SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302896|ref|YP_001190212.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302896|ref|YP_001190212.1|
Domain Number 1 Region: 132-210
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-19
Family Translational machinery components 0.0024
Further Details:      
 
Domain Number 2 Region: 48-119
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.81e-18
Family Ribosomal S5 protein, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146302896|ref|YP_001190212.1|
Sequence length 214
Comment 30S ribosomal protein S5 [Metallosphaera sedula DSM 5348]
Sequence
MAEEVPVSNVEEWKPRTKIGQLVKEGKITSIKELYARNMSIAEPEIIDVLLPNMKYEVID
IGMVQKQTDAGELSRYKVLVVMGNYDGYVSIGVGKSKQLRVAIQKAIRDAKMHVIPVRRG
CGSWECTCGESHSLPFLVSGKSGSAEVVLRPAPKGTGLVAGGVLKTLLTYAGIKDVWSFS
RGETRTTDNFIMAGYRALYNTYKFVTPVDWARRR
Download sequence
Identical sequences A0A088E4J9 A4YCY6
399549.Msed_0111 WP_011921257.1.15515 WP_011921257.1.27320 WP_011921257.1.28583 WP_011921257.1.31166 WP_011921257.1.34633 WP_011921257.1.8883 WP_011921257.1.99084 gi|146302896|ref|YP_001190212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]