SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304255|ref|YP_001191571.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304255|ref|YP_001191571.1|
Domain Number 1 Region: 95-215
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.59e-19
Family FHA domain 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|146304255|ref|YP_001191571.1|
Domain Number - Region: 2-23
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00192
Family Ran binding protein zinc finger-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304255|ref|YP_001191571.1|
Sequence length 218
Comment FHA domain-containing protein [Metallosphaera sedula DSM 5348]
Sequence
MTWKCTGCGTENPDDAMYCTTCGLKRPDEPVGAQSSSQEQPAEQQVQEQQQAVPPAETQV
QTQEPPVQQPVQSAEAQLVQSSAPASPTPQEQASTTPQPQVTQPQPSSQEGKYYIQFIAT
PVSALNKTKVPLDFDVFENISLGRSPENVLMIPDSEISRRHAILSKEGDTLYIEDLNSTN
GTYIYDGKVFQTVKGKVQLPKNAVVKLGNNTIIKIVRE
Download sequence
Identical sequences A0A088E5Q5 A4YGU5
399549.Msed_1490 gi|146304255|ref|YP_001191571.1| WP_012021434.1.15515 WP_012021434.1.27320 WP_012021434.1.28583 WP_012021434.1.31166 WP_012021434.1.34633 WP_012021434.1.8883 WP_012021434.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]