SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302863|ref|YP_001190179.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302863|ref|YP_001190179.1|
Domain Number 1 Region: 10-176,205-218
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-56
Family Ribonuclease PH domain 1-like 0.000000251
Further Details:      
 
Domain Number 2 Region: 191-272
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-17
Family Ribonuclease PH domain 2-like 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146302863|ref|YP_001190179.1|
Sequence length 280
Comment exosome complex RNA-binding protein Rrp42 [Metallosphaera sedula DSM 5348]
Sequence
MSMTPTNENVIPLIKKESIIALLERGTRSDGRKFTDYRPLSITLGYAKKADGSALVKLGD
TTVLAGVKVEEDEPYPDTPNQGNLVVNAELLPLAYETFEPGPPDENAIELSRVVDRSLRD
SKAVDLSGLVIEPGKKVWTVWVDISVLDYGGNVLDACTIAAVAALYDAKLPKVVRENDNI
IIQKEEKVTPLPIKYPVVTVSVAKIGKFLVVDPDLEEEGIMDAKISFSYIPSGNIVGIQK
SGEGSFSQQEVEVAEGMASATSQKLLEELKSLIGIGKGES
Download sequence
Identical sequences A0A088E357 A4YCV3
399549.Msed_0078 gi|146302863|ref|YP_001190179.1| WP_011921224.1.15515 WP_011921224.1.27320 WP_011921224.1.28583 WP_011921224.1.31166 WP_011921224.1.34633 WP_011921224.1.8883 WP_011921224.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]