SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146304700|ref|YP_001192016.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146304700|ref|YP_001192016.1|
Domain Number 1 Region: 166-438
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.93e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000929
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 2.93e-23
Family Seryl-tRNA synthetase (SerRS) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146304700|ref|YP_001192016.1|
Sequence length 455
Comment seryl-tRNA synthetase [Metallosphaera sedula DSM 5348]
Sequence
MSWSLLELIRNNPDSLMESLRKRNVNPQLAEKAVELDKKWRAILQEVEKLRHEHNVVSSQ
IPRLSPEERKKKIEEARNLLSIIEAKEKELKTIEEERDNILRTLPNVVHESVPVGPDDSY
NVPIKVWGKFRVYEKDVNEFLSQVKGLNPDYEIIKFKPVGHADELEAVLKLGNTAKAGEV
AGSRFYYLFEDVAWLEQALIAYALDVITSKGYSLVIPPYMLRGEVIQSVIDLDTFKDAIY
KIEGEDLYLIATAEHPIAALYFKEEIEAERLPLRYVGLSPAFRKEAGAANKDLKGIFRVH
QFNKVEQFIFSLPEDSWKFHEELLGNAEQIFQGLELPYRVVNIASGDLGACAAKKYDLEV
WMPAQAKFREMVSCSNCTDWQAFRMKIRFVDRKKNRKGFVHTLNSTAVATTRAITAILEN
NQLEDGSVVIPKVLRPYLERFQRAPKDYITPRKKS
Download sequence
Identical sequences A0A088E6X3 A4YI40
399549.Msed_1952 gi|146304700|ref|YP_001192016.1| WP_012021879.1.15515 WP_012021879.1.27320 WP_012021879.1.28583 WP_012021879.1.31166 WP_012021879.1.34633 WP_012021879.1.8883 WP_012021879.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]