SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303158|ref|YP_001190474.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303158|ref|YP_001190474.1|
Domain Number 1 Region: 8-82
Classification Level Classification E-value
Superfamily SirA-like 1.83e-20
Family SirA-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303158|ref|YP_001190474.1|
Sequence length 84
Comment SirA family protein [Metallosphaera sedula DSM 5348]
Sequence
MSSEPLKVKEPDDQLDVIGESCPVPEMMASKKLKKMKPGQVLEVITDHQPAVDVTLPSLC
KNMGYPYLVLKDGDVYRFRILKVG
Download sequence
Identical sequences A0A088E421 A4YDP8
WP_011921518.1.15515 WP_011921518.1.27320 WP_011921518.1.28583 WP_011921518.1.31166 WP_011921518.1.34633 WP_011921518.1.8883 WP_011921518.1.99084 gi|146303158|ref|YP_001190474.1| 399549.Msed_0373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]