SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304365|ref|YP_001191681.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304365|ref|YP_001191681.1|
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-34
Family GHMP Kinase, N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 185-312
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.56e-25
Family Mevalonate kinase 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304365|ref|YP_001191681.1|
Sequence length 316
Comment mevalonate kinase [Metallosphaera sedula DSM 5348]
Sequence
MRRVEAIVPLKLTLFGEHAVVYGEPAIAMAISETMKVTVTESDRTVISSSSLNIGNIKVD
LRDMRVESEQTGKALSFALEALNYFDEKKPALISIESSVDPSVGLGTSAAVIVGVVSAYS
KFLGYDMTNLEIAKVSRHIEKKVQGLGSRMDTFTTSLGGVLYFPRNSEDVERVNSSLNIS
GGYIRRISSTAEILRRVKAVKDKSREFDDILHLIGKLVDEARWGIEREDMETVGQLMYIN
HGLLMSLGVTSPAIDELVSTARNMGLPGCKMSGGGGGGSVVCLKSQKAELLLESRGFRLV
NTEPNQTGVVIKEIND
Download sequence
Identical sequences A0A088E5Y9 A4YH55
gi|146304365|ref|YP_001191681.1| 399549.Msed_1602 WP_012021544.1.15515 WP_012021544.1.27320 WP_012021544.1.28583 WP_012021544.1.31166 WP_012021544.1.34633 WP_012021544.1.8883 WP_012021544.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]