK.....................A......IQKEWLQIAKVLDRVFLTLYLLGNAMTVTYLL-----------v........
SPU_006738  ------.....................-......-------------------------------------------.........
SPU_011609  ------.....................-......-------------------------------------------dt.......
SPU_004550  DEAESK.....................R......TSMEWMHIASVLDRFFTYFFAIICLAITLGTI-----------va.......
SPU_020202  ------.....................-......-------------------------------------------aslfs....
SPU_006517  -SRENV.....................S......EENDMELVAIIVDRMFLCTFLVIEICMIFM-------------f........
SPU_007767  ------.....................-......-------------------------------------------gqnalsavv
SPU_011608  ------.....................-......-------------------------------------------g........
SPU_019886  ------.....................-......-------------------------------------------.........
SPU_026087  ------.....................-......-------------------------------------------hnpngvkdk
SPU_011609  RDNKNK.....................El.....NALLWREFALALDKG-LGIFVAMIIVGECLYVM----------iifia....
SPU_021043  ------.....................-......-------------------------------------------paeq.....
SPU_013639  ------.....................-......-------------------------------------------pae......
SPU_020202  ------.....................-......-------------------------------------------qt.......
SPU_015638  ------.....................-......-------------------------------------------ktvkvnges
SPU_003090  ------.....................-......-------------------------------------------fvsv.....
SPU_003089  ------.....................-......-------------------------------------------vsvvn....
SPU_022698  ------.....................-......-------------------------------------------kdqpghm..
SPU_015638  ------.....................-......-------------------------------------------yrfypk...
SPU_003089  ------.....................-......-------------------------------------------fvsvv....
SPU_015639  ------.....................-......-------------------------------------------gliyrfy..


                                                                                                    
                                                                                                    
d1oeda_       g.....................................................................................
SPU_001774  ......................................................................................
SPU_018204  ......................................................................................
SPU_023216  ......................................................................................
SPU_013095  ......................................................................................
SPU_021159  ......................................................................................
SPU_021158  ......................................................................................
SPU_002737  ......................................................................................
SPU_000767  ......................................................................................
SPU_000765  ......................................................................................
SPU_026087  ......................................................................................
SPU_014121  ......................................................................................
SPU_005670  ......................................................................................
SPU_011220  ......................................................................................
SPU_024908  ......................................................................................
SPU_019709  ......................................................................................
SPU_019711  ......................................................................................
SPU_019710  ......................................................................................
SPU_014649  ......................................................................................
SPU_026876  ......................................................................................
SPU_025266  ......................................................................................
SPU_014650  ......................................................................................
SPU_021157  ......................................................................................
SPU_017211  ......................................................................................
SPU_023734  ......................................................................................
SPU_024977  ......................................................................................
SPU_010605  ......................................................................................
SPU_016127  ......................................................................................
SPU_027433  ......................................................................................
SPU_009498  pnwverrlsgficastvskavqvrhaqdsgqnaigtnqisskyltlstvpetkikkqedkangnpnadganpsqetkediiaqwqe
SPU_013945  ......................................................................................
SPU_028560  ......................................................................................
SPU_011478  ......................................................................................
SPU_027434  ......................................................................................
SPU_014877  ......................................................................................
SPU_011871  ......................................................................................
SPU_017389  ......................................................................................
SPU_011606  ......................................................................................
SPU_024212  ......................................................................................
SPU_005440  ddpae.................................................................................
SPU_011607  ......................................................................................
SPU_009312  ......................................................................................
SPU_007776  ......................................................................................
SPU_011608  lyml..................................................................................
SPU_009313  ......................................................................................
SPU_015655  ......................................................................................
SPU_016220  ......................................................................................
SPU_026088  ......................................................................................
SPU_021097  stlkrhanl.............................................................................
SPU_018741  ......................................................................................
SPU_003661  ......................................................................................
SPU_017132  ......................................................................................
SPU_015801  ......................................................................................
SPU_017912  ......................................................................................
SPU_006469  dgcck.................................................................................
SPU_024212  ......................................................................................
SPU_017914  ......................................................................................
SPU_006738  ......................................................................................
SPU_011609  ......................................................................................
SPU_004550  ......................................................................................
SPU_020202  ......................................................................................
SPU_006517  ......................................................................................
SPU_007767  eind..................................................................................
SPU_011608  ......................................................................................
SPU_019886  ......................................................................................
SPU_026087  gwsdanlkwnpddy........................................................................
SPU_011609  ......................................................................................
SPU_021043  ......................................................................................
SPU_013639  ......................................................................................
SPU_020202  ......................................................................................
SPU_015638  kiksmirqwqtilnynstltafa...............................................................
SPU_003090  ......................................................................................
SPU_003089  ......................................................................................
SPU_022698  ......................................................................................
SPU_015638  ......................................................................................
SPU_003089  ......................................................................................
SPU_015639  ......................................................................................


                                           
                                           
d1oeda_       .............................
SPU_001774  .............................
SPU_018204  .............................
SPU_023216  .............................
SPU_013095  .............................
SPU_021159  .............................
SPU_021158  .............................
SPU_002737  .............................
SPU_000767  .............................
SPU_000765  .............................
SPU_026087  .............................
SPU_014121  .............................
SPU_005670  .............................
SPU_011220  .............................
SPU_024908  .............................
SPU_019709  .............................
SPU_019711  .............................
SPU_019710  .............................
SPU_014649  .............................
SPU_026876  .............................
SPU_025266  .............................
SPU_014650  .............................
SPU_021157  .............................
SPU_017211  .............................
SPU_023734  .............................
SPU_024977  .............................
SPU_010605  .............................
SPU_016127  .............................
SPU_027433  .............................
SPU_009498  lsikvnrimgflltssvmltalvitflyi
SPU_013945  .............................
SPU_028560  .............................
SPU_011478  .............................
SPU_027434  .............................
SPU_014877  .............................
SPU_011871  .............................
SPU_017389  .............................
SPU_011606  .............................
SPU_024212  .............................
SPU_005440  .............................
SPU_011607  .............................
SPU_009312  .............................
SPU_007776  .............................
SPU_011608  .............................
SPU_009313  .............................
SPU_015655  .............................
SPU_016220  .............................
SPU_026088  .............................
SPU_021097  .............................
SPU_018741  .............................
SPU_003661  .............................
SPU_017132  .............................
SPU_015801  .............................
SPU_017912  .............................
SPU_006469  .............................
SPU_024212  .............................
SPU_017914  .............................
SPU_006738  .............................
SPU_011609  .............................
SPU_004550  .............................
SPU_020202  .............................
SPU_006517  .............................
SPU_007767  .............................
SPU_011608  .............................
SPU_019886  .............................
SPU_026087  .............................
SPU_011609  .............................
SPU_021043  .............................
SPU_013639  .............................
SPU_020202  .............................
SPU_015638  .............................
SPU_003090  .............................
SPU_003089  .............................
SPU_022698  .............................
SPU_015638  .............................
SPU_003089  .............................
SPU_015639  .............................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0041810 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Chlorella variabilis sp. NC64A
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Porphyridium purpureum 02_2012
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Aureococcus anophagefferens
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Fragilariopsis cylindrus
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Nostoc punctiforme PCC 73102
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Thermotoga thermarum DSM 5069
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Azospirillum brasilense Sp245
NoYes   Nitrosococcus watsonii C-113
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Francisella sp. TX077308
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella tularensis subsp. tularensis WY96-3418
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Methanoregula boonei 6A8
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Francisella tularensis subsp. mediasiatica FSC147
NoYes   Francisella tularensis subsp. tularensis TIGB03
NoYes   Francisella tularensis subsp. tularensis TI0902
NoYes   Francisella tularensis subsp. tularensis NE061598
NoYes   Francisella tularensis subsp. tularensis FSC198
NoYes   Francisella tularensis subsp. tularensis SCHU S4
NoYes   Francisella cf. novicida Fx1
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Phoenix dactylifera - Date palm
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]