SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150019863|ref|YP_001312117.1| from Clostridium beijerinckii NCIMB 8052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150019863|ref|YP_001312117.1|
Domain Number 1 Region: 4-290
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.46e-49
Family ROO N-terminal domain-like 0.0000376
Further Details:      
 
Domain Number 2 Region: 253-397
Classification Level Classification E-value
Superfamily Flavoproteins 8.78e-24
Family Flavodoxin-related 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150019863|ref|YP_001312117.1|
Sequence length 399
Comment beta-lactamase domain-containing protein [Clostridium beijerinckii NCIMB 8052]
Sequence
MYCVREVTEDLYWIGGNDRRLALFENVHPIPRGVSYNSYLLLDEKTVLFDTVDWSICRQF
LENIKGVLGDRDLDYMVINHMEPDHAACIEEIVIRYPNVKIICTEKAFLFMHQFGFQIED
KVEQVKEGDTMSFGKHNVVFVSAPMVHWPEAMVTYDTTNGVLFSADAFGSFGALDGKLFN
DEVNFDRDWIDDARRYYTNIVGKYGPHVQALLKKAGTIDIKIICPLHGPVWRNDFGYLLD
KYDKWSSYTPEEKGVMIVYGTMYGNTEAAANELATRLVKKGITNVVMYDVSKTHVSYLIS
ETFKYSHVVLASVTYNLKIYPPMLDYIMDMKALNLQKRTFAIIENGSWAPQSGKLMRELL
EEMKDMTILDNEISINSSMKESDEDLMESIADSIIESMK
Download sequence
Identical sequences A0A0B5QVP1 A0A0K2M730 A0A202CNF0 A6M3I1
gi|150019863|ref|YP_001312117.1| 290402.Cbei_5055 WP_012061204.1.13860 WP_012061204.1.15846 WP_012061204.1.16915 WP_012061204.1.1793 WP_012061204.1.2274 WP_012061204.1.24330 WP_012061204.1.27559 WP_012061204.1.33930 WP_012061204.1.35420 WP_012061204.1.41106 WP_012061204.1.44456 WP_012061204.1.46861 WP_012061204.1.48361 WP_012061204.1.51202 WP_012061204.1.65774 WP_012061204.1.6721 WP_012061204.1.69068 WP_012061204.1.88565 WP_012061204.1.91641 WP_012061204.1.95078 WP_012061204.1.96201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]