SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150019292|ref|YP_001311546.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150019292|ref|YP_001311546.1|
Domain Number 1 Region: 12-282
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.14e-47
Family ROO N-terminal domain-like 0.0000678
Further Details:      
 
Domain Number 2 Region: 565-757
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0032
Further Details:      
 
Domain Number 3 Region: 253-395
Classification Level Classification E-value
Superfamily Flavoproteins 1.44e-30
Family Flavodoxin-related 0.0064
Further Details:      
 
Domain Number 4 Region: 459-589
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.03e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0067
Further Details:      
 
Domain Number 5 Region: 413-452
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000104
Family Rubredoxin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150019292|ref|YP_001311546.1|
Sequence length 844
Comment FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium beijerinckii NCIMB 8052]
Sequence
MEILELKKNFYWTGVLDPGLKVFDIVMETEFGTSYNSYLLKTGEKTVLFETAKAKFWDGY
LSALNKLVDINDIDYIVVNHTEPDHAGSIEKLIEINPNIKIVGTQVAIGFLKNIVNRDFY
SITVKENDTLELGDKTLRFMFLPNLHWPDTMYTYIEEDKTLITCDSFGSHYSFDEILLSK
VKDNEGYLRATKYYFDCIIGPFKTPYMVKALDRIKDLDIDMICTGHGPVIDCRIDEIMEL
YKEWCTVVNPNPRKTVIIPYVSAYGYTKELAGKISEGIKDSGDIDVRSYDLVEDDKEKVI
EELGFADGILFGTPTIVGEALEPIWDLTIKMFARTHGGKLASAFGSYGWSGEGVPHIIER
LKQLRMKVVDDGFRIKFKPSDSELSEAYDYGYNFGCILQNKENPKKKSAKRTLVKCLVCG
EIFDSSLEICPVCGVGKENFVPVEIDDSNYKNNTNEIYLILGNGAAGISAATSIRERNET
CSIVLVSNENVLGYNRPMLTKSMIAKFNSKQIAVHDEAWYKENNITNVLDRELIEINAKD
KEAVFKDGIKLKYDKCIYALGAECFVPPISGKDKKEVIAIRRISDTDKITELLPKVRNAV
VIGGGVLGLEAAWELTKAKCKVTVLELADKLMGRQLDYEGGKFLEEIIKDKGIDVRLGVK
IDEIEGENSVTGVRINGGEVIAADLVVISCGIVPNSKIAQEAGIDVNRAIIVNEKMETNV
SDIYACGDCAEYNGVNYGIWPQALEMGKVAGANAAGDSLTYETVDAALTFNGANTSLYAI
GDNGKNPEIQYKTVEFKDPVKKTYKKYYFANNRLCGAILIGDTSNLAKVTQDVKESRLFK
DMFK
Download sequence
Identical sequences A6M1W0
WP_012060637.1.44456 WP_012060637.1.51202 WP_012060637.1.88565 WP_012060637.1.91641 gi|150019292|ref|YP_001311546.1| 290402.Cbei_4481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]