SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304517|ref|YP_001191833.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304517|ref|YP_001191833.1|
Domain Number 1 Region: 308-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.78e-62
Family DNA gyrase/MutL, second domain 0.000000264
Further Details:      
 
Domain Number 2 Region: 14-227
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-38
Family DNA gyrase/MutL, N-terminal domain 0.0000000473
Further Details:      
 
Domain Number 3 Region: 230-303
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000000000000369
Family Topoisomerase VI-B subunit middle domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304517|ref|YP_001191833.1|
Sequence length 531
Comment DNA topoisomerase VI subunit B [Metallosphaera sedula DSM 5348]
Sequence
MSAKEKFTSISPAEFFKRNPELAGFSNPARAMYQALRELVENALDATDVHEILPSIKVII
ERTSQEKEIYRLTVEDNGIGIPPHVVPDAFGRVLYSSKYVLRQTRGMYGLGVKAAVLYSQ
MYQDKPIEITTAPLNSKRIYSFKLKIDVTKNEPIIYERGSVNNDTGYHGTSVSMYILGDW
MRAKSRVYEYIKRTYIITPYAEFYFKDPEGNVVLYPRLTNKMPVPPKEVKPHPYGVDIEL
LKNMISRQKEDTTVKEFLVKEFQSVGEKTALSVIEMAGLDPDKRVQKLTDDQLSKLVDAM
KNFPDFRPPSPEALSTIGADLIELGLKQTFNPEYVGAVTRRPKAYQGHPFIVEVGLAYGG
DIQPSEEPTVLRYANKIPLIYDEKSDVVWKVVEEIDWKRYGIEDEQLPLVVMVHLCSTKV
PYKSAGKESIADVEEIEKEIRNGIMEASRSLKTFMTEKRKEEEARKRLLTYLKYIPELAR
SLSIFVTDGKKELAPKVQEEIQNKMIDLVVTKLNIKDKDLELFKSYRVETL
Download sequence
Identical sequences A0A088E7A4 A4YHK7
gi|146304517|ref|YP_001191833.1| WP_012021696.1.15515 WP_012021696.1.27320 WP_012021696.1.28583 WP_012021696.1.31166 WP_012021696.1.34633 WP_012021696.1.8883 WP_012021696.1.99084 399549.Msed_1754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]