SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150019294|ref|YP_001311548.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150019294|ref|YP_001311548.1|
Domain Number 1 Region: 10-283
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.36e-49
Family ROO N-terminal domain-like 0.0000639
Further Details:      
 
Domain Number 2 Region: 253-395
Classification Level Classification E-value
Superfamily Flavoproteins 3.93e-35
Family Flavodoxin-related 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150019294|ref|YP_001311548.1|
Sequence length 407
Comment beta-lactamase domain-containing protein [Clostridium beijerinckii NCIMB 8052]
Sequence
MEILELKKNLYWTGVLDANLRVFDIIMETEFGTSYNSYLLKTSEKTVLFETAKAKFLDGY
LKALNKLVDIKDIDYIVVNHTEPDHAGSIEKLIEMNPNIKIIGSQVAIGFLKNIVNREFN
GIIVKENETLSLGDKTLRFMSVPNLHWPDTMYTYIEEDKTLVTCDSFGSHYSFEGILLSK
VTDNEGYLRALKYYFDCIIGPFKNPFMIKALDRIKDLEIDMICTGHGPVLDCRIDEIMEY
YKKWSNVSNPNPRKTVIIPYVSAYGYTKELAEKIAEGIKASGDIDVRVYDMVEADKDKVL
EELEFADGILFGSPTIVGEALKPIWDLTTSIFARTHGNKLASAFGSYGWSGEAVPHIIER
LKQLRMKVVDEGFRVKFKPSESELSDAYDYGYNFGFLLLNKENLNKN
Download sequence
Identical sequences A0A0B5QGQ9 A0A0K2M8H1 A0A202CMP0 A6M1W2
gi|150019294|ref|YP_001311548.1| WP_012060639.1.13860 WP_012060639.1.15846 WP_012060639.1.16915 WP_012060639.1.1793 WP_012060639.1.2274 WP_012060639.1.27559 WP_012060639.1.33930 WP_012060639.1.35420 WP_012060639.1.41106 WP_012060639.1.44456 WP_012060639.1.51202 WP_012060639.1.65774 WP_012060639.1.88565 WP_012060639.1.91641 WP_012060639.1.95078 290402.Cbei_4483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]