SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257057998|ref|YP_003135886.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257057998|ref|YP_003135886.1|
Domain Number 1 Region: 3-371
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.32e-115
Family GABA-aminotransferase-like 0.0000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257057998|ref|YP_003135886.1|
Sequence length 371
Comment glutamine--scyllo-inositol transaminase [Cyanothece sp. PCC 8802]
Sequence
MTDFIPVNEPLLNGKEKEYLNECIDTGWISSEGPFVKKFEADFAQVVGRKHAISVCNGSV
ALDAAIVALGIQEGDEVILPTFTIISCGAAIVRAGAIPVVVDSDPHTWNMDIDQIEAKIS
PKTKAIMVVHIYGLPVDMTPVLELANQYGLTVIEDAAEMHGQTYKNKPCGSFGDISTFSF
YPNKHITTGEGGMIVTDDDTFAEKCRSLRNLCFQPQKRFIHEELGWNFRFTNLQAAVGLA
QLERLAEFVQRKRRMGELYTELLSGISGLQLPLAKTDYADNIYWVYGIVLSDEIPFDATE
AMEKLRQQKIGTRPFFWCMHEQPIFHKMGLLTNESCPVAERLARRGFYIPSGLALTEEQI
EQVANAVKRIF
Download sequence
Identical sequences B7K0N4
WP_012593465.1.62203 WP_012593465.1.93053 gi|218244973|ref|YP_002370344.1| 395962.Cyan8802_0080 41431.PCC8801_0082 gi|257057998|ref|YP_003135886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]