SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304327|ref|YP_001191643.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304327|ref|YP_001191643.1|
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily SirA-like 0.00000000000000392
Family SirA-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304327|ref|YP_001191643.1|
Sequence length 86
Comment hypothetical protein Msed_1564 [Metallosphaera sedula DSM 5348]
Sequence
MEELNLLDLECPEPFMKVAAKLMKMKEGRLKVMFKDPKCDDMIMEAVKLMDCKVIEHVSQ
NGTYTLVLEKRSSSGNEGKVQELGGC
Download sequence
Identical sequences A0A088E6S5 A4YH17
WP_012021506.1.15515 WP_012021506.1.27320 WP_012021506.1.28583 WP_012021506.1.31166 WP_012021506.1.34633 WP_012021506.1.8883 WP_012021506.1.99084 399549.Msed_1564 gi|146304327|ref|YP_001191643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]