SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304178|ref|YP_001191494.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304178|ref|YP_001191494.1|
Domain Number 1 Region: 2-69,150-317
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.65e-71
Family Pyruvate kinase 0.0000355
Further Details:      
 
Domain Number 2 Region: 302-444
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 2.22e-27
Family Pyruvate kinase, C-terminal domain 0.0043
Further Details:      
 
Domain Number 3 Region: 64-149
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 6.45e-16
Family Pyruvate kinase beta-barrel domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304178|ref|YP_001191494.1|
Sequence length 445
Comment pyruvate kinase [Metallosphaera sedula DSM 5348]
Sequence
MTRRTKIVVTLGPSTEGLIPKLKDKVDIFRVNLAHGDYDSHARYFELLRSGAPDSSILAD
LPGPKLRVGDIGKMELTMGQEVLFSPDEGIVVQEPLFYRSVKPGSIILLADGLIKIRIKE
VSGDQVRGIVLTPGTLTSRKGINIPDMALDSGLTENDFKLMEEALSLGADYVGLSFVLSE
NDVMKAKEKIQGRAWIISKIEKGQAVQRLFRIVEESDGVMVARGDLGVEIGLENLPYVQR
KIIRISKQLGKPVILATQVLESMVSNPLPSRAEVIDIANSVYQGVDAIMLSDETAVGKYP
VEAVQYLDQIISSSEDKVKPLSPSPMRSPDDAVAYASSSLSELSKSHVIVVHSRSGLSAI
RVSRLRPKAMILAFTPDIKVARRLKICWGVTPISLEEGASDLNDLVSILERKCRELGVKG
NVVIVAGDPKMESGRTNLLKLHSID
Download sequence
Identical sequences A0A088E543 A4YGL8
WP_012021357.1.15515 WP_012021357.1.27320 WP_012021357.1.28583 WP_012021357.1.31166 WP_012021357.1.34633 WP_012021357.1.8883 WP_012021357.1.99084 gi|146304178|ref|YP_001191494.1| 399549.Msed_1412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]