SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304311|ref|YP_001191627.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304311|ref|YP_001191627.1|
Domain Number 1 Region: 4-78
Classification Level Classification E-value
Superfamily SirA-like 5.23e-26
Family SirA-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304311|ref|YP_001191627.1|
Sequence length 80
Comment SirA family protein [Metallosphaera sedula DSM 5348]
Sequence
MSQETKIAKTLDVKGMYCPGPVMETAKAIKQINVGEVLEVLATDPAAKPDIEAWARRTGH
QILDIQQQGGVTRILVKRAK
Download sequence
Identical sequences A0A088E7K4 A4YH01
399549.Msed_1548 WP_012021490.1.15515 WP_012021490.1.27320 WP_012021490.1.28583 WP_012021490.1.31166 WP_012021490.1.34633 WP_012021490.1.8883 WP_012021490.1.99084 gi|146304311|ref|YP_001191627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]