SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302842|ref|YP_001190158.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302842|ref|YP_001190158.1|
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.38e-39
Family Pseudouridine synthase II TruB 0.0000169
Further Details:      
 
Domain Number 2 Region: 150-228
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000127
Family PUA domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146302842|ref|YP_001190158.1|
Sequence length 233
Comment PUA domain-containing protein [Metallosphaera sedula DSM 5348]
Sequence
MSVVTKSGKEYVCLMEVHCDFQEERLRAIAKEFVGTIYQKPPVRSSVKRRVRKRKIYSLE
VLEMEGRRVLMKISSEPGTYMRKICHDMGILLGCGAHMRELRRTRSGIFTEDTVVTLQQV
SEALYLYRNCGEEDELRRILIPMEMAFCGIPKIIVDDETVNSLAYGSPLMAPGIVAFQGF
KKGDTVALITWKGEGIALGKALVDSVSMGKRGEVVKPERVLMDKDVYPKAWKK
Download sequence
Identical sequences A0A088E1R5 A4YCT2
gi|146302842|ref|YP_001190158.1| 399549.Msed_0057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]