SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304275|ref|YP_001191591.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304275|ref|YP_001191591.1|
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily SirA-like 0.000000000115
Family SirA-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304275|ref|YP_001191591.1|
Sequence length 75
Comment hypothetical protein Msed_1510 [Metallosphaera sedula DSM 5348]
Sequence
MLFMELDLTGLCCAVPQLTLYSALKKLKPGMEIRIITDDKVVLERDIIPLLSTNDMDYSV
KQDQDNFVVTAFKRY
Download sequence
Identical sequences A0A088E5R6 A4YGW5
WP_012021454.1.15515 WP_012021454.1.27320 WP_012021454.1.28583 WP_012021454.1.31166 WP_012021454.1.34633 WP_012021454.1.8883 WP_012021454.1.99084 399549.Msed_1510 gi|146304275|ref|YP_001191591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]