SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303278|ref|YP_001190594.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303278|ref|YP_001190594.1|
Domain Number 1 Region: 4-200,302-389
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.86e-88
Family Bacterial dinuclear zinc exopeptidases 0.0000119
Further Details:      
 
Domain Number 2 Region: 187-291
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 5.63e-30
Family Bacterial exopeptidase dimerisation domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303278|ref|YP_001190594.1|
Sequence length 391
Comment amidohydrolase [Metallosphaera sedula DSM 5348]
Sequence
MDAQRIYNEAREIEDKVIELRRKIHENPELSYQEYETAKLVANYLRSLGIDVREGVGTET
GVLGVIKGRRSGTVALRADMDALPVTEETGLPFASKKPGVMHACGHDAHTAMLLGAATIL
SRHLDEIGEVRLIFQPAEEDGGRGGALPMIEAGVMEGVDYVFGLHVMSGYPSGTLATRGG
AIMACPDSFRVEVVGRGGHGSAPHETIDPVFISAMIVNALQGIRSRQINPLEPFVLSVTS
IHSGTKDNIIPDRAVMEGTIRTLNEKVRETALKSFRNIVKSVCEAYGAECLVQFKEDAYP
VTVNDPDTTKRAMEILKDIPGAEVKETQPVMGGEDFSRFLQRAKGSFIFLGTRNEKKGIV
YPNHSSKFTVDEDALKVGVTALALLASKFSS
Download sequence
Identical sequences A0A088E4H4 A4YE18
gi|146303278|ref|YP_001190594.1| 399549.Msed_0493 WP_012020458.1.15515 WP_012020458.1.27320 WP_012020458.1.28583 WP_012020458.1.31166 WP_012020458.1.34633 WP_012020458.1.8883 WP_012020458.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]