SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304369|ref|YP_001191685.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304369|ref|YP_001191685.1|
Domain Number 1 Region: 6-69
Classification Level Classification E-value
Superfamily SirA-like 0.0000000000589
Family SirA-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304369|ref|YP_001191685.1|
Sequence length 72
Comment hypothetical protein Msed_1606 [Metallosphaera sedula DSM 5348]
Sequence
MKEIETNEVCPVVILKVMREWRSVKGEEELVIRTPWEAVTQELEKWCNETGNQFLGYTKE
KGKFVIRLKLKR
Download sequence
Identical sequences A0A088E8V0 A4YH59
WP_012021548.1.15515 WP_012021548.1.27320 WP_012021548.1.28583 WP_012021548.1.31166 WP_012021548.1.34633 WP_012021548.1.8883 WP_012021548.1.99084 399549.Msed_1606 gi|146304369|ref|YP_001191685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]