SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303980|ref|YP_001191296.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|146303980|ref|YP_001191296.1|
Domain Number - Region: 20-77
Classification Level Classification E-value
Superfamily SirA-like 0.0017
Family SirA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146303980|ref|YP_001191296.1|
Sequence length 79
Comment hypothetical protein Msed_1211 [Metallosphaera sedula DSM 5348]
Sequence
MKILRELEFRREEICGANNPVRIIINTVRELGDCEGIKVKVNDYDWVLTLRNLAEIHDFE
VEEGKEENNFLNLIVYKRC
Download sequence
Identical sequences A0A088E5S9 A4YG20
399549.Msed_1211 WP_012021159.1.15515 WP_012021159.1.27320 WP_012021159.1.28583 WP_012021159.1.31166 WP_012021159.1.34633 WP_012021159.1.8883 WP_012021159.1.99084 gi|146303980|ref|YP_001191296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]