SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225865289|ref|YP_002750667.1| from Bacillus cereus 03BB102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225865289|ref|YP_002750667.1|
Domain Number 1 Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0000589
Family Surp module (SWAP domain) 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|225865289|ref|YP_002750667.1|
Domain Number - Region: 85-186
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.0628
Family MAPEG domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225865289|ref|YP_002750667.1|
Sequence length 240
Comment hypothetical protein BCA_3399 [Bacillus cereus 03BB102]
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFIFGMISLLYEWRILLFVAVMIPFFIVNMYYARQKNERALLNDISAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
VLTVIVFAINPLCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI
Download sequence
Identical sequences A0A158RK59 B3ZI55 C2NK71
gi|225865289|ref|YP_002750667.1| 572264.BCA_3399 WP_000779962.1.24676 WP_000779962.1.2569 WP_000779962.1.26000 WP_000779962.1.3699 WP_000779962.1.44483 WP_000779962.1.4649 WP_000779962.1.62300 WP_000779962.1.69323 WP_000779962.1.9269 gi|376267196|ref|YP_005119908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]