SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303561|ref|YP_001190877.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303561|ref|YP_001190877.1|
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily ITPase-like 8.72e-45
Family YjjX-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303561|ref|YP_001190877.1|
Sequence length 169
Comment hypothetical protein Msed_0778 [Metallosphaera sedula DSM 5348]
Sequence
MLVCVGSTNPVKLEAVKDAIKEIGKEWEIKGVQVSSNVSEQPWCNETLVGARNRAINALI
QEGCDVGVGIEGGVCWERERIVAFAAIYVVNREKENFSYSPAFTLSNELAKLVIRGKELG
EATDIVYGKTNTKHGEGAVGMLTKIVDRKRLYKDAVILALYPFYMESER
Download sequence
Identical sequences A0A088E3C9 A4YEV1
gi|146303561|ref|YP_001190877.1| 399549.Msed_0778 WP_012020740.1.15515 WP_012020740.1.27320 WP_012020740.1.28583 WP_012020740.1.31166 WP_012020740.1.34633 WP_012020740.1.8883 WP_012020740.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]