SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304661|ref|YP_001191977.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304661|ref|YP_001191977.1|
Domain Number 1 Region: 2-138,173-384
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.04e-80
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000924
Further Details:      
 
Domain Number 2 Region: 385-540
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.55e-35
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00017
Further Details:      
 
Domain Number 3 Region: 139-173
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00000000000916
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146304661|ref|YP_001191977.1|
Sequence length 568
Comment methionyl-tRNA synthetase [Metallosphaera sedula DSM 5348]
Sequence
MKILVASAWPYVQSVPHLGNLIGSILSADVFARYARLKYGKENVVFVSGSDEHGTPIEIE
AIKRGVSPKSLTDQAHEYDRQLFLNTWNISFDNYTRTESEVHKSFVKEFLLGVSKYIKVE
EEELPYCERDKLFLPDRFVKGTCPYCGFEDARGDQCDRCGRLLTPSLLINPKCAICGTPP
VLRKTKHWFFDLRPFSEPIREWITSSQDMPENVKGTALSWVNEGLKPRSLTRDNSWGIPA
PFPGAEGKTIYVWFEALLGYLSATLEYFQGRGETERWKEFWENGKVRSYYFIGKDNIPFH
AVILPAMLLASEKNYALPTVIAATEYLMYEGQKFSKSRKIGIWIDEAPLIMEVDYWRFLL
IRMRPEEKDMNFTWTEAIRIVNSELNDDVGNLVNRVITMVNRYFQGKIPEPKNLKEVDMR
LLSRVGETLDQVSFMFEKGKLKGGTELVLTLARETNAYLNEKAPWDKVKSDVEDASNTLF
VASSAIRAIALMLYPVIPEKAKLIYDQLGLDITQERWDNAKEPLKPGHVVGKPAPVFKKL
PQDFEKNLNEILEKVRKEVEKRRPTLLK
Download sequence
Identical sequences A0A088E8K9 A4YI01
gi|146304661|ref|YP_001191977.1| MdR38 WP_012021840.1.15515 WP_012021840.1.27320 WP_012021840.1.28583 WP_012021840.1.31166 WP_012021840.1.34633 WP_012021840.1.8883 WP_012021840.1.99084 399549.Msed_1913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]