SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058170|ref|YP_003136058.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058170|ref|YP_003136058.1|
Domain Number 1 Region: 301-498
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-46
Family Ribonuclease PH domain 1-like 0.00000596
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-45
Family Ribonuclease PH domain 1-like 0.0000259
Further Details:      
 
Domain Number 3 Region: 461-560
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.94e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 143-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.26e-25
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 5 Region: 566-651
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.07e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 631-713
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.48e-16
Family Cold shock DNA-binding domain-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058170|ref|YP_003136058.1|
Sequence length 718
Comment polynucleotide phosphorylase/polyadenylase [Cyanothece sp. PCC 8802]
Sequence
MQEFDKSISFDGRDIRLKLGLLAPQAGGSVLIQSGDTAVLVTATRATGREGIDFLPLTVD
YEERLYAAGRIPGGFLRREGRPPEKAILISRLIDRPLRPLFPQWLRDDIQIIATTLSMDE
EVPPDVLAVTGASIAVIAARIPFFGPMAAVRVGLIGDDFIINPTYREIEIGDLDLVVAGS
PDGVVMVEAGANQLPEQDIIEAIDFGYEAVRDLIQAQRDVMEALDIPLVIGEPPAVNEVL
QSFISDRASESIKKVLMQYNLDKNARDEQLDEIKETAITNAIAELPEEDPVKVAATEEPK
AVSNLYKDLTKKLMRSQIITDGVRVDGRKLDEVRPISSRVCLLPRRVHGSALFARGLTQV
LSLATLGTPGDAQDLADDLHPEDEKRYLHHYNFPPFSVGETKPLRSPGRREIGHGALAER
AITPILPPQEEFPYVIRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPITKPVSGAAMGLI
KEGDEVRILTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKITGLSMEIVAKAIEQALPA
RLHILDKMMETLSTPRKNLSPYAPRLLTMKIDPEQIGLVIGPGGKTIKGITEQTGSKIDI
ADDGTVTIAALEAEKAEKAKQIIYNMTRKLNEGEVYMGRVTRIIQIGAFVEVLPGKEGMI
HISQLAEGRVGKVEDEVAVGDEVIVKVREIDAKGRLNLTRLGIHPDEAAAARKAVAPV
Download sequence
Identical sequences B7K339
395962.Cyan8802_0256 41431.PCC8801_0258 WP_012593636.1.62203 WP_012593636.1.93053 gi|218245144|ref|YP_002370515.1| gi|257058170|ref|YP_003136058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]