SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302862|ref|YP_001190178.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302862|ref|YP_001190178.1|
Domain Number 1 Region: 9-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-44
Family Ribonuclease PH domain 1-like 0.000000612
Further Details:      
 
Domain Number 2 Region: 153-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.83e-24
Family Ribonuclease PH domain 2-like 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146302862|ref|YP_001190178.1|
Sequence length 245
Comment exosome complex exonuclease Rrp41 [Metallosphaera sedula DSM 5348]
Sequence
MLQVQKPKLILDDGRRLDGRRPDELRPMKMEIGVLKNADGSSLVEVGNTKIIAAVYGPRE
MHPRHLALPNRATLRVRYHMTPFSTDERKSPVPSRREIELSKVIREALESSILVEQFPRS
SIDVFMEVIQADAGTRLASLMAASLAVVDAGIPVKDVIAAVAVGKADGVVVLDLNEPEDM
WGEADMPVAMLPSLGQITLIQLNGNMTQQEFKQGLELAYKGISTIYNLEKEVLRNKFAEI
HEEGS
Download sequence
Identical sequences A0A088E1S9 A4YCV2
399549.Msed_0077 WP_011921223.1.15515 WP_011921223.1.27320 WP_011921223.1.28583 WP_011921223.1.31166 WP_011921223.1.34633 WP_011921223.1.8883 WP_011921223.1.99084 gi|146302862|ref|YP_001190178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]