SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150017859|ref|YP_001310113.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150017859|ref|YP_001310113.1|
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.28e-52
Family ROO N-terminal domain-like 0.000000453
Further Details:      
 
Domain Number 2 Region: 249-393
Classification Level Classification E-value
Superfamily Flavoproteins 3.84e-39
Family Flavodoxin-related 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150017859|ref|YP_001310113.1|
Sequence length 396
Comment beta-lactamase domain-containing protein [Clostridium beijerinckii NCIMB 8052]
Sequence
MKELRDGVYWVGATDWKVRHIHGNELSTHRGSTYNSYLIKDEKTVLIDTVWEPLTEMFLE
NLREVTDISKIDYVVMNHGEPDHSGALPALMEHIPNATVFVSKKGLESIQKHYHKEWNFK
VVSTGEKINIGKNNLVFIEAPMLHWPDSMFTYLTGENILFSNDAFGQHYASSSIFNDEVD
ETEVNQEALKYYANILTPFSKLVTKKIDELKKLGVPVDMIAPAHGIIWRKDPMMIVEKYY
EWSAGKSNKSVVVAYNSMWGATHKMAEFIGKGLGEAGVEYKIFNVATSDKSDILAEVFKS
KGIILGSSTVNSGILTSLLPLIEDLIGLKFNEKVGAAFGSYGWGGESTDILTNYLTKAKI
KVVEDGLKFKYMPNDDELEECIAFGKNFGQKVLEEF
Download sequence
Identical sequences A6LXS7
gi|150017859|ref|YP_001310113.1| WP_012059210.1.44456 WP_012059210.1.51202 WP_012059210.1.88565 WP_012059210.1.91641 290402.Cbei_3018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]