SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153950010|ref|YP_001399030.1| from Yersinia pseudotuberculosis IP 31758

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153950010|ref|YP_001399030.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily HAD-like 3.28e-41
Family YihX-like 0.000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153950010|ref|YP_001399030.1|
Sequence length 196
Comment phosphatase [Yersinia pseudotuberculosis IP 31758]
Sequence
MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVFQQHERGEISDEDFAHQ
LSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNRVVVLSNTNRLHCYYWPEH
YPEVAAAADYMYLSQDLGMRKPEARIYQHVLSAENVPAEQAVFFDDVEANVLAAKAVGIN
AIHVTDRQIIPTYFSL
Download sequence
Identical sequences A0A0U1R1A5
gi|153950010|ref|YP_001399030.1| 349747.YpsIP31758_0029 WP_011991009.1.12167 WP_011991009.1.58543 WP_011991009.1.6333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]