SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304339|ref|YP_001191655.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304339|ref|YP_001191655.1|
Domain Number 1 Region: 6-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.75e-39
Family GHMP Kinase, N-terminal domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 179-320
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.12e-37
Family Mevalonate 5-diphosphate decarboxylase 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304339|ref|YP_001191655.1|
Sequence length 323
Comment diphosphomevalonate decarboxylase [Metallosphaera sedula DSM 5348]
Sequence
MKLEAEAVAPSNIAIVKYWGKRDRELNLPLNSSLSISLDSLWVRSRVIFDESLDKDEVII
NGKRLSENEVREYAGRVLRRFRDLYGKELFARVESTTNFPSSAGLASSAAGIAALTYASN
AALGLGLSNRELSKIARVGSGSACRSMFGGFVKWNRGELESGDDSFCEEIFPPDHWPDLV
DIIPIFGEEKKKVSSRTGMENTATSSALMRCRLQFIEETFNEVIDAIRTKNAGKFFQLTM
RHSNSMHAVILDSWPPMNYLNEKSFRVMEWVVEFGKAAYTFDAGPNPHIFVLEKDVDEVL
KFLNEIGSTKTIVSRVGKGPYLI
Download sequence
Identical sequences A0A088E8S6 A4YH29
MdR37 399549.Msed_1576 WP_012021518.1.15515 WP_012021518.1.27320 WP_012021518.1.28583 WP_012021518.1.31166 WP_012021518.1.34633 WP_012021518.1.8883 WP_012021518.1.99084 gi|146304339|ref|YP_001191655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]