SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058162|ref|YP_003136050.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058162|ref|YP_003136050.1|
Domain Number 1 Region: 126-273
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.81e-59
Family C-terminal domain of ribosomal protein L2 0.0000016
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-49
Family Cold shock DNA-binding domain-like 0.00000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058162|ref|YP_003136050.1|
Sequence length 276
Comment 50S ribosomal protein L2 [Cyanothece sp. PCC 8802]
Sequence
MGIRSYRPYTPGTREASVSDFAEITKTEPEKSLTTYKHSRQGRNNRGVITSRHRGGGHKR
LYRIVDFRRDKHNIPAKVAAIEYDPNRNARIALLFYKDGEKRYILAPAGITVGTMVVSGE
NAPFEVGNALPLARIPLGTDVHNIELTPGKGGQMVRAAGGSAQVVAKEGDYVTLRLPSKE
VRMVRKECYATIGRVGNVEDRNIKLGKAGRTRHLGQRPHVRGSVMNPVDHPHGGGEGRAP
IGRSGPVTPWGKPALGAKTRNKKKQSSKLIVRRRTR
Download sequence
Identical sequences B7K332
gi|257058162|ref|YP_003136050.1| WP_012593629.1.62203 WP_012593629.1.93053 395962.Cyan8802_0246 41431.PCC8801_0249 gi|218245137|ref|YP_002370508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]