SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302841|ref|YP_001190157.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302841|ref|YP_001190157.1|
Domain Number 1 Region: 12-84
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.00000000000000193
Family Pseudouridine synthase II TruB 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146302841|ref|YP_001190157.1|
Sequence length 84
Comment DKCLD domain-containing protein [Metallosphaera sedula DSM 5348]
Sequence
MDFSPFVERIDKFCGYNQPWEVRKDYVPAGDFGVQPDKRTIKDLINTSIINVDKPPGPTS
HEVAFWVKTMFNLPRVGHGGTLEP
Download sequence
Identical sequences A0A088E4E6 A4YCT1
WP_011921202.1.15515 WP_011921202.1.27320 WP_011921202.1.28583 WP_011921202.1.31166 WP_011921202.1.34633 WP_011921202.1.8883 WP_011921202.1.99084 gi|146302841|ref|YP_001190157.1| 399549.Msed_0056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]