SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146304693|ref|YP_001192009.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304693|ref|YP_001192009.1|
Domain Number 1 Region: 88-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.2e-33
Family Imidazole glycerol phosphate dehydratase 0.00017
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.04e-26
Family Imidazole glycerol phosphate dehydratase 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304693|ref|YP_001192009.1|
Sequence length 193
Comment imidazoleglycerol-phosphate dehydratase [Metallosphaera sedula DSM 5348]
Sequence
MSRYVEKVRETKETKVQVKLELDGEGKVEIRTPVPFFDHMLHSMLFYMKVNATILGEDKQ
GYDDHHIVEDVGITLGQAIKDALGDRRGIKRFSSAVIPMDEALVLVAVDVSGRGYASTNL
DLKREKIGDLSTENVAHFFWSLATNAGITLHVRKLDGVNEHHIVEAAFKGVGLALGEACS
IQGEGIRSTKGSL
Download sequence
Identical sequences A0A088E6K6 A4YI33
gi|146304693|ref|YP_001192009.1| 399549.Msed_1945 WP_012021872.1.15515 WP_012021872.1.27320 WP_012021872.1.28583 WP_012021872.1.31166 WP_012021872.1.34633 WP_012021872.1.8883 WP_012021872.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]