SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303396|ref|YP_001190712.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303396|ref|YP_001190712.1|
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000911
Family GHMP Kinase, N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303396|ref|YP_001190712.1|
Sequence length 247
Comment pantothenate kinase [Metallosphaera sedula DSM 5348]
Sequence
MVDVVIPISVSGIWRPFISDNPTRSGSIGITVILEPYSFARVTEGEGVYLNGNPVKMKNL
EYLEAKMGKVRVNMESKVPLGFGYGMSASVSLAYALGASQIRGIDLEQAALLAHESEVIS
GNGLGDVVSQFFGRNIVYRERPGFPPYGVIRIFEISSDDIYSKPLEALPTKSILQPLDVS
FTLINEFLSNPSIDKFFEVSRKFTEALGFTSPFPNSFRKKGLILKLGKPESDSWIRHRIA
SRGAYVE
Download sequence
Identical sequences A0A088E603 A4YED6
gi|146303396|ref|YP_001190712.1| WP_012020575.1.15515 WP_012020575.1.27320 WP_012020575.1.28583 WP_012020575.1.31166 WP_012020575.1.34633 WP_012020575.1.8883 WP_012020575.1.99084 399549.Msed_0613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]