SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257057955|ref|YP_003135843.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257057955|ref|YP_003135843.1|
Domain Number 1 Region: 11-205,315-386
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.2e-46
Family Bacterial dinuclear zinc exopeptidases 0.0014
Further Details:      
 
Domain Number 2 Region: 196-299
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 4.84e-21
Family Bacterial exopeptidase dimerisation domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257057955|ref|YP_003135843.1|
Sequence length 388
Comment peptidase M20 [Cyanothece sp. PCC 8802]
Sequence
MSSPTLTPQLAQRLRDYLHSRQGEMIELLGQLVQAESPSTVPESQKNVLSLLKQSLEERN
YQVRYVKGNQTGGHLLAIPRDRPTTQPQQLLLGHCDTVWPVGTLETMPLVRHQDKLYGPG
VYDMKGGLVQGIFALEALQAQDLTSSITPIFLINSDEEIGSQESTPHIQALAQQCDRVFV
LEPSLGATGRLKTQRKGVGRFTIRVVGKAAHAGLDPEKGASAILELSFVIQQLFALNNPE
RGITVNVGMIDGGIRSNVVAPESEAVVDVRVLHQEDVQAIETAIFALKPTTPGTELRIEG
RIGRTPMEKTPASEQLWQKARQIGAELGIELEEATAGGGSDGNTTNLYTPTLDGLGAIGD
AAHSPGEFIYLDSLVERSALLARLLIEP
Download sequence
Identical sequences B7JZI5
gi|257057955|ref|YP_003135843.1| WP_012593422.1.62203 WP_012593422.1.93053 395962.Cyan8802_0036 41431.PCC8801_0038 gi|218244930|ref|YP_002370301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]