SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304657|ref|YP_001191973.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304657|ref|YP_001191973.1|
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.05e-31
Family Precorrin-6Y methyltransferase (CbiT) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146304657|ref|YP_001191973.1|
Sequence length 165
Comment hypothetical protein Msed_1909 [Metallosphaera sedula DSM 5348]
Sequence
MSTPHREVPHVPFVPTPEKVVLKMLEVAKVGPEDIVYDLGCGDGRIIIAAVKNFGAKKAV
GVDLSDERLKEAEQNAIQNGVRDKIELRKNNFLDENVSDATVVTLFLLTNANELLKPKFE
KELKPGTRVVSHEFEMKGWKPKEVIKVEDGNMHHLVYLYVIGEHQ
Download sequence
Identical sequences A0A088E7S3 A4YHZ7
gi|146304657|ref|YP_001191973.1| 399549.Msed_1909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]