SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302991|ref|YP_001190307.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302991|ref|YP_001190307.1|
Domain Number 1 Region: 28-185,245-359
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.73e-43
Family tRNA pseudouridine synthase TruD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146302991|ref|YP_001190307.1|
Sequence length 365
Comment tRNA pseudouridine synthase D [Metallosphaera sedula DSM 5348]
Sequence
MRMSLLDLAIGIEFKVHRWASIRAEIPRPDGFRVTEEIDGKPCTAWRGSESGKYAVYLLR
KRGMEHNAVMSRLASILGEKPRYLGIKDTNAVTEQLIYVTRKSKDFHREESFSIEFMGFT
STKLNHTGNIFSIKLETGDKEELKRRVNTIKGEGVLPAFIGYQRFGTRRPITHLVGKALT
QRDWCKAVDFILGYPFVWENENIRLFREEYMKGEVKEELLRKIPSQERNIYLELRKTEDC
LSALRKSRVKLSFYVEAYQSYLFNRVLSRKLRYSTVHERDEITIPTDPKQCDAECLEVFE
VEGIQRGSFHIEELGISLRPVKRNAFMNVRGLHFDGEFVTFSLERGMYATVVLSEILNAD
PKEFT
Download sequence
Identical sequences A0A088E4U5 A4YD81
399549.Msed_0206 gi|146302991|ref|YP_001190307.1| WP_011921351.1.15515 WP_011921351.1.27320 WP_011921351.1.28583 WP_011921351.1.31166 WP_011921351.1.34633 WP_011921351.1.8883 WP_011921351.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]