SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303450|ref|YP_001190766.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303450|ref|YP_001190766.1|
Domain Number 1 Region: 288-427
Classification Level Classification E-value
Superfamily vWA-like 4.61e-17
Family Integrin A (or I) domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303450|ref|YP_001190766.1|
Sequence length 451
Comment von Willebrand factor, type A [Metallosphaera sedula DSM 5348]
Sequence
MTGLLRGVDYESPVVKYRGERILNTLRRVSGKESNVDPLFLIDTYYVHYLPLPILKTKGE
IDQSDSIKYSLIDLTISSEIVNRNRNYSIANSAVSMALSVSYVQNLIEELERIRRTSQSQ
EEREAAEQILNGIMKGSQGKEGKQNQNQQQENQTTGKLMKQVHEKAMAKASEDANSVRSM
QRIVGGNGAGTGSMMNFEGDIHDVLRLARNTEIKKILEFLSGIPKLGSFTKKRTTRYARG
ELYGYEEGSDLERLVPSELALPEELFDVKLAESQLLLYQKQIKETLGPIYLLLDKSGSMD
GEKILWAKAVALALYSRARRENRDFYLRFFDNIPYPLIKVIKNAKSKDVIKMVEYIGKIR
GGGGTDISRSVMSACDDIKDGHVRGVSEVIILTDGEDKIAETTVRRSLKEANATLISVMI
RGDNADLKRVSDNYLVVYRLDQGDLLRVVES
Download sequence
Identical sequences A0A088E303 A4YEJ0
399549.Msed_0667 WP_012020629.1.15515 WP_012020629.1.27320 WP_012020629.1.28583 WP_012020629.1.31166 WP_012020629.1.34633 WP_012020629.1.8883 WP_012020629.1.99084 gi|146303450|ref|YP_001190766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]