SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302925|ref|YP_001190241.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302925|ref|YP_001190241.1|
Domain Number 1 Region: 1-43
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000152
Family CopG-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146302925|ref|YP_001190241.1|
Sequence length 57
Comment hypothetical protein Msed_0140 [Metallosphaera sedula DSM 5348]
Sequence
MRVITFKAEEDLVMMLELYAIRNGLNRSEAIRKAIEAMVKEERGKKGKKGRVEVVKL
Download sequence
Identical sequences A0A088E1G6 A4YD15
gi|146302925|ref|YP_001190241.1| 399549.Msed_0140 WP_011921285.1.15515 WP_011921285.1.27320 WP_011921285.1.28583 WP_011921285.1.31166 WP_011921285.1.34633 WP_011921285.1.8883 WP_011921285.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]